BLAST/PSIBLAST alignment of GI: 254780854 and GI: 222085577 at iteration 1
>gi|222085577|ref|YP_002544107.1| NADH-ubiquinone oxidoreductase chain C protein [Agrobacterium radiobacter K84] Length = 200
>gi|254767808|sp|B9JD44|NUOC_AGRRK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit C Length = 200
>gi|221723025|gb|ACM26181.1| NADH-ubiquinone oxidoreductase chain C protein [Agrobacterium radiobacter K84] Length = 200
 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 138/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+       +  +    GEL++     ++++L +FLRDD  C FVN+ D+
Sbjct: 1   MSEALNELATYLTEVRGALISSSEIKYGELNVTTTAENVIALLTFLRDDAKCGFVNMTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSPK N R+R+K+ VAE + VPS  GIYPGADWFERE WDMY
Sbjct: 61  CGVDWPQRPDRFDVVYHLLSPKKNLRIRIKVPVAEDQPVPSACGIYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189