BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780854|ref|YP_003065267.1| NADH dehydrogenase subunit C
[Candidatus Liberibacter asiaticus str. psy62]
         (202 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780854|ref|YP_003065267.1| NADH dehydrogenase subunit C [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040531|gb|ACT57327.1| NADH dehydrogenase subunit C [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 202

 Score =  410 bits (1055), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/202 (100%), Positives = 202/202 (100%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL
Sbjct: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY
Sbjct: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD
Sbjct: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180

Query: 181 FLSPWEGVNSLFAKEDSKDDMS 202
           FLSPWEGVNSLFAKEDSKDDMS
Sbjct: 181 FLSPWEGVNSLFAKEDSKDDMS 202


>gi|315122724|ref|YP_004063213.1| NADH dehydrogenase subunit C [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496126|gb|ADR52725.1| NADH dehydrogenase subunit C [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 198

 Score =  322 bits (824), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/195 (80%), Positives = 176/195 (90%), Gaps = 1/195 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +ED+GDYIVNSF  SVR  +NSVGELSLDVDCGDL+SLC FLRDD +C FVNI+DLCGVD
Sbjct: 1   MEDIGDYIVNSFGRSVRSTINSVGELSLDVDCGDLLSLCYFLRDDSNCRFVNIVDLCGVD 60

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           FLSRS+RFDVVYHFLSPKYN R+RVK+AV+EG S+PS+V +YP A+WFEREV DMYGI F
Sbjct: 61  FLSRSSRFDVVYHFLSPKYNCRVRVKVAVSEGDSIPSMVEVYPAANWFEREVLDMYGIKF 120

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           EGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL YDDK KKVVY PVELMQE+RDYDFLSP
Sbjct: 121 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELRYDDKAKKVVYSPVELMQEYRDYDFLSP 180

Query: 185 WEGVNSLFAKEDSKD 199
           WEG + LFA +DS++
Sbjct: 181 WEG-SPLFADKDSEN 194


>gi|319782983|ref|YP_004142459.1| NADH (or F420H2) dehydrogenase subunit C [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168871|gb|ADV12409.1| NADH (or F420H2) dehydrogenase, subunit C [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 200

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 113/189 (59%), Positives = 142/189 (75%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+     G V  A  + GEL++ V+  DLV + +FLRDD  C F++IID+
Sbjct: 1   MTASLSELSTYLGEKLIGRVNEADIAYGELTIHVEPRDLVEVMTFLRDDARCQFISIIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CG D+ SR+ RFDVVYH LSPK N R+RVK+   E   VPSI G+YPGADWFERE +D+Y
Sbjct: 61  CGADYPSRAKRFDVVYHLLSPKQNVRVRVKVQADEETMVPSITGVYPGADWFERETYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YDD+ K+V+Y PVEL QE R++D
Sbjct: 121 GVLFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDDEAKRVIYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|222085577|ref|YP_002544107.1| NADH-ubiquinone oxidoreductase chain C protein [Agrobacterium
           radiobacter K84]
 gi|254767808|sp|B9JD44|NUOC_AGRRK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|221723025|gb|ACM26181.1| NADH-ubiquinone oxidoreductase chain C protein [Agrobacterium
           radiobacter K84]
          Length = 200

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 138/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+       +  +    GEL++     ++++L +FLRDD  C FVN+ D+
Sbjct: 1   MSEALNELATYLTEVRGALISSSEIKYGELNVTTTAENVIALLTFLRDDAKCGFVNMTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSPK N R+R+K+ VAE + VPS  GIYPGADWFERE WDMY
Sbjct: 61  CGVDWPQRPDRFDVVYHLLSPKKNLRIRIKVPVAEDQPVPSACGIYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|163759541|ref|ZP_02166626.1| NADH-ubiquinone oxidoreductase chain C protein [Hoeflea
           phototrophica DFL-43]
 gi|162283138|gb|EDQ33424.1| NADH-ubiquinone oxidoreductase chain C protein [Hoeflea
           phototrophica DFL-43]
          Length = 200

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 144/197 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   ++DL DY+       +  +  + GEL+L     +L+ L +FLRDD  C FVN ID 
Sbjct: 1   MSDALKDLSDYLGEIRGNLIESSEIAYGELTLIAQPANLIELMTFLRDDAQCQFVNFIDC 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R+ RFDVVYH LSP+ N R+RVK+A AE   VPS+  +YPGADWFERE +D+Y
Sbjct: 61  CGVDWPGRAERFDVVYHLLSPRQNIRIRVKVATAEDAPVPSLTAVYPGADWFEREAYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFP+TGFVE+ YDD+VK+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYDDEVKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           FLSPWEG + +   ++ 
Sbjct: 181 FLSPWEGTDYVLPGDEK 197


>gi|222148276|ref|YP_002549233.1| NADH dehydrogenase subunit C [Agrobacterium vitis S4]
 gi|254767809|sp|B9JVE7|NUOC_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|221735264|gb|ACM36227.1| NADH ubiquinone oxidoreductase chain C [Agrobacterium vitis S4]
          Length = 200

 Score =  247 bits (630), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 142/189 (75%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   ++ L  +I  +  G    +  + GEL++     ++ +L +FLRDD  C F+NIID+
Sbjct: 1   MSEALQVLASHITENSGGLALSSTVAFGELTVTTTVENIYALVTFLRDDARCGFINIIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RF+VVYHFL+PK N+R+RVK++ +E K VPSI  ++PGADWFERE WD+Y
Sbjct: 61  CGVDYPERVERFEVVYHFLAPKQNQRIRVKLSTSEDKPVPSICPLFPGADWFEREAWDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YDD VK+VVY PVEL QE R +D
Sbjct: 121 GVMFTGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDDTVKRVVYEPVELKQEFRSFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|260462232|ref|ZP_05810476.1| NADH (or F420H2) dehydrogenase, subunit C [Mesorhizobium
           opportunistum WSM2075]
 gi|259032092|gb|EEW33359.1| NADH (or F420H2) dehydrogenase, subunit C [Mesorhizobium
           opportunistum WSM2075]
          Length = 200

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 142/189 (75%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+     G    AV + GEL++ V+  +LV + +FLRDD  C F++IID+
Sbjct: 1   MAASLSELSTYLGEKLPGRFSDAVLAYGELTVHVEPQNLVEVVTFLRDDARCQFISIIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CG D+ SR+ RFDVVYH LSP+ N R+RVK+   E   VPSI G++PGADWFERE +D+Y
Sbjct: 61  CGADYPSRAKRFDVVYHLLSPRQNVRIRVKVQADEETMVPSITGVFPGADWFERETYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YDD+ K+V+Y PVEL QE R++D
Sbjct: 121 GVLFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDDEAKRVIYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|190891287|ref|YP_001977829.1| NADH-ubiquinone oxidoreductase, chain C [Rhizobium etli CIAT 652]
 gi|218528026|sp|B3PVZ9|NUOC1_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit C 1; AltName:
           Full=NADH dehydrogenase I subunit C 1; AltName:
           Full=NDH-1 subunit C 1
 gi|190696566|gb|ACE90651.1| NADH-ubiquinone oxidoreductase protein, chain C [Rhizobium etli
           CIAT 652]
          Length = 200

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/189 (59%), Positives = 135/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +L+ L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQLKYGELTLTATGENLIPLLTFLRDDAKCGFVNLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   VPS  G+YPGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKKNLRIRVKVATDEDTPVPSACGLYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           F+SPWEG  
Sbjct: 181 FMSPWEGTE 189


>gi|150396113|ref|YP_001326580.1| NADH dehydrogenase subunit C [Sinorhizobium medicae WSM419]
 gi|218534338|sp|A6U7W5|NUOC_SINMW RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|150027628|gb|ABR59745.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium medicae
           WSM419]
          Length = 201

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 139/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  YI  +    V  +    GEL+L      L++L +FLRDD  C FV+ ID+
Sbjct: 1   MSEALNELASYIREARGALVAGSEVRYGELTLTTKAESLIALLTFLRDDVQCGFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N+R+RVK+A  E + VPSI  +YPGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNQRIRVKVATGENEPVPSITSVYPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|116251468|ref|YP_767306.1| NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241204088|ref|YP_002975184.1| NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|218534325|sp|Q1MIL3|NUOC_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|115256116|emb|CAK07197.1| putative NADH-quinone oxidoreductase subunit C [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240857978|gb|ACS55645.1| NADH (or F420H2) dehydrogenase, subunit C [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 200

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/189 (59%), Positives = 135/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +LV+L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQMKYGELTLTTTGENLVALLTFLRDDAKCGFVNLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   VPS   +YPGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKKNLRIRVKVATDEDTPVPSACPVYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           F+SPWEG  
Sbjct: 181 FMSPWEGTE 189


>gi|86357238|ref|YP_469130.1| NADH dehydrogenase subunit C [Rhizobium etli CFN 42]
 gi|123512313|sp|Q2K9T3|NUOC_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|86281340|gb|ABC90403.1| NADH-ubiquinone oxidoreductase chain C protein [Rhizobium etli CFN
           42]
          Length = 200

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +L++L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQLKYGELTLTATGENLIALLTFLRDDAKCGFVNMIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   VPS   +YPGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKKNLRIRVKVATDEDTPVPSACAVYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           F+SPWEG  
Sbjct: 181 FMSPWEGTE 189


>gi|325292634|ref|YP_004278498.1| NADH dehydrogenase I, C subunit [Agrobacterium sp. H13-3]
 gi|325060487|gb|ADY64178.1| NADH dehydrogenase I, C subunit [Agrobacterium sp. H13-3]
          Length = 200

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/189 (60%), Positives = 140/189 (74%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + DL  Y+  +    V  A  + GEL+L+     +++L +FLRDD  C FVNIID+
Sbjct: 1   MSEALNDLAAYVKEARGSLVVSADIAYGELTLNTTTESVIALLTFLRDDVQCGFVNIIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSP+ N R+R+K+ VAE + VPS   +Y GADWFERE WDMY
Sbjct: 61  CGVDWPQREKRFDVVYHLLSPRQNLRVRIKLQVAEDEGVPSATSVYMGADWFEREAWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI FEGH DLRRILTDYGFEGHPLRKDFPVTGFVE+ YDD +K+V+Y PVEL QE R++D
Sbjct: 121 GIPFEGHADLRRILTDYGFEGHPLRKDFPVTGFVEVRYDDVLKRVLYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|227821619|ref|YP_002825589.1| NADH dehydrogenase subunit C [Sinorhizobium fredii NGR234]
 gi|227340618|gb|ACP24836.1| NADH-quinone oxidoreductase chain C 1 [Sinorhizobium fredii NGR234]
          Length = 200

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 139/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  A    GEL+L     +L+ L +FLRDD  C F++ ID+
Sbjct: 1   MSEALNELATYLREARGSLIADAAIKYGELTLTATAENLIELLTFLRDDARCGFISFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N R+RVK+A A+G  VPS   +YPGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNLRVRVKVATADGDPVPSATPVYPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YDD+VK+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPMTGFVEVRYDDEVKRVVYEPVELRQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|218660526|ref|ZP_03516456.1| NADH dehydrogenase subunit C [Rhizobium etli IE4771]
          Length = 200

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 111/189 (58%), Positives = 134/189 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +L+ L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQMKYGELTLTATGENLIPLLTFLRDDAKCGFVNLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   +PS   +YPGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKQNLRIRVKVATDEDTPIPSACAVYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           F+SPWEG  
Sbjct: 181 FMSPWEGTE 189


