RPSBLAST alignment of GI: 254780853 and protein with PDBid: 1yq9

>1yq9_A Periplasmic [NIFE] hydrogenase small subunit; oxidoreductase; 2.35A {Desulfovibrio gigas} SCOP: e.19.1.1 PDB: 2frv_S 1frv_A Length = 264
 Score = 78.1 bits (192), Expect = 1e-15
 Identities = 23/156 (14%), Positives = 51/156 (32%), Gaps = 37/156 (23%)

Query: 54  SLMWMTFGLAC--CAVEMMQASMPRYDLERFGF-------------------APRASPRQ 92
           S++++     C  C+  +++   P  D                         A   + + 
Sbjct: 8   SVVYLHNA-ECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKG 66

Query: 93  SDVMIVAGTLTNKMA---------SALRRVYDQMPEPRYVISMGSCANGGG--YYHYSYS 141
             V ++ G +              +      +  P+ + VI++G+CA  GG      + +
Sbjct: 67  DFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPT 126

Query: 142 VVRGCDRIVP----VDIYVPGCPPTAEALIYGILLL 173
              G +  +       I + GCPP     +  ++ L
Sbjct: 127 GTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHL 162