RPSBLAST alignment for GI: 254780853 and conserved domain: PRK14815

>gnl|CDD|184832 PRK14815, PRK14815, NADH dehydrogenase subunit B; Provisional. Length = 183
 Score =  183 bits (466), Expect = 2e-47
 Identities = 80/144 (55%), Positives = 107/144 (74%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDV 95
             +VT++D  + W R  SL  M  GLACCA+E+M  +  R+D+ RFG    R SPRQ+DV
Sbjct: 17  NVVVTTLDAAINWIRKNSLWPMPMGLACCAIELMAVACSRFDISRFGAEVMRFSPRQADV 76

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGT+T KMA A+RR+YDQMPEP++VI+MG+CA+ GG Y  SYSV++G DRI+PVD+Y
Sbjct: 77  MIVAGTVTYKMALAVRRIYDQMPEPKWVIAMGACASSGGMYR-SYSVLQGVDRILPVDVY 135

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           + GCPP  EA++  ++ LQKKI  
Sbjct: 136 ISGCPPRPEAILDALIKLQKKIDT 159