>gi|209548864|ref|YP_002280781.1| NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226737322|sp|B5ZYL4|NUOC_RHILW RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|209534620|gb|ACI54555.1| NADH (or F420H2) dehydrogenase, subunit C [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 200

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/189 (58%), Positives = 136/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +L++L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQMKYGELTLTTTGENLIALLTFLRDDAKCGFVNLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   VPS   ++PGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKQNVRIRVKVATDEDTPVPSACAVHPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++D
Sbjct: 121 GVLFTGHPDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           F+SPWEG +
Sbjct: 181 FMSPWEGTD 189


>gi|90417842|ref|ZP_01225754.1| NADH dehydrogenase I, C subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337514|gb|EAS51165.1| NADH dehydrogenase I, C subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 202

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (75%), Gaps = 2/191 (1%)

Query: 1   MVRK--IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNII 58
           M+R+   +DL DY+V +   ++   + + GEL+L V   ++V + +FLRDDP   F++++
Sbjct: 1   MIREHATKDLTDYVVETLGDTLIETITAFGELTLIVAPAEIVRVLTFLRDDPQTQFISLV 60

Query: 59  DLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWD 118
           D+CGVD+  R+ RF+VVYH LSP+ N+R+R+K+   E   VPS+ G++ GADWFERE +D
Sbjct: 61  DICGVDYPERAERFEVVYHLLSPRQNQRVRIKVRTGEDLPVPSVTGVFAGADWFEREAYD 120

Query: 119 MYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRD 178
            YGI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+HYD+  K+VVY PVEL QE R+
Sbjct: 121 FYGILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVHYDEAKKQVVYEPVELRQEFRN 180

Query: 179 YDFLSPWEGVN 189
           +DFLSPWEG  
Sbjct: 181 FDFLSPWEGTE 191


>gi|13471405|ref|NP_102971.1| NADH dehydrogenase subunit C [Mesorhizobium loti MAFF303099]
 gi|81855685|sp|Q98KQ7|NUOC_RHILO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|14022147|dbj|BAB48757.1| NADH-ubiquinone dehydrogenase chain C 1 [Mesorhizobium loti
           MAFF303099]
          Length = 201

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 141/189 (74%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+     G V  A  + GEL++ V+  +L+ + +FLRDD  C F++IID+
Sbjct: 1   MAASLSELSTYLGERLIGRVNDADIAYGELTMHVEPRNLIEVVTFLRDDQRCQFISIIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CG D+ SR  RFDVVYH LSPK N R+R+K+   E   VPSI G++PGADWFERE +D+Y
Sbjct: 61  CGADYPSRPKRFDVVYHLLSPKQNVRIRLKVQADEETMVPSITGVFPGADWFERETYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YDD+ K+V+Y PVEL QE R++D
Sbjct: 121 GVLFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDDEAKRVIYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|15888599|ref|NP_354280.1| NADH dehydrogenase subunit C [Agrobacterium tumefaciens str. C58]
 gi|218534249|sp|A9CJB1|NUOC_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|15156319|gb|AAK87065.1| NADH ubiquinone oxidoreductase chain C [Agrobacterium tumefaciens
           str. C58]
          Length = 200

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 140/189 (74%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + DL  Y+  +    V  A  + GEL+L+    ++++L +FLRDD  C FVNIID+
Sbjct: 1   MSEALNDLAAYVKEARGSLVVSADIAYGELTLNTTPENVIALLTFLRDDVQCGFVNIIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSP+ N R+R+K+ VAE + VPS   +Y GA+WFERE WDMY
Sbjct: 61  CGVDWPQREKRFDVVYHLLSPRQNLRVRIKLQVAEDEGVPSSTPVYMGAEWFEREAWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI FEGH DLRRILTDYGFEGHPLRKDFPVTGFVE+ YDD +K+V+Y PVEL QE R++D
Sbjct: 121 GIPFEGHKDLRRILTDYGFEGHPLRKDFPVTGFVEVRYDDVLKRVLYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|307317825|ref|ZP_07597263.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           AK83]
 gi|5650736|emb|CAB51622.1| nuoC1 [Sinorhizobium meliloti]
 gi|306896587|gb|EFN27335.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           AK83]
          Length = 201

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 139/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  A    GEL++     +L++L +FLRDD  C FV+ ID+
Sbjct: 1   MSEALNELASYLREARGALIADAEVKYGELTVTAKAENLIALLTFLRDDVQCGFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N+R+RVK+A  E + VPS   ++PGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNQRVRVKVATGENEPVPSATSVFPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|15965019|ref|NP_385372.1| NADH dehydrogenase subunit C [Sinorhizobium meliloti 1021]
 gi|307301091|ref|ZP_07580860.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           BL225C]
 gi|7387951|sp|O68854|NUOC1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit C 1; AltName:
           Full=NADH dehydrogenase I subunit C 1; AltName:
           Full=NDH-1 subunit C 1
 gi|15074198|emb|CAC45845.1| NADH dehydrogenase I chain C [Sinorhizobium meliloti 1021]
 gi|306904046|gb|EFN34632.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           BL225C]
          Length = 201

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 138/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  A    GEL++     +L++L +FLRDD  C FV+ ID+
Sbjct: 1   MSEALNELASYLREARGALIADAEVKYGELTVTAKAENLIALLTFLRDDVQCGFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N+R+RVK+A  E   VPS   ++PGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNQRVRVKVATGENDPVPSATSVFPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|83311884|ref|YP_422148.1| NADH dehydrogenase subunit C [Magnetospirillum magneticum AMB-1]
 gi|123541538|sp|Q2W3I6|NUOC_MAGMM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|82946725|dbj|BAE51589.1| NADH:ubiquinone oxidoreductase 27 kD subunit [Magnetospirillum
           magneticum AMB-1]
          Length = 199

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/198 (55%), Positives = 142/198 (71%), Gaps = 1/198 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M + ++DLG+YI  +    V    VN  GELSL V    +V + ++L+DD  C F  ++D
Sbjct: 1   MTQALKDLGEYIAQALPQDVLGTEVNRCGELSLTVKAASIVKVMTYLKDDAGCLFKQLVD 60

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +CGVD+  R  RFDVVYH LS K+N+R+RVK+A  E  +VPS+ G++  A WFEREVWDM
Sbjct: 61  VCGVDWPGREQRFDVVYHLLSMKHNQRVRVKVATDEETAVPSVTGVFSSAGWFEREVWDM 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+ F  HPDLRRILTDYGFEGHPLRKDFP+TG+VE+ YDD+ K+VVY PV+L Q+ R +
Sbjct: 121 YGVLFSDHPDLRRILTDYGFEGHPLRKDFPLTGYVEMRYDDETKRVVYEPVKLTQDFRSF 180

Query: 180 DFLSPWEGVNSLFAKEDS 197
           DFLSPWEG   L   E +
Sbjct: 181 DFLSPWEGPGMLPGDEKA 198


>gi|218516290|ref|ZP_03513130.1| NADH dehydrogenase subunit C [Rhizobium etli 8C-3]
          Length = 177

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 128/170 (75%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+L     +L+ L +FLRDD  C FVN+ID+CGVD+  R  RFDVVYH LSPK N R+
Sbjct: 5   GELTLTATGENLIPLLTFLRDDAKCGFVNLIDICGVDWPQRELRFDVVYHLLSPKTNLRI 64

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           RVK+A  E   VPS   +YPGADWFERE WDMYG+ F GHPDLRRILTDYGFEGHPLRKD
Sbjct: 65  RVKVATDEDTPVPSACAVYPGADWFERETWDMYGVLFTGHPDLRRILTDYGFEGHPLRKD 124

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           FP TGFVE+ YDD  K+VVY PVEL QE R++DF+SPWEG   +   ++ 
Sbjct: 125 FPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFDFMSPWEGTEYVLPGDEK 174


>gi|3025803|gb|AAC12756.1| NADH-ubiquinone oxidoreductase subunit NuoC [Sinorhizobium
           meliloti]
          Length = 201

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+       +  A    GEL++     +L++L +FLRDD  C FV+ ID+
Sbjct: 1   MSEALNELASYLREGRGALIADAEVKYGELTVTAKAENLIALLTFLRDDVQCGFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R +RFDVVYH LSP+ N+R+RVK+A  E   VPS   ++PGADWFERE +DMY
Sbjct: 61  CGVDYPQRPDRFDVVYHLLSPRQNQRVRVKVATRENDPVPSATSVFPGADWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PVEL QE R++D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGTE 189


>gi|299135031|ref|ZP_07028222.1| NADH (or F420H2) dehydrogenase, subunit C [Afipia sp. 1NLS2]
 gi|298590008|gb|EFI50212.1| NADH (or F420H2) dehydrogenase, subunit C [Afipia sp. 1NLS2]
          Length = 215

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 107/199 (53%), Positives = 140/199 (70%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG+ IV +  G+       VGEL++ VD   ++ +  FL+ DP C FVNIID+  V
Sbjct: 5   RLDALGETIVGALPGAALGHAVEVGELNISVDLSRIIEVARFLKTDPRCRFVNIIDVTAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R NRFDVVYHF+SP  N RLR++    E   VPSI+ ++PG DWFERE +D+YG+ 
Sbjct: 65  DYPGRENRFDVVYHFMSPTLNARLRLRGQANETTQVPSIISVFPGCDWFERETYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RR+LTDYGFEGHPLRKDFP TGFVE+ YDD+ K+VVY PV L QE R +DFLS
Sbjct: 125 FTGHPDMRRLLTDYGFEGHPLRKDFPTTGFVEVRYDDQEKRVVYDPVRLNQEFRKFDFLS 184

Query: 184 PWEGVNSLFAKEDSKDDMS 202
           PWEG + L   ++    +S
Sbjct: 185 PWEGADYLLPGDEKASAVS 203


>gi|209885053|ref|YP_002288910.1| NADH-quinone oxidoreductase subunit c [Oligotropha carboxidovorans
           OM5]
 gi|209873249|gb|ACI93045.1| NADH-quinone oxidoreductase subunit c [Oligotropha carboxidovorans
           OM5]
          Length = 216

 Score =  237 bits (605), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 138/194 (71%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV +  G+       VGEL++ VD   +V +  FL+ DP C FVNIID+  V
Sbjct: 6   RLDALGQTIVGALPGAALGHAVEVGELNIAVDLERIVEVVRFLKTDPRCRFVNIIDVTAV 65

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R NRFDVVYHF+SP  N RLR++    E   VPSI+ ++PGADWFERE +D+YG+ 
Sbjct: 66  DYPGRENRFDVVYHFMSPTLNARLRLRGQANEDTQVPSIIRVFPGADWFERETYDLYGVI 125

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RRILTDYGFEGHPLRKDFP+TGFVE+ YDD+ K+VVY PV L QE R +DFLS
Sbjct: 126 FTGHPDMRRILTDYGFEGHPLRKDFPLTGFVEVRYDDQEKRVVYDPVRLNQEFRQFDFLS 185

Query: 184 PWEGVNSLFAKEDS 197
           PWEG   L   ++ 
Sbjct: 186 PWEGAEYLLPGDEK 199


>gi|23013442|ref|ZP_00053336.1| COG0852: NADH:ubiquinone oxidoreductase 27 kD subunit
           [Magnetospirillum magnetotacticum MS-1]
          Length = 199

