BLAST/PSIBLAST alignment of GI: 254780854 and GI: 150396113 at iteration 1
>gi|150396113|ref|YP_001326580.1| NADH dehydrogenase subunit C [Sinorhizobium medicae WSM419] Length = 201
>gi|218534338|sp|A6U7W5|NUOC_SINMW RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit C Length = 201
>gi|150027628|gb|ABR59745.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium medicae WSM419] Length = 201
 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 139/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  YI  +    V  +    GEL+L      L++L +FLRDD  C FV+ ID+
Sbjct: 1   MSEALNELASYIREARGALVAGSEVRYGELTLTTKAESLIALLTFLRDDVQCGFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N+R+RVK+A  E + VPSI  +YPGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNQRIRVKVATGENEPVPSITSVYPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189