Query         gi|254780854|ref|YP_003065267.1| NADH dehydrogenase subunit C [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 202
No_of_seqs    224 out of 1237
Neff          5.9 
Searched_HMMs 13730
Date          Wed Jun  1 10:31:32 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780854.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2fug51 d.307.1.1 (5:1-196) NA 100.0       0       0  330.1   8.2  149    8-159     3-165 (196)
  2 d1asha_ a.1.1.2 (A:) Ascaris h  22.4     4.9 0.00036   18.5  -1.3   28  116-145    27-54  (147)
  3 g1o7d.2 b.30.5.6 (C:488-585,D:  21.8      11 0.00083   16.2   0.5   16  131-146   307-323 (490)
  4 d1es6a2 b.31.1.1 (A:201-321) E  19.6      13 0.00098   15.8   0.5   14   35-48     33-46  (121)
  5 d1kr7a_ a.1.1.4 (A:) Nerve tis  14.2      10 0.00076   16.5  -1.2   24  118-144    10-33  (110)
  6 d1pd0a2 b.2.8.1 (A:133-215,A:5  13.7      37  0.0027   13.1   2.8   36   72-109   142-177 (177)
  7 d2gycj1 c.12.1.1 (J:4-143) Rib  11.8      42  0.0031   12.8   2.1   37  135-177    43-81  (140)
  8 d2zjri1 c.12.1.1 (I:4-144) Rib  10.3      43  0.0031   12.8   1.0   32  137-175    44-77  (141)
  9 d1jqga2 d.58.3.1 (A:4P-100P) P   9.7      50  0.0037   12.3   4.2   31   28-59     42-72  (92)
 10 d2j01p1 c.12.1.1 (P:5-150) Rib   8.1      48  0.0035   12.5   0.5   38  136-174    44-83  (146)

No 1  
>d2fug51 d.307.1.1 (5:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}
Probab=100.00  E-value=0  Score=330.13  Aligned_cols=149  Identities=35%  Similarity=0.631  Sum_probs=127.5

Q ss_pred             HHHHHHHHCCCCEEEEEEECCCEEEEECHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCC----CCCCEEEEEEEEECC-
Q ss_conf             999999861531145798479599998689899999998718789801475132568877----778579999966157-
Q gi|254780854|r    8 LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS----RSNRFDVVYHFLSPK-   82 (202)
Q Consensus         8 L~~~L~~~l~~~I~~~~~~~~el~i~V~~~~l~~vl~~LKdd~~~~F~~LiDItaVDyp~----~~~RFeVvY~LlS~~-   82 (202)
                      |.+.|++.....+.......|+++|.|+++++.+++++||+   ++|++|+|||||||+.    .++||+|||||+|+. 
T Consensus         3 le~~Le~a~~~g~~ve~~~~g~l~I~V~~e~l~evl~~LKe---~gF~~L~dITaVD~~~~~e~~~~rfevvYhL~S~~~   79 (196)
T d2fug51           3 LERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKA---MGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPG   79 (196)
T ss_dssp             HHHHHHHHHTTTCCEEECSSSCEEEECCSTTHHHHHHHTTT---TTCCCCCCEEEEECTTCSSCCSSSEEEEEEEECCTT
T ss_pred             HHHHHHHHHHCCCEEEECCCCCEEEEECHHHHHHHHHHHHH---CCCCCEEEEEEECCCCCCCCCCCEEEEEEEEEEEEE
T ss_conf             89999986733770101348838999859999999999986---799816578848688767676640699987888864


Q ss_pred             ----CCCEEEEEEEECC-CCEEECCCCCEECCCCEECCCHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCC----C
Q ss_conf             ----5205998212057-850101223302553101121011382735679876778899898787113377898----4
Q gi|254780854|r   83 ----YNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG----F  153 (202)
Q Consensus        83 ----~n~ri~Vk~~v~e-~~~vpSi~~i~p~A~W~ERE~~DmfGI~F~gHPdlRRiL~d~~feGhPLRKDFPltG----~  153 (202)
                          .+.+|+|||.+++ ++.||||++|||+|||+|||+||||||.|+|||||||||++++|+||||||||||.|    |
T Consensus        80 ~~~~~~~~v~vkv~vp~~~p~ipSi~~i~p~A~w~ERE~~dmfGi~f~ghpd~rr~llpd~~~g~PlRKdfpl~~~~~~~  159 (196)
T d2fug51          80 WKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLF  159 (196)
T ss_dssp             SSSCCCCEEEEEEEECSSCCCCCCCCC-----CCCHHHHHHHHHHSSCCCSSCSCCCCSSCSSSCSSSTTSCCCCCCEEC
T ss_pred             CCCCCCCEEEEEEEECCCCCEEEEEECCEECCEEEECCCCEEECEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             04788638999997235663122342318065101303526608697898888565579999989877676688865555