 Score =  237 bits (605), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 140/198 (70%), Gaps = 1/198 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M + ++DLGDYI  +    V    VN   ELSL V    +V + SFL+DD  C F  ++D
Sbjct: 1   MTQALKDLGDYIAQALPQDVLGTEVNRCDELSLTVKAASIVKVLSFLKDDAGCLFKQLVD 60

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +CGVD+  R +RFDVVYH LS K+N+R+RVK+A  E  +VPS   ++  A WFEREVWDM
Sbjct: 61  VCGVDWPGRESRFDVVYHLLSMKHNQRIRVKVATDEETAVPSATAVFSSAGWFEREVWDM 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+ F  HPDLRRILTDYGFEGHPLRKDFP+TG+VE+ YDD+ K+VVY PV+L Q+ R +
Sbjct: 121 YGVLFSDHPDLRRILTDYGFEGHPLRKDFPLTGYVEMRYDDETKRVVYEPVKLTQDFRSF 180

Query: 180 DFLSPWEGVNSLFAKEDS 197
           DFLSPWEG   L   E +
Sbjct: 181 DFLSPWEGPGMLPGDEKA 198


>gi|158423293|ref|YP_001524585.1| NADH-ubiquinone dehydrogenase chain C 1 [Azorhizobium caulinodans
           ORS 571]
 gi|218534279|sp|A8I3Y9|NUOC_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|158330182|dbj|BAF87667.1| NADH-ubiquinone dehydrogenase chain C 1 [Azorhizobium caulinodans
           ORS 571]
          Length = 211

 Score =  237 bits (604), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 105/196 (53%), Positives = 143/196 (72%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   ++DL  ++  +  G+V     + GEL+L+     ++ L +FLRDDP C F  I+D+
Sbjct: 1   MDETLKDLAAHVTGALPGAVVAHKIAYGELTLETTPDHILKLATFLRDDPSCLFTCIVDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CG D+ +R  RF+VVYH LS K N R+RVK++  E   VPS+ GI+PGA+WFERE +D+Y
Sbjct: 61  CGADYPAREQRFEVVYHLLSLKQNARVRVKLSAGEETLVPSVTGIWPGANWFEREAYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHP+LRR+LTDYGF+GHPLRKDFP+TGFVE+ YDD++K+VVY PV L QE R++D
Sbjct: 121 GILFTGHPELRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDELKRVVYEPVRLAQEFRNFD 180

Query: 181 FLSPWEGVNSLFAKED 196
           FLSPWEGV  +   ++
Sbjct: 181 FLSPWEGVEYILPGDE 196


>gi|154248550|ref|YP_001419508.1| NADH (or F420H2) dehydrogenase, subunit C [Xanthobacter
           autotrophicus Py2]
 gi|218534340|sp|A7IPA5|NUOC_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|154162635|gb|ABS69851.1| NADH (or F420H2) dehydrogenase, subunit C [Xanthobacter
           autotrophicus Py2]
          Length = 209

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 143/197 (72%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + DL  ++  + SG+V  ++ + GEL+L +D   +V + +FLRDDP C F  I+D+
Sbjct: 1   MDETLNDLAAHVSAALSGAVLGSLVAHGELTLQIDPAQIVKVATFLRDDPACLFHCIVDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ +R  RFDVVYH LS K N R+R+K+   E   VPSI  ++PGA+WFERE +DMY
Sbjct: 61  CGVDYPAREKRFDVVYHLLSLKQNVRIRLKVETDEDTPVPSICSVFPGANWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHP+LRR+LTDYGF+GHPLRKDFP TGFVE+ YDD+ K+VVY PV L QE R++D
Sbjct: 121 GILFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDEQKRVVYEPVRLPQEFRNFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           FLSPWEGV  +   ++ 
Sbjct: 181 FLSPWEGVEYVLPGDEK 197


>gi|27380028|ref|NP_771557.1| NADH dehydrogenase subunit C [Bradyrhizobium japonicum USDA 110]
 gi|27353182|dbj|BAC50182.1| NADH ubiquinone oxidoreductase chain C [Bradyrhizobium japonicum
           USDA 110]
          Length = 203

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/186 (55%), Positives = 136/186 (73%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K++ LG  IV++  G+      +  +L++DV+   +V +  +LRDDP+C FVN  D+  V
Sbjct: 5   KLDALGQTIVSALPGAATGHSVAFNQLTVDVEAARIVEVVKYLRDDPNCRFVNFTDITAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+ SR  RFDVVYH +SP  N R+R+K    E   VPS++ ++PGADWFERE +D+YG+F
Sbjct: 65  DYPSREKRFDVVYHLMSPTLNTRIRLKAQADETTQVPSLIDVFPGADWFEREAYDLYGVF 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RRILTDYGFEGHPLRKDFP TGFVE+ YDD+ K+VVY PV L QE R +DFLS
Sbjct: 125 FVGHPDMRRILTDYGFEGHPLRKDFPTTGFVEVRYDDQEKRVVYEPVRLNQEFRKFDFLS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|118590037|ref|ZP_01547441.1| NADH dehydrogenase subunit C [Stappia aggregata IAM 12614]
 gi|118437534|gb|EAV44171.1| NADH dehydrogenase subunit C [Stappia aggregata IAM 12614]
          Length = 201

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 137/189 (72%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++L ++I      S+       GEL+L VD  D++    FLRD+  C FVN+ D+
Sbjct: 1   MDETLKELAEHIELGLGESLVSWKVEYGELTLTVDATDILDAIRFLRDNSSCKFVNLTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ SR  RFDVVYHFLSP  N+R+RVK+A  E   V S+  ++PGA+WFERE +DMY
Sbjct: 61  CGVDYPSREKRFDVVYHFLSPVQNQRIRVKVATDENTPVASLTPLFPGAEWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF+GHPLRKDFPVTGFVE+ YDD+ K+VVY PV L QE R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFDGHPLRKDFPVTGFVEVRYDDEKKRVVYEPVRLNQEMRSFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|328543687|ref|YP_004303796.1| NADH-ubiquinone oxidoreductase chain c protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413431|gb|ADZ70494.1| NADH-ubiquinone oxidoreductase chain c protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 201

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 139/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG++I  +   S+     + GEL+L V    ++ +  FLRDD  C FVN+ D+
Sbjct: 1   MDETLRELGEHIELALKDSLLSWKVAYGELTLTVSAPAILDVVRFLRDDASCKFVNLTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ +R  RFDVVYHFLSP  N+R+RVK++  E   VPS+  ++PGA+WFERE +DMY
Sbjct: 61  CGVDYPARDRRFDVVYHFLSPVQNQRIRVKLSTDEDTPVPSLTPLFPGAEWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF+GHPLRKDFPVTGFVE+ YDD  K+VVY PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFDGHPLRKDFPVTGFVEVRYDDDKKRVVYEPVRLTQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|307942119|ref|ZP_07657470.1| NADH-quinone oxidoreductase chain 5 [Roseibium sp. TrichSKD4]
 gi|307774405|gb|EFO33615.1| NADH-quinone oxidoreductase chain 5 [Roseibium sp. TrichSKD4]
          Length = 201

 Score =  232 bits (591), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 141/197 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++L ++I      SV       GEL++ V   D++ +  +LRD+  C FVN+ D+
Sbjct: 1   MDEALKELAEHISLGLGDSVLSTKVDYGELTISVAASDILDVVRYLRDNSACKFVNLTDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ +R  RFDVVYHFLSP  N+R+RVK+   E   VPSI  I+PGA+WFERE +DMY
Sbjct: 61  CGVDWPAREKRFDVVYHFLSPFQNQRIRVKVMTDEDTPVPSITPIFPGAEWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF+GHPLRKDFP+TGFVE+ YDD+ K+VVY PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFDGHPLRKDFPLTGFVEVRYDDEKKRVVYEPVRLNQEFRNFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           FLSPWEG + +   ++ 
Sbjct: 181 FLSPWEGTDYVLTGDEK 197


>gi|153009750|ref|YP_001370965.1| NADH dehydrogenase subunit C [Ochrobactrum anthropi ATCC 49188]
 gi|218534315|sp|A6X1N2|NUOC_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|151561638|gb|ABS15136.1| NADH (or F420H2) dehydrogenase, subunit C [Ochrobactrum anthropi
           ATCC 49188]
          Length = 202

 Score =  232 bits (591), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 136/183 (74%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  YI      ++  A  + GEL+L V    ++S+ +FLRDD  C FVN+ D+ GVD+ 
Sbjct: 8   ELSGYIKERLGDAIEEAKLAYGELTLSVPAASIISVLTFLRDDVQCQFVNLTDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R+ RFDVVY  +SP+ N+R+RVK+   E   VPS V ++ GA+WFERE +DMYG+ F G
Sbjct: 68  QRAKRFDVVYQLMSPRQNQRIRVKVQADEDTLVPSAVPVFVGAEWFERETYDMYGVLFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y+D++K+VVY PV+L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GTD 190


>gi|241518507|ref|YP_002979135.1| NADH (or F420H2) dehydrogenase, subunit C [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862920|gb|ACS60584.1| NADH (or F420H2) dehydrogenase, subunit C [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 205

 Score =  231 bits (590), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 140/203 (68%), Gaps = 1/203 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+VN    ++      +GEL+L      ++ L  FLR+D +C FV ++D+
Sbjct: 1   MSGNLPELASYLVNKVPQAISDHQFKLGELTLHTGREHIIELLGFLRNDENCRFVCLLDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R+ RFDVVYH LSP  N RLRVK+   E  +VPS   ++P ADW+ERE WDMY
Sbjct: 61  CGVDWPGRAERFDVVYHLLSPTQNLRLRVKLETDEESAVPSACELFPCADWYEREAWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFP+TGFVE+ YDD  K+V+Y PVEL QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYDDAAKRVIYEPVELKQEYRHFD 180

Query: 181 FLSPWEGVNSLF-AKEDSKDDMS 202
           FLSPWEG + +    E S  D S
Sbjct: 181 FLSPWEGTDYVLPGDEKSAADPS 203


>gi|90423903|ref|YP_532273.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris BisB18]
 gi|122476334|sp|Q215I2|NUOC_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|90105917|gb|ABD87954.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris BisB18]
          Length = 199

 Score =  230 bits (587), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 136/185 (73%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + +LG+ I  +   +V  A  + GEL+L VD   +V +  FLRDDP C F++ ID+  VD
Sbjct: 4   LAELGETIKAALPAAVSNASIAFGELTLTVDAAKIVEVVRFLRDDPRCRFISPIDVTAVD 63

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+NRFDVV+HFLSP  N R+R++   +E   VPS++ ++PG DWFERE +D+YG+ F
Sbjct: 64  YPGRANRFDVVWHFLSPSLNTRIRLRAEASETTQVPSLIDLFPGVDWFEREAYDLYGVIF 123

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RRILTDYGF+GHPLRKDFP++GFVE+ YDD  K+VVY PV L QE R +DFLSP
Sbjct: 124 TGHPDMRRILTDYGFDGHPLRKDFPLSGFVEVRYDDDEKRVVYEPVRLNQEFRKFDFLSP 183

Query: 185 WEGVN 189
           WEG +
Sbjct: 184 WEGAD 188


>gi|144899467|emb|CAM76331.1| NADH dehydrogenase I, C subunit [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 200

 Score =  230 bits (587), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/188 (56%), Positives = 140/188 (74%), Gaps = 1/188 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M + ++DLGDYI  +    V    VN VGEL++ V    +  + +FLRDD  C F  ++D
Sbjct: 1   MTQVLKDLGDYIAAALPNDVLSTEVNRVGELTVLVRTPSIAKVLTFLRDDSGCLFKQLVD 60

