BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780853|ref|YP_003065266.1| NADH dehydrogenase subunit B [Candidatus Liberibacter asiaticus str. psy62] (185 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780853|ref|YP_003065266.1| NADH dehydrogenase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 385 bits (989), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/185 (100%), Positives = 185/185 (100%) Query: 1 MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60 MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF Sbjct: 1 MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60 Query: 61 GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120 GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP Sbjct: 61 GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120 Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV Sbjct: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180 Query: 181 GNVKC 185 GNVKC Sbjct: 181 GNVKC 185 >gi|254781062|ref|YP_003065475.1| putative aminotransferase involved in iron-sulfur cluster biogenesis [Candidatus Liberibacter asiaticus str. psy62] Length = 406 Score = 22.7 bits (47), Expect = 4.5, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 155 YVPGCPPTAEALIYGILL 172 + PG PP ++A+ G+ L Sbjct: 273 FEPGTPPISQAIALGVAL 290 >gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Score = 21.9 bits (45), Expect = 7.1, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 5 TVNQKIISGQSSCSLEKVD 23 T+N II+GQ S +K++ Sbjct: 84 TINANIITGQIELSAQKIE 102 >gi|254781091|ref|YP_003065504.1| putative pyridoxal-phosphate-dependent aminotransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 383 Score = 21.9 bits (45), Expect = 7.8, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 2 GLTTVNQKIISGQSSCSLEKVDADFSRISSE 32 G+ V+ +G+ S+E++ ADF ISS Sbjct: 175 GILVVDAVQAAGRIPLSIEEIKADFLIISSH 205 >gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 21.6 bits (44), Expect = 9.7, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query: 158 GCPPTAEALIYGIL-LLQKKIRRVGNVKC 185 GCP +E L YG+ +L + V +++ Sbjct: 160 GCPSASETLKYGVANILNHFVPEVKDIRT 188 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.136 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,268 Number of Sequences: 1233 Number of extensions: 4196 Number of successful extensions: 12 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 5 length of query: 185 length of database: 328,796 effective HSP length: 69 effective length of query: 116 effective length of database: 243,719 effective search space: 28271404 effective search space used: 28271404 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 36 (18.5 bits)