Q ss_pred             EEEEEC
Q ss_conf             478876
Q gi|254780854|r  154 VELHYD  159 (202)
Q Consensus       154 ~evryd  159 (202)
                      .|+||+
T Consensus       160 ~~~~~~  165 (196)
T d2fug51         160 REGRYI  165 (196)
T ss_dssp             TTSCEE
T ss_pred             CCCCCC
T ss_conf             255307


No 2  
>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
Probab=22.40  E-value=4.9  Score=18.49  Aligned_cols=28  Identities=29%  Similarity=0.407  Sum_probs=21.2

Q ss_pred             CHHHCCCEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             101138273567987677889989878711
Q gi|254780854|r  116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLR  145 (202)
Q Consensus       116 ~~DmfGI~F~gHPdlRRiL~d~~feGhPLR  145 (202)
                      .-+||.-.|+.||++|.+..  .|.+.|..
T Consensus        27 G~~~f~~LF~~~P~~k~~F~--~f~~~~~~   54 (147)
T d1asha_          27 GIDLYKHMFENYPPLRKYFK--SREEYTAE   54 (147)
T ss_dssp             HHHHHHHHHHHCGGGGGGST--TTTTCCHH
T ss_pred             HHHHHHHHHHHCHHHHHHCC--CCCCCCHH
T ss_conf             99999999998987887642--12469988


No 3  
>g1o7d.2 b.30.5.6 (C:488-585,D:603-875,E:885-1007) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}
Probab=21.75  E-value=11  Score=16.24  Aligned_cols=16  Identities=50%  Similarity=0.744  Sum_probs=6.9

Q ss_pred             CCCCCCCCC-CCCCCCC
Q ss_conf             677889989-8787113
Q gi|254780854|r  131 RRILTDYGF-EGHPLRK  146 (202)
Q Consensus       131 RRiL~d~~f-eGhPLRK  146 (202)
                      ||++.|.++ .|.|+.-
T Consensus       307 R~~~~~D~rG~g~~~~d  323 (490)
T g1o7d.2         307 RRLLKDDARGVGEPLNK  323 (490)
T ss_dssp             EECSSCCSSSCCSCSCC
T ss_pred             ECCCCCCCCCCCCCCCC
T ss_conf             41457876455766554


No 4  
>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus [TaxId: 205488]}
Probab=19.57  E-value=13  Score=15.83  Aligned_cols=14  Identities=14%  Similarity=0.247  Sum_probs=6.8

Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             68989999999871
Q gi|254780854|r   35 DCGDLVSLCSFLRD   48 (202)
Q Consensus        35 ~~~~l~~vl~~LKd   48 (202)
                      .++++..++.++.|
T Consensus        33 spdkiq~imn~~qd   46 (121)
T d1es6a2          33 SPEKIQAIMTSLQD   46 (121)
T ss_dssp             CHHHHHHHHHHGGG
T ss_pred             CHHHHHHHHHHCCC
T ss_conf             88999999986023


No 5  
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}
Probab=14.16  E-value=10  Score=16.51  Aligned_cols=24  Identities=33%  Similarity=0.765  Sum_probs=18.6

Q ss_pred             HHCCCEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             113827356798767788998987871
Q gi|254780854|r  118 DMYGIFFEGHPDLRRILTDYGFEGHPL  144 (202)
Q Consensus       118 DmfGI~F~gHPdlRRiL~d~~feGhPL  144 (202)
                      |+|...|+-||+.+++..   |.|.|+
T Consensus        10 ~ff~~LF~~~Pe~~~~F~---f~~~~~   33 (110)
T d1kr7a_          10 DFYQELFKAHPEYQNKFG---FKGVAL   33 (110)
T ss_dssp             HHHHHHHHHCGGGGGGST---TTTCCG
T ss_pred             HHHHHHHHHCHHHHHHCC---CCCCCH
T ss_conf             999999998968897777---642102


No 6  
>d1pd0a2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=13.73  E-value=37  Score=13.14  Aligned_cols=36  Identities=19%  Similarity=0.274  Sum_probs=22.6

Q ss_pred             EEEEEEEEECCCCCEEEEEEEECCCCEEECCCCCEECC
Q ss_conf             79999966157520599821205785010122330255
Q gi|254780854|r   72 FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGA  109 (202)
Q Consensus        72 FeVvY~LlS~~~n~ri~Vk~~v~e~~~vpSi~~i~p~A  109 (202)
                      |++.....+...-.||||-+..  -+...++.+||.+|
T Consensus       142 ~Q~AlLYTs~~GeRRIRV~T~~--lpvts~l~evf~sA  177 (177)
T d1pd0a2         142 VQVAVLLSLNNSQRRIRIITLA--MPTTESLAEVYASA  177 (177)
T ss_dssp             EEEEEEEEETTTEEEEEEEEEE--EEEESCHHHHHHTB
T ss_pred             EEEEEEEECCCCCEEEEEEEEC--CCCCCCHHHHHHCC
T ss_conf             9999988859998899999531--01307899998539