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +CGVD+  R +RFDVVYH LS K+N+R+RVK+A  E   VPS+VG++  A WFERE WDM
Sbjct: 61  VCGVDWPGREDRFDVVYHLLSLKHNQRVRVKVATDEETPVPSVVGVFSSAGWFERETWDM 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G+ F  HPDLRR+LTDYGFEGHPLRKDFP+TG VEL YDD++K+ VY PV+L+Q+ R++
Sbjct: 121 FGVIFSDHPDLRRLLTDYGFEGHPLRKDFPLTGHVELRYDDELKRCVYEPVKLVQDFRNF 180

Query: 180 DFLSPWEG 187
           DFLSPWEG
Sbjct: 181 DFLSPWEG 188


>gi|85717028|ref|ZP_01047990.1| NADH dehydrogenase subunit C [Nitrobacter sp. Nb-311A]
 gi|85696152|gb|EAQ34048.1| NADH dehydrogenase subunit C [Nitrobacter sp. Nb-311A]
          Length = 206

 Score =  230 bits (586), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 135/186 (72%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV +  G+      S G+L++ V+   +V +  F+RDD  C F+NIID+  V
Sbjct: 5   RLDALGQMIVATLPGAATGHSMSFGQLTVTVEAAKIVEVARFIRDDQRCRFINIIDVTAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R  RFDV+YHFLSP  N R+R++   +E   VPS++ ++PGADWFERE +D+YG+ 
Sbjct: 65  DYPGREKRFDVIYHFLSPALNARIRLRAYASETTQVPSLIDVFPGADWFEREAYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RR+LTDYGF+GHPLRKDFP+TGFVE+ YDD  K+VVY PV L QE R +DF+S
Sbjct: 125 FTGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDAEKRVVYEPVRLNQEFRKFDFMS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|86749692|ref|YP_486188.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris HaA2]
 gi|86572720|gb|ABD07277.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris HaA2]
          Length = 204

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/194 (54%), Positives = 136/194 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LG  IV +  G+      + G+L++ +D   +V +  FLRDDP C FVNI+D+  VD
Sbjct: 6   LDTLGQTIVGALPGAAIGHSIAYGQLTVTIDAAKVVEVARFLRDDPRCRFVNIVDVTAVD 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RFD+VYHFLSP  N R+R++  V E   VPSI+ ++PG DWFEREV+D+YGI  
Sbjct: 66  YPGRVPRFDLVYHFLSPALNARIRLRAEVGETTLVPSIIDVFPGTDWFEREVYDLYGIVI 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RRILTDYGF+GHPLRKDFP+TGFVE+ YDD  K+VVY PV L QE R +DFLSP
Sbjct: 126 TGHPDMRRILTDYGFDGHPLRKDFPLTGFVEVRYDDDQKRVVYEPVRLNQEFRKFDFLSP 185

Query: 185 WEGVNSLFAKEDSK 198
           WEG +      D K
Sbjct: 186 WEGADYPVLPGDEK 199


>gi|239831688|ref|ZP_04680017.1| NADH (or F420H2) dehydrogenase, subunit C [Ochrobactrum intermedium
           LMG 3301]
 gi|239823955|gb|EEQ95523.1| NADH (or F420H2) dehydrogenase, subunit C [Ochrobactrum intermedium
           LMG 3301]
          Length = 204

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 139/192 (72%), Gaps = 3/192 (1%)

Query: 1   MVRKIEDLGD---YIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNI 57
           M+   E LG+   YI      ++  A  + GEL+L V    ++S+ +FLRDD  C FVN+
Sbjct: 1   MIMSEEALGELSGYIKERLGDAIEEAKLAYGELTLSVPVASIISVLTFLRDDVQCQFVNL 60

Query: 58  IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVW 117
            D+ GVD+  R+ RFDVVY  +SP+ N+R+RVK+   E   VPS V ++ GA+WFERE +
Sbjct: 61  TDISGVDYPQRAKRFDVVYQLMSPRQNQRIRVKVQADEDTLVPSAVPVFVGAEWFERETY 120

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR 177
           DMYG+ F GHPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y++++K+V Y PV+L QE R
Sbjct: 121 DMYGVLFSGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNNELKRVAYEPVQLRQEFR 180

Query: 178 DYDFLSPWEGVN 189
           ++DFLSPWEG +
Sbjct: 181 NFDFLSPWEGTD 192


>gi|182679351|ref|YP_001833497.1| NADH (or F420H2) dehydrogenase, subunit C [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635234|gb|ACB96008.1| NADH (or F420H2) dehydrogenase, subunit C [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 212

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 134/190 (70%)

Query: 9   GDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR 68
           G+ I  +  G+++ A  + GEL+L V+ G L+   ++LRDDP   +V+ IDL  VD+  R
Sbjct: 17  GEAIGAALPGAIKAATVAFGELTLTVEAGRLIETITYLRDDPSALYVSFIDLTAVDYPLR 76

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHP 128
             RFDVV H LSPK+NRR+R+K+   E   VPS+   YP A+WFERE +D +G+ F GHP
Sbjct: 77  ERRFDVVTHLLSPKHNRRIRIKVETDENTPVPSLSSFYPAANWFEREAYDFFGVLFSGHP 136

Query: 129 DLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           DLRR+LTDYGF+GHPLRKDFP+TG+ E+ YDD+ K+VVY PV+L+QE R +DFLSPWEG 
Sbjct: 137 DLRRLLTDYGFDGHPLRKDFPMTGYAEVRYDDEQKRVVYEPVQLVQEFRSFDFLSPWEGA 196

Query: 189 NSLFAKEDSK 198
                  D K
Sbjct: 197 IDYILPGDEK 206


>gi|209964548|ref|YP_002297463.1| NADH dehydrogenase subunit C [Rhodospirillum centenum SW]
 gi|209958014|gb|ACI98650.1| NADH-quinone oxidoreductase chain C [Rhodospirillum centenum SW]
          Length = 236

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 1/197 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           + +++LGDYI ++       A VN VGEL + V+   +V +  FLRDD  C F  +++LC
Sbjct: 4   QALQELGDYITSALGKDALSAEVNRVGELVVRVERRSIVRVLQFLRDDSTCLFQQLMELC 63

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  RS RF+VVY  LS K+N+R+RV +   E   VPS+ G++P A+WFERE WD+YG
Sbjct: 64  GVDYPQRSERFEVVYCLLSLKHNQRVRVVVTTDEDTPVPSVTGVFPVANWFEREAWDLYG 123

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           IFF  HPDLRRILTDYGFEGHPLRKDFP+TG+VEL YD   ++VVY PV+L Q+ R +DF
Sbjct: 124 IFFSDHPDLRRILTDYGFEGHPLRKDFPLTGYVELRYDPDQRRVVYEPVKLTQDFRSFDF 183

Query: 182 LSPWEGVNSLFAKEDSK 198
           LSPWEG+  +    D K
Sbjct: 184 LSPWEGMTEVQLPGDEK 200


>gi|148255913|ref|YP_001240498.1| NADH dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
 gi|146408086|gb|ABQ36592.1| NADH dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
          Length = 201

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 136/186 (73%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV++  G+      +  +L++D++   +V +  +LRDDP C FVNI D+  V
Sbjct: 5   RLDALGQTIVSALPGAALGHSVAFNQLTVDIEPTRIVEVAKYLRDDPACRFVNITDITAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R+ RFDVVYHFLSP  N R+R+K    E   VPS++ ++PGADWFERE +D+YG+ 
Sbjct: 65  DYPERAKRFDVVYHFLSPTLNARVRLKGQADEATQVPSLIDVFPGADWFEREAYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RR+LTDYGF+GHPLRKDFP TGFVE+ YDD+ K+V+Y PV L QE R +DFLS
Sbjct: 125 FVGHPDMRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDQEKRVIYEPVRLNQEFRKFDFLS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|75676077|ref|YP_318498.1| NADH dehydrogenase subunit C [Nitrobacter winogradskyi Nb-255]
 gi|74420947|gb|ABA05146.1| NADH dehydrogenase subunit C [Nitrobacter winogradskyi Nb-255]
          Length = 206

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 133/186 (71%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV +  G+      S G+L++ V+   +V +  FLRDD  C FVN ID   V
Sbjct: 5   RLDALGQMIVATLPGAATGHSVSFGQLTVTVEAAKIVEVARFLRDDRRCRFVNFIDATAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R  RFDVVYHFLSP  N R+R++   +E   VPS++ ++PGADWFERE +D+YG+ 
Sbjct: 65  DYPGREKRFDVVYHFLSPTLNARIRLRAHASETTQVPSLIDVFPGADWFEREAYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RR+LTDYGF+GHPLRKDFP+TGFVE+ YDD  K+VVY PV L QE R +DF+S
Sbjct: 125 FTGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDAEKRVVYEPVRLNQEFRKFDFMS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|110633378|ref|YP_673586.1| NADH dehydrogenase subunit C [Mesorhizobium sp. BNC1]
 gi|123353796|sp|Q11JK4|NUOC_MESSB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|110284362|gb|ABG62421.1| NADH dehydrogenase subunit C [Chelativorans sp. BNC1]
          Length = 200

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 100/189 (52%), Positives = 140/189 (74%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + DL  YI     G V+  + +  EL++ V+ GD+V + +FL+ D  C F   +D+
Sbjct: 1   MNEALRDLAGYIKEKLDGRVQDWMVAYDELTIFVEPGDIVDVLTFLKSDVQCQFFAFVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ +R  RF+VVYH LSP+ N+R+RVK++  E   +PS++ ++P A+W+ERE++D+Y
Sbjct: 61  SGVDYPARERRFEVVYHLLSPRQNQRIRVKVSTDEETPIPSVIEVFPAANWYEREIYDLY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F  HPDLRRILTDYGFEGHPLRKDFP+TGFVE+HYDD+ K+VVY+PV L QE R++D
Sbjct: 121 GVLFTEHPDLRRILTDYGFEGHPLRKDFPLTGFVEVHYDDEAKRVVYQPVNLRQEFRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|115524528|ref|YP_781439.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris BisA53]
 gi|115518475|gb|ABJ06459.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris BisA53]
          Length = 201

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 103/196 (52%), Positives = 138/196 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LG  IV + SG+V     + GEL++ +    +V +  FLRDDP C F+N ID+  VD
Sbjct: 6   LDALGQMIVGALSGAVIGHSIAFGELTVTIYAEKVVEVARFLRDDPRCRFINPIDVTAVD 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R NRFDVVYH LSP  N R+R++    E   VPS++G++PG DWFERE +D+YG+ F
Sbjct: 66  YPGRENRFDVVYHLLSPTLNARIRLRAEANETTQVPSLIGVFPGVDWFEREAYDLYGVIF 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RRILTDYGF+GHPLRKDFP++GFVE+ YDD  K+VVY PV L QE R +DFLSP
Sbjct: 126 TGHPDMRRILTDYGFDGHPLRKDFPLSGFVEVRYDDDEKRVVYEPVRLNQEFRKFDFLSP 185

Query: 185 WEGVNSLFAKEDSKDD 200
           WEG +     ++ + +
Sbjct: 186 WEGADYPLPGDEKRSE 201


>gi|298291845|ref|YP_003693784.1| NADH (or F420H2) dehydrogenase, subunit C [Starkeya novella DSM
           506]
 gi|296928356|gb|ADH89165.1| NADH (or F420H2) dehydrogenase, subunit C [Starkeya novella DSM
           506]
          Length = 204

