HHsearch alignment for GI: 254780854 and conserved domain: PRK11742

>PRK11742 bifunctional NADH:ubiquinone oxidoreductase subunit C/D; Provisional.
Probab=100.00  E-value=0  Score=344.42  Aligned_cols=143  Identities=41%  Similarity=0.734  Sum_probs=130.8

Q ss_pred             HHHHHHHCCCCEEEEEEE-CCCEEEEECHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCC-------EEEEEEEEE
Q ss_conf             999998615311457984-795999986898999999987187898014751325688777785-------799999661
Q gi|254780854|r    9 GDYIVNSFSGSVRFAVNS-VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLS   80 (202)
Q Consensus         9 ~~~L~~~l~~~I~~~~~~-~~el~i~V~~~~l~~vl~~LKdd~~~~F~~LiDItaVDyp~~~~R-------FeVvY~LlS   80 (202)
T Consensus         2 ~~~L~~~Fg~~~~~~~~~~~~~~~~~v~~~~~~~v~~~L~~~~-~~f~~L~dl~~vD~~~r~~r~~~~~~~f~vvyhl~s   80 (575)
T PRK11742          2 IGELRNRFGPDAFTVQATRTGVPVVWIKREQLLEVLRFLRKLP-KPYVMLFDLHGIDERLRTHREGLPAADFTVFYHLIS   80 (575)
T ss_pred             HHHHHHHHCHHHCCEEECCCCCEEEEECHHHHHHHHHHHHCCC-CCCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEE
T ss_conf             3789866123423101112895699986888999999985385-103501244554153334556688787799999863


Q ss_pred             CCCCCEEEEEEEECCCCE-EECCCCCEECCCCEECCCHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             575205998212057850-101223302553101121011382735679876778899898787113377898
Q gi|254780854|r   81 PKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG  152 (202)
Q Consensus        81 ~~~n~ri~Vk~~v~e~~~-vpSi~~i~p~A~W~ERE~~DmfGI~F~gHPdlRRiL~d~~feGhPLRKDFPltG  152 (202)
T Consensus        81 ~~~n~~irvk~~~~~~~~~~~s~~~~~~~a~w~Ere~~d~~Gi~f~ghp~~rr~~~~~~~~~~plrkd~~~~~  153 (575)
T PRK11742         81 IERNRDIMLKVALSENDLRVPTITKIFPNANWYERETWDMFGITFDGHPHLRRILMPPTWEGHPLRKDYPARA  153 (575)
T ss_pred             CCCCCEEEEEEECCCCCCCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
T ss_conf             6889669999865787898981566333675788888762386637999862121677678888767775445