No 7  
>d2gycj1 c.12.1.1 (J:4-143) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]}
Probab=11.83  E-value=42  Score=12.78  Aligned_cols=37  Identities=30%  Similarity=0.533  Sum_probs=27.5

Q ss_pred             CCCCCCC--CCCCCCCCCCCCEEEEECHHHCEEECCCCEEEEHHH
Q ss_conf             8998987--871133778984478876211513126642202221
Q gi|254780854|r  135 TDYGFEG--HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR  177 (202)
Q Consensus       135 ~d~~feG--hPLRKDFPltG~~evryd~~~k~v~~epv~l~q~~r  177 (202)
                      ..-+|||  .||-+=+|--||.      ...+..|++++|.+--+
T Consensus        43 ~r~gfEGGQ~Pl~rr~PK~Gf~------~~~~~~~~~i~l~~l~~   81 (140)
T d2gycj1          43 VRRGFEGGQMPLYRRLPKFGFT------SRKAAITAEIRLSDLAK   81 (140)
T ss_dssp             SSCSCCSSCSSSSSSSSSCCCC------CCCCCCCCCBCCSSSSS
T ss_pred             CCCCCCCCCCCCEEECCEEECC------CCCCCEEEEEEEEEEHH
T ss_conf             7875247766655407603022------22321266677432011


No 8  
>d2zjri1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
Probab=10.29  E-value=43  Score=12.75  Aligned_cols=32  Identities=34%  Similarity=0.457  Sum_probs=23.0

Q ss_pred             CCCCC--CCCCCCCCCCCCEEEEECHHHCEEECCCCEEEEH
Q ss_conf             98987--8711337789844788762115131266422022
Q gi|254780854|r  137 YGFEG--HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQE  175 (202)
Q Consensus       137 ~~feG--hPLRKDFPltG~~evryd~~~k~v~~epv~l~q~  175 (202)
                      -+|||  .||-+=+|--||.-+       +..|++|+|.+=
T Consensus        44 ~gfeGGQ~Pl~rrlPKrGf~~~-------~~~~~~inl~~l   77 (141)
T d2zjri1          44 AFFEGGRSRLIARLPKRGFNNV-------GTTYEVVKLSQL   77 (141)
T ss_dssp             CSCSCCSSSSTTTSCCCCCCCC-------CCCCCEECHHHH
T ss_pred             CCEECCCCCCEECCCCCCCCCC-------CCEEEEEEHHHH
T ss_conf             7450166653541774577766-------526888886352


No 9  
>d1jqga2 d.58.3.1 (A:4P-100P) Procarboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
Probab=9.65  E-value=50  Score=12.32  Aligned_cols=31  Identities=10%  Similarity=-0.040  Sum_probs=24.7

Q ss_pred             CCEEEEECHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             95999986898999999987187898014751
Q gi|254780854|r   28 GELSLDVDCGDLVSLCSFLRDDPHCCFVNIID   59 (202)
Q Consensus        28 ~el~i~V~~~~l~~vl~~LKdd~~~~F~~LiD   59 (202)
                      ....|.|+|..+..+..+|+.. +..|..+++
T Consensus        42 ~~vdI~V~p~~~~~f~~~L~~~-~i~y~v~i~   72 (92)
T d1jqga2          42 RPGKVLVPKFKREIFENFLKQS-GVQYKLEVE   72 (92)
T ss_dssp             BCEEEEECGGGHHHHHHHHHHH-TCEEEEEES
T ss_pred             CEEEEEECHHHHHHHHHHHHHC-CCEEEEEEC
T ss_conf             8689998989999999999986-984899830


No 10 
>d2j01p1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
Probab=8.09  E-value=48  Score=12.46  Aligned_cols=38  Identities=24%  Similarity=0.329  Sum_probs=25.2

Q ss_pred             CCCCCC--CCCCCCCCCCCCEEEEECHHHCEEECCCCEEEE
Q ss_conf             998987--871133778984478876211513126642202
Q gi|254780854|r  136 DYGFEG--HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ  174 (202)
Q Consensus       136 d~~feG--hPLRKDFPltG~~evryd~~~k~v~~epv~l~q  174 (202)
                      +-+|||  .||-+=+|--||.-..-. ...++.|..|+|.+
T Consensus        44 ~~gFEGGQ~Pl~rrlPK~Gf~~~~~~-~~~~~~~~~inl~~   83 (146)
T d2j01p1          44 PRRFEGGRSTTLMRLPKRGMQGQVPG-EIKRPRYQGVNLKD   83 (146)
T ss_dssp             SSSCCSSSCTTCCSCCCCCSCCCSSC-SCCCCCEEEEETTT
T ss_pred             CCHHCCCCCCCEECCCHHHHHCCCCC-CEEEEEEEHHHHHH
T ss_conf             73210688785440651654155523-11357752234666


Done!