 Score =  228 bits (580), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/187 (56%), Positives = 132/187 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG ++  +    V   V + GEL+L  D   +  L +FLRDDP C FV+ ID+
Sbjct: 1   MDETLTELGAHVKEALPDVVEEVVVAYGELTLIADAAKVTGLLTFLRDDPSCKFVSFIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSP  N R+RVK+   E   V S   ++PGA WFERE +DMY
Sbjct: 61  CGVDWPKREKRFDVVYHLLSPTLNARIRVKVETDETTPVASATAVFPGAFWFEREAFDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHP+LRRILTDYGF+G+PLRKDFP TGFVE+ YDD+ K+VVY PV+L QE R++D
Sbjct: 121 GIMFSGHPELRRILTDYGFDGYPLRKDFPTTGFVEVRYDDERKRVVYEPVKLAQEFRNFD 180

Query: 181 FLSPWEG 187
           FLSPWEG
Sbjct: 181 FLSPWEG 187


>gi|254504711|ref|ZP_05116862.1| putative NADH dehydrogenase, subunit C subfamily [Labrenzia
           alexandrii DFL-11]
 gi|222440782|gb|EEE47461.1| putative NADH dehydrogenase, subunit C subfamily [Labrenzia
           alexandrii DFL-11]
          Length = 201

 Score =  227 bits (579), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 138/189 (73%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++L ++I    S S+       GEL+L V+  D++ +  +LRD+  C FVN+ D+
Sbjct: 1   MDETLKELAEHIELGLSESLVSWKVEYGELTLVVNASDILDVVRYLRDNASCKFVNLTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ +R  RFDVVYHFLSP  N+R+RVK+   +   V S+  ++PGA+WFERE +DMY
Sbjct: 61  CGVDYPAREKRFDVVYHFLSPFQNQRIRVKLETDDVTPVASLTSLFPGAEWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF+GHPLRKDFPVTGFVE+ YDD+ K+VVY PV L QE R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFDGHPLRKDFPVTGFVEVRYDDEKKRVVYEPVRLNQEMRTFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG +
Sbjct: 181 FLSPWEGTD 189


>gi|91977355|ref|YP_570014.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris BisB5]
 gi|91683811|gb|ABE40113.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris BisB5]
          Length = 204

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 135/194 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LG  IV +  G+    V +  EL++ +D   +V +  FLRDDP C F+NI+D+  VD
Sbjct: 6   LDTLGQTIVGALPGAAIGHVVTYSELTVTIDSTKVVDVVRFLRDDPRCRFINIVDVTAVD 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RFD+VYHFLSP  N R+R++  V E   VPSI+ ++PG DWFEREV+D+YGI  
Sbjct: 66  YPGRVPRFDLVYHFLSPTLNARIRLRAEVGETTLVPSIISVFPGTDWFEREVYDLYGIII 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RR+LTDYGF+GHPLRKDFP+TGFVE+ YDD  K+VVY PV L QE R +DF SP
Sbjct: 126 TGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDDQKRVVYEPVRLNQEFRKFDFQSP 185

Query: 185 WEGVNSLFAKEDSK 198
           WEG +      D K
Sbjct: 186 WEGADYPILPGDEK 199


>gi|17987439|ref|NP_540073.1| NADH dehydrogenase subunit C [Brucella melitensis bv. 1 str. 16M]
 gi|23501691|ref|NP_697818.1| NADH dehydrogenase subunit C [Brucella suis 1330]
 gi|148559816|ref|YP_001258782.1| NADH dehydrogenase subunit C [Brucella ovis ATCC 25840]
 gi|161618768|ref|YP_001592655.1| NADH dehydrogenase subunit C [Brucella canis ATCC 23365]
 gi|163843077|ref|YP_001627481.1| NADH dehydrogenase subunit C [Brucella suis ATCC 23445]
 gi|225852320|ref|YP_002732553.1| NADH dehydrogenase subunit C [Brucella melitensis ATCC 23457]
 gi|254693542|ref|ZP_05155370.1| NADH dehydrogenase subunit C [Brucella abortus bv. 3 str. Tulya]
 gi|254701572|ref|ZP_05163400.1| NADH dehydrogenase subunit C [Brucella suis bv. 5 str. 513]
 gi|254704119|ref|ZP_05165947.1| NADH dehydrogenase subunit C [Brucella suis bv. 3 str. 686]
 gi|254706981|ref|ZP_05168809.1| NADH dehydrogenase subunit C [Brucella pinnipedialis M163/99/10]
 gi|254709912|ref|ZP_05171723.1| NADH dehydrogenase subunit C [Brucella pinnipedialis B2/94]
 gi|254713913|ref|ZP_05175724.1| NADH dehydrogenase subunit C [Brucella ceti M644/93/1]
 gi|254717029|ref|ZP_05178840.1| NADH dehydrogenase subunit C [Brucella ceti M13/05/1]
 gi|254718913|ref|ZP_05180724.1| NADH dehydrogenase subunit C [Brucella sp. 83/13]
 gi|256031405|ref|ZP_05445019.1| NADH dehydrogenase subunit C [Brucella pinnipedialis M292/94/1]
 gi|256044483|ref|ZP_05447387.1| NADH dehydrogenase subunit C [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060916|ref|ZP_05451074.1| NADH dehydrogenase subunit C [Brucella neotomae 5K33]
 gi|256113334|ref|ZP_05454196.1| NADH dehydrogenase subunit C [Brucella melitensis bv. 3 str. Ether]
 gi|256264181|ref|ZP_05466713.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella
           melitensis bv. 2 str. 63/9]
 gi|256369236|ref|YP_003106744.1| NADH dehydrogenase subunit C [Brucella microti CCM 4915]
 gi|260563837|ref|ZP_05834323.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella
           melitensis bv. 1 str. 16M]
 gi|260566632|ref|ZP_05837102.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella suis bv.
           4 str. 40]
 gi|261213807|ref|ZP_05928088.1| NADH dehydrogenase subunit C [Brucella abortus bv. 3 str. Tulya]
 gi|261218836|ref|ZP_05933117.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M13/05/1]
 gi|261314444|ref|ZP_05953641.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           M163/99/10]
 gi|261317458|ref|ZP_05956655.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           B2/94]
 gi|261321665|ref|ZP_05960862.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M644/93/1]
 gi|261324916|ref|ZP_05964113.1| NADH-quinone oxidoreductase subunit C [Brucella neotomae 5K33]
 gi|261752125|ref|ZP_05995834.1| NADH-quinone oxidoreductase subunit C [Brucella suis bv. 5 str.
           513]
 gi|261754785|ref|ZP_05998494.1| NADH-quinone oxidoreductase subunit C [Brucella suis bv. 3 str.
           686]
 gi|265983900|ref|ZP_06096635.1| NADH-quinone oxidoreductase subunit C [Brucella sp. 83/13]
 gi|265988494|ref|ZP_06101051.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           M292/94/1]
 gi|265990907|ref|ZP_06103464.1| NADH-quinone oxidoreductase subunit C [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994744|ref|ZP_06107301.1| NADH-quinone oxidoreductase subunit C [Brucella melitensis bv. 3
           str. Ether]
 gi|294852161|ref|ZP_06792834.1| NADH-quinone oxidoreductase subunit C [Brucella sp. NVSL 07-0026]
 gi|306838239|ref|ZP_07471091.1| NADH dehydrogenase subunit C [Brucella sp. NF 2653]
 gi|306843741|ref|ZP_07476340.1| NADH dehydrogenase subunit C [Brucella sp. BO1]
 gi|81752804|sp|Q8G1B5|NUOC_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|81851725|sp|Q8YGK2|NUOC_BRUME RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534260|sp|A9MAI1|NUOC_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534262|sp|A5VPY5|NUOC_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534264|sp|B0CLD1|NUOC_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|254767810|sp|C0RIE1|NUOC_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|17983132|gb|AAL52337.1| NADH-quinone oxidoreductase chain c [Brucella melitensis bv. 1 str.
           16M]
 gi|23347613|gb|AAN29733.1| NADH dehydrogenase I, C subunit [Brucella suis 1330]
 gi|148371073|gb|ABQ61052.1| NADH dehydrogenase I, C subunit [Brucella ovis ATCC 25840]
 gi|161335579|gb|ABX61884.1| NADH (or F420H2) dehydrogenase, subunit C [Brucella canis ATCC
           23365]
 gi|163673800|gb|ABY37911.1| NADH (or F420H2) dehydrogenase, subunit C [Brucella suis ATCC
           23445]
 gi|225640685|gb|ACO00599.1| NADH dehydrogenase subunit C [Brucella melitensis ATCC 23457]
 gi|255999396|gb|ACU47795.1| NADH dehydrogenase subunit C [Brucella microti CCM 4915]
 gi|260153853|gb|EEW88945.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella
           melitensis bv. 1 str. 16M]
 gi|260156150|gb|EEW91230.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella suis bv.
           4 str. 40]
 gi|260915414|gb|EEX82275.1| NADH dehydrogenase subunit C [Brucella abortus bv. 3 str. Tulya]
 gi|260923925|gb|EEX90493.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M13/05/1]
 gi|261294355|gb|EEX97851.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M644/93/1]
 gi|261296681|gb|EEY00178.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           B2/94]
 gi|261300896|gb|EEY04393.1| NADH-quinone oxidoreductase subunit C [Brucella neotomae 5K33]
 gi|261303470|gb|EEY06967.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           M163/99/10]
 gi|261741878|gb|EEY29804.1| NADH-quinone oxidoreductase subunit C [Brucella suis bv. 5 str.
           513]
 gi|261744538|gb|EEY32464.1| NADH-quinone oxidoreductase subunit C [Brucella suis bv. 3 str.
           686]
 gi|262765857|gb|EEZ11646.1| NADH-quinone oxidoreductase subunit C [Brucella melitensis bv. 3
           str. Ether]
 gi|263001691|gb|EEZ14266.1| NADH-quinone oxidoreductase subunit C [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094399|gb|EEZ18244.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella
           melitensis bv. 2 str. 63/9]
 gi|264660691|gb|EEZ30952.1| NADH-quinone oxidoreductase subunit C [Brucella pinnipedialis
           M292/94/1]
 gi|264662492|gb|EEZ32753.1| NADH-quinone oxidoreductase subunit C [Brucella sp. 83/13]
 gi|294820750|gb|EFG37749.1| NADH-quinone oxidoreductase subunit C [Brucella sp. NVSL 07-0026]
 gi|306275932|gb|EFM57645.1| NADH dehydrogenase subunit C [Brucella sp. BO1]
 gi|306406683|gb|EFM62910.1| NADH dehydrogenase subunit C [Brucella sp. NF 2653]
 gi|326408827|gb|ADZ65892.1| NADH dehydrogenase subunit C [Brucella melitensis M28]
 gi|326538543|gb|ADZ86758.1| NADH dehydrogenase subunit C [Brucella melitensis M5-90]
          Length = 202

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 134/183 (73%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  YI      ++  A  + GEL+L V    L+ + +FLRDD  C FVN+ D+ GVD+ 
Sbjct: 8   ELSGYIRERLGDAIEEANLAYGELTLCVPVASLIGVLTFLRDDVQCQFVNLTDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RFDVVY  LSP+ N+R+RVK+   E   VPS V ++ GA+W+ERE +DMYGI F G
Sbjct: 68  QREKRFDVVYQLLSPRQNQRIRVKVQADEDTLVPSAVPVFFGAEWYEREAYDMYGILFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y+D++K+VVY PV+L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GTD 190


>gi|319408581|emb|CBI82236.1| NADH dehydrogenase I chain C [Bartonella schoenbuchensis R1]
          Length = 202

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/200 (52%), Positives = 136/200 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+ N     +  +V + GEL++      +  +  F+RDD  C FVNI D+
Sbjct: 1   MFESLNELSAYLKNQLGDKLEESVLAFGELTIVSRLDAITDVLMFVRDDSRCQFVNITDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP++N RLRVK+   E   +PS   +YPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSRDKRFDVSYQLLSPRHNLRLRVKVRTDENVPIPSACSVYPGAEWYERETYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++VK+V+Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEVKRVIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           FLSPWEG   +   ++  +D
Sbjct: 181 FLSPWEGAEYILPGDEEIND 200


>gi|225627301|ref|ZP_03785338.1| NADH dehydrogenase subunit C [Brucella ceti str. Cudo]
 gi|256159526|ref|ZP_05457294.1| NADH dehydrogenase subunit C [Brucella ceti M490/95/1]
 gi|256254813|ref|ZP_05460349.1| NADH dehydrogenase subunit C [Brucella ceti B1/94]
 gi|260168539|ref|ZP_05755350.1| NADH dehydrogenase subunit C [Brucella sp. F5/99]
 gi|261221994|ref|ZP_05936275.1| NADH-quinone oxidoreductase subunit C [Brucella ceti B1/94]
 gi|261758012|ref|ZP_06001721.1| NADH dehydrogenase subunit C [Brucella sp. F5/99]
 gi|265997958|ref|ZP_06110515.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M490/95/1]
 gi|225617306|gb|EEH14351.1| NADH dehydrogenase subunit C [Brucella ceti str. Cudo]
 gi|260920578|gb|EEX87231.1| NADH-quinone oxidoreductase subunit C [Brucella ceti B1/94]
 gi|261737996|gb|EEY25992.1| NADH dehydrogenase subunit C [Brucella sp. F5/99]
 gi|262552426|gb|EEZ08416.1| NADH-quinone oxidoreductase subunit C [Brucella ceti M490/95/1]
          Length = 202

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  YI      ++  A  + GEL+L V    L+ + +FLRDD  C FVN+ D+ GVD+ 
Sbjct: 8   ELSGYIRERLGDAIEEANLAYGELTLCVPVASLIGVLTFLRDDVQCQFVNLTDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RFDVVY  LSP+ N+R+RVK+   E   VPS + ++ GA+W+ERE +DMYGI F G
Sbjct: 68  QREKRFDVVYQLLSPRQNQRIRVKVQADEDTLVPSAIPVFFGAEWYEREAYDMYGILFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y+D++K+VVY PV+L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GTD 190


>gi|323138147|ref|ZP_08073220.1| NADH (or F420H2) dehydrogenase, subunit C [Methylocystis sp. ATCC
           49242]
 gi|322396609|gb|EFX99137.1| NADH (or F420H2) dehydrogenase, subunit C [Methylocystis sp. ATCC
           49242]
          Length = 200

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/189 (53%), Positives = 136/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           MV + E LG  I ++  G+V     + GEL+L V     + + +FLRDD  C FVN+ID+
Sbjct: 1   MVGEFEALGARISDALPGAVTNVNVAYGELTLTVARDRWLDVATFLRDDAECLFVNVIDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+  R  RF+VV H  SPK+NRR+R+K   +E   V S+V ++PGADW+ERE +D++
Sbjct: 61  TAADYPEREERFEVVAHLQSPKHNRRIRIKTPASEETPVASLVPLFPGADWYERETYDLF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRI+TDYGF+GHPLRKDFP+TGFVE+ YDD+ K+VVY PV L QE+R++D
Sbjct: 121 GVIFSGHPDLRRIMTDYGFDGHPLRKDFPMTGFVEVRYDDEQKRVVYEPVRLTQEYRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWE V 
Sbjct: 181 FLSPWEAVQ 189


>gi|306841958|ref|ZP_07474635.1| NADH dehydrogenase subunit C [Brucella sp. BO2]
 gi|306287949|gb|EFM59360.1| NADH dehydrogenase subunit C [Brucella sp. BO2]
          Length = 202

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 134/183 (73%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  YI      ++  A  + GEL+L V    L+ + +FLRDD  C FVN+ D+ GVD+ 
Sbjct: 8   ELSGYIRERLGDAIEDANLAYGELTLCVPVASLIGVLTFLRDDVQCQFVNLTDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RFDVVY  LSP+ N+R+RVK+   E   VPS V ++ GA+W+ERE +DMYGI F G
Sbjct: 68  QREKRFDVVYQLLSPRQNQRIRVKVQADEDTLVPSAVPVFFGAEWYEREAYDMYGILFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y+D++K+VVY PV+L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GTD 190


>gi|170748476|ref|YP_001754736.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           radiotolerans JCM 2831]
 gi|218534300|sp|B1LUN5|NUOC_METRJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|170654998|gb|ACB24053.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           radiotolerans JCM 2831]
          Length = 215

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 136/195 (69%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
            +  + + +V +   +V     + GEL+L V   D+V   ++LRDDP C F N ID+CGV
Sbjct: 19  AVAAMAERVVGALGPAVVSHAIAFGELTLVVQASDIVYALTYLRDDPACAFRNFIDICGV 78

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R  RFDVVYH LS ++N R+R+K+   E   VPS++ ++P A+W+ERE +D+YGI 
Sbjct: 79  DYPQREKRFDVVYHLLSLRHNLRIRLKVQTDEVTPVPSVIEVFPAANWYERETYDLYGIL 138

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLS
Sbjct: 139 FSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDQARVVYEPVQLTQEFRNFDFLS 198

Query: 184 PWEGVNSLFAKEDSK 198
           PWEG + +   ++  
Sbjct: 199 PWEGTDYVLPGDEKT 213


>gi|316933893|ref|YP_004108875.1| NADH (or F420H2) dehydrogenase subunit C [Rhodopseudomonas
           palustris DX-1]
 gi|315601607|gb|ADU44142.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris DX-1]
          Length = 204

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 135/194 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LG  IV +  G       + G+L+L VD G +V +   LRDDP   F++ ID+  VD
Sbjct: 6   LDTLGQTIVGALPGIATGHFVAFGQLTLTVDAGKIVEVMRLLRDDPRFRFISFIDMTAVD 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R++RF++VYH LSPK N R+RVK  V E   VPSI+ ++PGADWFERE +D+YGI  
Sbjct: 66  YPGRADRFEIVYHLLSPKLNERVRVKAEVGETTLVPSIIDVFPGADWFEREAYDLYGIII 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RR+LTDYGF+GHPLRKDFP++GFVE+ YDD  K+VVY PV L QE R +DFLSP
Sbjct: 126 TGHPDMRRLLTDYGFDGHPLRKDFPLSGFVEVRYDDDQKRVVYEPVRLNQEFRKFDFLSP 185

Query: 185 WEGVNSLFAKEDSK 198
           WEG +      D K
Sbjct: 186 WEGADYPVLPGDEK 199


>gi|39936015|ref|NP_948291.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris CGA009]
 gi|192291670|ref|YP_001992275.1| NADH dehydrogenase subunit C [Rhodopseudomonas palustris TIE-1]
 gi|81562350|sp|Q6N5M4|NUOC_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534314|sp|B3Q7N4|NUOC_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|39649869|emb|CAE28391.1| NADH-ubiquinone dehydrogenase chain C [Rhodopseudomonas palustris
           CGA009]
 gi|192285419|gb|ACF01800.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
           palustris TIE-1]
          Length = 204

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 133/194 (68%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LG  IV +  G         G+L+L VD G +V +   LRDDP   F++ ID+  VD
Sbjct: 6   LDTLGQTIVGALPGIATGHSVGFGQLTLTVDAGKIVEVMRLLRDDPRFRFISFIDMTAVD 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RF++VYH LSPK N R+RVK  V E   VPSI+ ++PGADWFERE +D+YGI  
Sbjct: 66  YPGRAERFEIVYHLLSPKLNERVRVKAEVGETTLVPSIIEVFPGADWFEREAYDLYGIVI 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPD+RR+LTDYGF+GHPLRKDFP+TGFVE+ YDD  K+V+Y PV L QE R +DFLSP
Sbjct: 126 TGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDDQKRVIYEPVRLNQEFRKFDFLSP 185

Query: 185 WEGVNSLFAKEDSK 198
           WEG +      D K
Sbjct: 186 WEGADYPVLPGDEK 199


>gi|312116345|ref|YP_004013941.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221474|gb|ADP72842.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 206

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 137/194 (70%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+E L + +  +F   V     ++GEL++ VD   + ++  FLR DP   F  ++D+CGV
Sbjct: 6   KLEVLAEALKGAFPEGVTETRFALGELTVLVDRARIPAIAEFLRSDPAWRFTILVDICGV 65

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R+ RFDVVYHFLS   N R+R+K        VPS+VG++P A+WFERE +D+YGI 
Sbjct: 66  DYPERAERFDVVYHFLSMYQNLRVRLKTTADAATPVPSLVGVFPAANWFEREAYDLYGIL 125

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           FEGHPDLRRILTDYGF GHPLRKDFP+TGFVEL YD++ K+VVY PV+L QE R +DFLS
Sbjct: 126 FEGHPDLRRILTDYGFRGHPLRKDFPLTGFVELRYDEEQKRVVYEPVKLPQEFRSFDFLS 185

Query: 184 PWEGVNSLFAKEDS 197
           PWEG + L   ++ 
Sbjct: 186 PWEGADYLLPGDEK 199


>gi|92117742|ref|YP_577471.1| NADH dehydrogenase subunit C [Nitrobacter hamburgensis X14]
 gi|91800636|gb|ABE63011.1| NADH dehydrogenase subunit C [Nitrobacter hamburgensis X14]
          Length = 206

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 133/186 (71%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV +  G+      + G+LS+ V+   +V +  F+RDD  C FVNI D+  V
Sbjct: 5   RLDALGQMIVATLPGAAIGHSVAFGQLSITVEVAKIVEVARFIRDDQRCRFVNITDVTAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R  RFDVVY+FLSP  N R+R+    +E   VPS++ ++PGADWFERE +D+YG+ 
Sbjct: 65  DYPGREKRFDVVYNFLSPTLNTRIRLNAQASETTQVPSLIDVFPGADWFERETYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RR+LTDYGF+GHPLRKDFP+TGFVE+ YDD  K+VVY PV L QE R +DF+S
Sbjct: 125 FTGHPDMRRLLTDYGFDGHPLRKDFPLTGFVEVRYDDAEKRVVYEPVRLNQEFRKFDFMS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|62289753|ref|YP_221546.1| NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9-941]
 gi|82699681|ref|YP_414255.1| NADH dehydrogenase subunit C [Brucella melitensis biovar Abortus
           2308]
 gi|189023998|ref|YP_001934766.1| NADH dehydrogenase subunit C [Brucella abortus S19]
 gi|237815240|ref|ZP_04594238.1| NADH (or F420H2) dehydrogenase, subunit C [Brucella abortus str.
           2308 A]
 gi|254689060|ref|ZP_05152314.1| NADH dehydrogenase subunit C [Brucella abortus bv. 6 str. 870]
 gi|254697194|ref|ZP_05159022.1| NADH dehydrogenase subunit C [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730090|ref|ZP_05188668.1| NADH dehydrogenase subunit C [Brucella abortus bv. 4 str. 292]
 gi|256257309|ref|ZP_05462845.1| NADH dehydrogenase subunit C [Brucella abortus bv. 9 str. C68]
 gi|260545497|ref|ZP_05821238.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella abortus
           NCTC 8038]
 gi|260754558|ref|ZP_05866906.1| NADH dehydrogenase subunit C [Brucella abortus bv. 6 str. 870]
 gi|260757779|ref|ZP_05870127.1| NADH dehydrogenase subunit C [Brucella abortus bv. 4 str. 292]
 gi|260761604|ref|ZP_05873947.1| NADH dehydrogenase subunit C [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883585|ref|ZP_05895199.1| NADH-quinone oxidoreductase subunit C [Brucella abortus bv. 9 str.
           C68]
 gi|297248158|ref|ZP_06931876.1| NADH dehydrogenase I subunit C [Brucella abortus bv. 5 str. B3196]
 gi|75505304|sp|Q57DU9|NUOC_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|123546614|sp|Q2YNC7|NUOC_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534245|sp|B2S545|NUOC_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|62195885|gb|AAX74185.1| NuoC, NADH dehydrogenase I, C subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615782|emb|CAJ10780.1| NADH dehydrogenase (ubiquinone), 30 kDa subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|189019570|gb|ACD72292.1| NADH dehydrogenase (ubiquinone), 30 kDa subunit [Brucella abortus
           S19]
 gi|237790077|gb|EEP64287.1| NADH (or F420H2) dehydrogenase, subunit C [Brucella abortus str.
           2308 A]
 gi|260096904|gb|EEW80779.1| trifunctional NADH dehydrogenase I subunit B/C/D [Brucella abortus
           NCTC 8038]
 gi|260668097|gb|EEX55037.1| NADH dehydrogenase subunit C [Brucella abortus bv. 4 str. 292]
 gi|260672036|gb|EEX58857.1| NADH dehydrogenase subunit C [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674666|gb|EEX61487.1| NADH dehydrogenase subunit C [Brucella abortus bv. 6 str. 870]
 gi|260873113|gb|EEX80182.1| NADH-quinone oxidoreductase subunit C [Brucella abortus bv. 9 str.
           C68]
 gi|297175327|gb|EFH34674.1| NADH dehydrogenase I subunit C [Brucella abortus bv. 5 str. B3196]
          Length = 202

 Score =  224 bits (572), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 133/183 (72%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  YI      ++  A  + GEL+L V    L+ + + LRDD  C FVN+ D+ GVD+ 
Sbjct: 8   ELSGYIRERLGDAIEEANLAYGELTLCVPVASLIGVLTLLRDDVQCQFVNLTDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RFDVVY  LSP+ N+R+RVK+   E   VPS V ++ GA+W+ERE +DMYGI F G
Sbjct: 68  QREKRFDVVYQLLSPRQNQRIRVKVQADEDTLVPSAVPVFFGAEWYEREAYDMYGILFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFP+TGFVE+ Y+D++K+VVY PV+L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GTD 190


>gi|114707369|ref|ZP_01440266.1| NADH dehydrogenase subunit C [Fulvimarina pelagi HTCC2506]
 gi|114537250|gb|EAU40377.1| NADH dehydrogenase subunit C [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score =  224 bits (570), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 132/183 (72%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           D+ D ++ S    +       GEL+L V   ++V + + LRDDP   F+N +DLCGVDF 
Sbjct: 9   DVRDAVLESLEDRIEDHFFRFGELTLVVTPENVVKVMTTLRDDPKMQFINFVDLCGVDFP 68

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RF+VVYH LSP+ N R+RVK   AE   VPS+  ++P ADWFERE +D+YGI F G
Sbjct: 69  QREKRFEVVYHLLSPRQNCRIRVKTMTAEDDPVPSVSDVFPAADWFEREAYDLYGILFTG 128

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEG+PLRKDFP+TGFVE+ YD++ K+VVY PV+L QE R++DFLSPWE
Sbjct: 129 HPDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDEERKQVVYEPVDLRQEFRNFDFLSPWE 188

Query: 187 GVN 189
           G  
Sbjct: 189 GTE 191


>gi|220924007|ref|YP_002499309.1| NADH (or F420H2) dehydrogenase subunit C [Methylobacterium nodulans
           ORS 2060]
 gi|219948614|gb|ACL59006.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           nodulans ORS 2060]
          Length = 215

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 137/196 (69%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  ++ L D +  +   +V   V +  EL+L V+  ++V + + LRDDP C F   ID+C
Sbjct: 17  IEALQALSDRLAEALGSAVTDRVIAFDELTLTVEAQEIVRVLTHLRDDPLCAFRCFIDIC 76

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           G D+  R+ RFDVVYH LS ++N R+RVK+   E   VPS++ +YP A+W+ERE +D+YG
Sbjct: 77  GADYPGRARRFDVVYHLLSLRHNLRIRVKVQTDEATPVPSVIAVYPAANWYERETYDLYG 136

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           I F GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DF
Sbjct: 137 ILFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEGRVVYEPVKLTQEFRNFDF 196

Query: 182 LSPWEGVNSLFAKEDS 197
           LSPWEG + +   ++ 
Sbjct: 197 LSPWEGTDYVLPGDEK 212


>gi|146341113|ref|YP_001206161.1| NADH dehydrogenase subunit C [Bradyrhizobium sp. ORS278]
 gi|146193919|emb|CAL77936.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           (NDH-1, chain C) [Bradyrhizobium sp. ORS278]
          Length = 201

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 133/186 (71%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ LG  IV++  G+      +  +L++ VD   +V +   LRDDP C F+N  D+  V
Sbjct: 5   RLDALGQTIVSALPGAALGHSVAFNQLTVTVDPARIVEVVKHLRDDPGCRFINFTDITAV 64

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R+ RF+VVYHFLSP  N R+R+K    E   VPSI+ ++PGADWFERE +D+YG+ 
Sbjct: 65  DYPERAKRFEVVYHFLSPTLNTRIRLKAEADEMTQVPSIIDVFPGADWFEREAYDLYGVI 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPD+RRILTDYGF+GHPLRKDFP TGFVE+ YDD+ K+V+Y PV L QE R +DFLS
Sbjct: 125 FVGHPDMRRILTDYGFDGHPLRKDFPTTGFVEVRYDDQEKRVIYEPVRLNQEFRRFDFLS 184

Query: 184 PWEGVN 189
           PWEG +
Sbjct: 185 PWEGAD 190


>gi|217979051|ref|YP_002363198.1| NADH (or F420H2) dehydrogenase, subunit C [Methylocella silvestris
           BL2]
 gi|217504427|gb|ACK51836.1| NADH (or F420H2) dehydrogenase, subunit C [Methylocella silvestris
           BL2]
          Length = 204

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 135/186 (72%), Gaps = 3/186 (1%)

Query: 6   EDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           EDL  ++     +  G V  A  + GEL+L V    LV   +FLRDDP C FV  IDL  
Sbjct: 3   EDLKQFVETLSAALRGWVEDASLAYGELTLTVRADCLVETVAFLRDDPSCLFVCFIDLTA 62

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD+ +R  RFDVV H LSPK+NRR+RVK+   E   V S+ G++P A+WFERE +D++G+
Sbjct: 63  VDYPTREKRFDVVTHLLSPKHNRRIRVKVEADEQTPVASLSGLFPAANWFEREAYDLFGV 122

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           +F GHPDLRR+LTDYGF+GHPLRKDFP+TG+VE+ YDD+ K+V+Y PV LMQE R++DFL
Sbjct: 123 YFSGHPDLRRLLTDYGFDGHPLRKDFPMTGYVEVRYDDEEKRVLYEPVALMQEFRNFDFL 182

Query: 183 SPWEGV 188
           SPWEG 
Sbjct: 183 SPWEGA 188


>gi|114569907|ref|YP_756587.1| NADH dehydrogenase subunit C [Maricaulis maris MCS10]
 gi|122316123|sp|Q0APY8|NUOC_MARMM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|114340369|gb|ABI65649.1| NADH dehydrogenase subunit C [Maricaulis maris MCS10]
          Length = 200

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/199 (49%), Positives = 145/199 (72%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   ++ LG++I N+   +V     + GEL++++    + ++ ++LRDDP C F  +ID+
Sbjct: 1   MSEALKVLGEHIANAQDAAVTGWSIANGELTVEIHRDRIETVLTWLRDDPACRFTTLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R+ RF+VVYH LS   N R+RVK++  E   VP+++ +YP ADWFERE +DMY
Sbjct: 61  CGVDYPQRAERFEVVYHLLSMHQNHRIRVKLSTDEEAPVPTVIPVYPVADWFEREAFDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F  HPDLRR+LTDYGFEG+PLRKDFP+TG+VE+ +D++ K+VVY PVEL+QE+RD+D
Sbjct: 121 GIVFADHPDLRRLLTDYGFEGYPLRKDFPLTGYVEVRWDEEEKRVVYEPVELVQEYRDFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   +   ++  +
Sbjct: 181 FMSPWEGAKYILPGDEKAE 199


>gi|188580283|ref|YP_001923728.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium populi
           BJ001]
 gi|218534298|sp|B1ZA44|NUOC_METPB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|179343781|gb|ACB79193.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium populi
           BJ001]
          Length = 219

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 136/194 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  +G+ I  +   +V     + GEL+L V   D+V   ++LRDDP+C F   ID+CGVD
Sbjct: 24  LRAMGERITGALGPAVTDWSIAHGELTLIVQGSDIVYALTYLRDDPNCAFRCFIDICGVD 83

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RFDVVYH LS ++N R+RVK+       VPS + ++P A+WFERE +D+YGI F
Sbjct: 84  YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWFERETYDLYGILF 143

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLSP
Sbjct: 144 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP 203

Query: 185 WEGVNSLFAKEDSK 198
           WEG + +   ++ K
Sbjct: 204 WEGTDYVLPGDEKK 217


>gi|170742513|ref|YP_001771168.1| NADH (or F420H2) dehydrogenase subunit C [Methylobacterium sp.
           4-46]
 gi|218534301|sp|B0ULK6|NUOC_METS4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|168196787|gb|ACA18734.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium sp.
           4-46]
          Length = 215

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 136/193 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ L D +  +  G+V     +  EL+L V+  ++V + + LRDDP C F + ID+CG D
Sbjct: 20  LQALSDRLAETLGGAVVERAIAFDELTLVVEPSEIVRVLTHLRDDPACGFRSFIDICGAD 79

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RFDVVYH LS ++NRR+RVK+   E   VPS++ ++P A+W+ERE +D+YGI F
Sbjct: 80  YPGREKRFDVVYHLLSLRHNRRIRVKVQTDEATPVPSVITVFPAANWYERETYDLYGILF 139

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R +DFLSP
Sbjct: 140 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEGRVVYEPVKLSQEFRQFDFLSP 199

Query: 185 WEGVNSLFAKEDS 197
           WEG + +   ++ 
Sbjct: 200 WEGTDYVLPGDEK 212


>gi|319405696|emb|CBI79319.1| NADH dehydrogenase I chain C [Bartonella sp. AR 15-3]
          Length = 202

 Score =  222 bits (565), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 133/187 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M + + +L +Y+ ++    +  ++   GEL++      +  +  F+RDD  C F++IID+
Sbjct: 1   MSKTLVELSNYLKDNLGDKIEESIFEFGELTIVSRLDAITDVLMFVRDDTRCQFISIIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP+YN RLR+K+   E  +V S   IYPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSREKRFDVSYQLLSPRYNLRLRIKVRTDENVAVASACSIYPGAEWYEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y P+ L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNETKRVIYEPIILRQEMRNFD 180

Query: 181 FLSPWEG 187
           FLSPWEG
Sbjct: 181 FLSPWEG 187


>gi|163746198|ref|ZP_02153557.1| NADH dehydrogenase subunit C [Oceanibulbus indolifex HEL-45]
 gi|161380943|gb|EDQ05353.1| NADH dehydrogenase subunit C [Oceanibulbus indolifex HEL-45]
          Length = 209

 Score =  221 bits (562), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++++LG YI       V     + GEL++DV   ++  L  FL+ DP C F  ++D+
Sbjct: 1   MSEQLQELGAYIEAKRPDCVLGWDVTRGELNMDVALANIAGLVEFLKGDPTCRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+R++    E   VPSI G++P ADWFEREV+DM+
Sbjct: 61  TAVDYPGRAKRFDVVYHFLSMYQNHRIRLRATAREKDMVPSITGVHPSADWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEAAKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           F+SPWEG   +   +D 
Sbjct: 181 FMSPWEGAEYILPGDDK 197


>gi|240137580|ref|YP_002962051.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           [Methylobacterium extorquens AM1]
 gi|240007548|gb|ACS38774.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           [Methylobacterium extorquens AM1]
          Length = 224

 Score =  221 bits (562), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 134/194 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  +G+ I  +   +V     S GEL+L V   D+V   ++LRD+P C F   ID+CGVD
Sbjct: 29  LRAMGERIAGALGPAVTEWAISRGELTLVVQGSDIVYALTYLRDEPACAFRCFIDICGVD 88

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RFDVVYH LS ++N R+RVK+       VPS + ++P A+W+ERE +D+YGI F
Sbjct: 89  YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWYERETYDLYGILF 148

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLSP
Sbjct: 149 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP 208

Query: 185 WEGVNSLFAKEDSK 198
           WEG + +   ++  
Sbjct: 209 WEGTDYVLPGDEKT 222


>gi|254469529|ref|ZP_05082934.1| NADH-ubiquinone oxidoreductase chain c protein [Pseudovibrio sp.
           JE062]
 gi|211961364|gb|EEA96559.1| NADH-ubiquinone oxidoreductase chain c protein [Pseudovibrio sp.
           JE062]
          Length = 200

 Score =  220 bits (561), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 140/200 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG++I  +    V     + G+L+L+V    ++++  FLRDD  C F+ ++D+
Sbjct: 1   MDETLSELGEFIELTLGDKVESWSVAYGDLTLNVSHDQIINVLRFLRDDARCGFIALVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ +R  RFDVVYH LSP  N R+RVK+   E   VPS++ I+ GA+WFERE +DMY
Sbjct: 61  CGVDWPAREKRFDVVYHLLSPVQNLRIRVKVQTDETTPVPSVISIFKGAEWFEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F G+PDLRR+LTDYGF+G PLRKDFP+TG+VE+ YDD  K+VVY PV+L QE R +D
Sbjct: 121 GILFTGNPDLRRLLTDYGFDGFPLRKDFPLTGYVEVRYDDTKKRVVYEPVQLTQEFRSFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           FLSPWEG + +   ++   +
Sbjct: 181 FLSPWEGTDYVLPGDEKASN 200


>gi|114771818|ref|ZP_01449211.1| NADH dehydrogenase subunit C [alpha proteobacterium HTCC2255]
 gi|114547634|gb|EAU50525.1| NADH dehydrogenase subunit C [alpha proteobacterium HTCC2255]
          Length = 202

 Score =  220 bits (561), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 1/197 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M   + DLG+ I +    +V  + VN  GEL L+V    +V++  FL+ +    F  +ID
Sbjct: 1   MSNTLTDLGEVIASKLPNAVTASGVNDFGELVLNVKLEKIVTVVEFLKTNSAMRFSTLID 60

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  +D+ SR NRF++VYHFLS   N R+R+K+ V+E   VPSI  I+PGA+WFEREV+DM
Sbjct: 61  ITAIDYPSRKNRFEMVYHFLSMYTNMRIRLKLQVSEDGMVPSICEIHPGANWFEREVFDM 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+ F GHPDLRRILTDYGF GHPLRKDFP TG+ EL YD+  K+VVY PV L QE+R +
Sbjct: 121 YGVLFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTELRYDEVGKRVVYEPVTLTQEYRQF 180

Query: 180 DFLSPWEGVNSLFAKED 196
           DF+SPWEG   +   +D
Sbjct: 181 DFMSPWEGAQYILPGDD 197


>gi|89053662|ref|YP_509113.1| NADH dehydrogenase subunit C [Jannaschia sp. CCS1]
 gi|122499243|sp|Q28T74|NUOC_JANSC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|88863211|gb|ABD54088.1| NADH dehydrogenase subunit C [Jannaschia sp. CCS1]
          Length = 207

 Score =  220 bits (561), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 101/203 (49%), Positives = 140/203 (68%), Gaps = 1/203 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M   +++L +Y+    S  V    VN++GELS+ V    +V    FL+ D  C F  +ID
Sbjct: 1   MSDALKELAEYLSEKRSDDVVSTDVNAMGELSVTVAPAQMVGFIEFLKTDRTCRFSTLID 60

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  VD+ SR  RFDVVYHFLS   N R+RV+ A+ E  ++PSI G++PGA W+ERE++DM
Sbjct: 61  ITAVDYPSRDRRFDVVYHFLSMYQNHRVRVRAAIREEDTLPSISGVHPGAGWYEREIYDM 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +GI F GH DLRR+LTDYGF GHPLRKDFP TG+ E+ YD+++K+VVY PV L+QE+R +
Sbjct: 121 FGILFTGHADLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEELKRVVYEPVSLVQEYRQF 180

Query: 180 DFLSPWEGVNSLFAKEDSKDDMS 202
           DF+SPWEG   +   ++  DD +
Sbjct: 181 DFMSPWEGAQYVLPGDEKADDKA 203


>gi|254560051|ref|YP_003067146.1| NADH-quinone oxidoreductase subunit C [Methylobacterium extorquens
           DM4]
 gi|254267329|emb|CAX23161.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           [Methylobacterium extorquens DM4]
          Length = 224

 Score =  220 bits (560), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 98/185 (52%), Positives = 131/185 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  +G+ I  +   +V     + GEL+L V   D+V   ++LRD+P C F   ID+CGVD
Sbjct: 29  LRAMGERIAGALGPAVTEWAITRGELTLVVQGSDIVYALTYLRDEPACAFRCFIDICGVD 88

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RFDVVYH LS ++N R+RVK+       VPS + ++P A+W+ERE +D+YGI F
Sbjct: 89  YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWYERETYDLYGILF 148

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLSP
Sbjct: 149 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP 208

Query: 185 WEGVN 189
           WEG +
Sbjct: 209 WEGTD 213


>gi|163868371|ref|YP_001609580.1| NADH dehydrogenase subunit C [Bartonella tribocorum CIP 105476]
 gi|218534256|sp|A9IUQ0|NUOC_BART1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|161018027|emb|CAK01585.1| NADH dehydrogenase I chain C [Bartonella tribocorum CIP 105476]
          Length = 203

 Score =  220 bits (560), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 133/201 (66%), Gaps = 3/201 (1%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+ N     +   V + GEL++      +  +  F+RDD HC F+N+ D+
Sbjct: 2   MDESLVELATYLKNKLGNKLEETVFAFGELTIVARLDAITDVLMFVRDDSHCQFINLTDI 61

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP+ N RLRVK+   E   V S   +YPGA+W+ERE +DMY
Sbjct: 62  SGVDYPSRDKRFDVSYQLLSPRENLRLRVKVRTDENTPVASACTVYPGAEWYERETYDMY 121

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++D
Sbjct: 122 GILFSGHPDLRRILTDYGFEGYPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFD 181

Query: 181 FLSPWEGVNSLF---AKEDSK 198
           FLSPWEG   +     KED K
Sbjct: 182 FLSPWEGGQYVLPCDGKEDEK 202


>gi|296444796|ref|ZP_06886759.1| NADH (or F420H2) dehydrogenase, subunit C [Methylosinus
           trichosporium OB3b]
 gi|296257744|gb|EFH04808.1| NADH (or F420H2) dehydrogenase, subunit C [Methylosinus
           trichosporium OB3b]
          Length = 200

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 132/189 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++E LG+ +  +  G V     + GEL+++V+    +     LRDDP   FV+ ID+
Sbjct: 1   MSAELELLGEKVAAALPGIVTGLKIAYGELTIEVERSRWLDAARALRDDPELLFVSFIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+  R  RFDVV H LSP+ N+R+R+K    E   V S+  +YPGADWFERE +D++
Sbjct: 61  TAADYPEREQRFDVVTHLLSPRRNQRIRIKTQTDEATPVTSLTSLYPGADWFERETYDLF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F+GHPDLRRI+TDYGF+GHPLRKDFP+TG+VE+ YDD+ K+VVY PV L QE+R +D
Sbjct: 121 GVIFDGHPDLRRIMTDYGFDGHPLRKDFPMTGYVEVRYDDERKRVVYEPVNLTQEYRKFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEGV 
Sbjct: 181 FLSPWEGVQ 189


>gi|49475656|ref|YP_033697.1| NADH dehydrogenase subunit C [Bartonella henselae str. Houston-1]
 gi|81827709|sp|Q6G390|NUOC_BARHE RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|49238463|emb|CAF27691.1| NADH dehydrogenase I, C subunit [Bartonella henselae str.
           Houston-1]
          Length = 202

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 132/200 (66%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +E+L  Y+ +     +   V + GEL++      +  +  F+RDD  C F+NI D+
Sbjct: 1   MSESLEELAAYLKSKLGDKLEETVLAFGELTIVSRLDAITDVLIFVRDDSRCQFINITDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+  R  RFDV Y  LSP++N RLRVK+   E   V S   IYPGA+W+ERE +DMY
Sbjct: 61  SGVDYPCRDKRFDVSYQLLSPRHNLRLRVKVRTDENIPVASACSIYPGAEWYERETYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           FLSPWEG   +   ++   D
Sbjct: 181 FLSPWEGAQYILPCDEKTKD 200


>gi|319404257|emb|CBI77850.1| NADH dehydrogenase I chain C [Bartonella rochalimae ATCC BAA-1498]
          Length = 202

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 131/187 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+ +     +  ++ + GEL++      +  +  F+RDD  C F++I D+
Sbjct: 1   MSETLSELSSYLKDKLGDKIEESILAFGELTVVSRLDAITDVLMFVRDDSRCQFISITDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP++N RLRVK+   E  +V S   IYPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSREKRFDVSYQLLSPRHNLRLRVKVRTDENVAVASACSIYPGAEWYEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++VK+++Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEVKRIIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEG 187
           FLSPWEG
Sbjct: 181 FLSPWEG 187


>gi|218529212|ref|YP_002420028.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           chloromethanicum CM4]
 gi|218521515|gb|ACK82100.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           chloromethanicum CM4]
          Length = 219

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 98/194 (50%), Positives = 134/194 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  +G+ I  +   +V     + GEL+L V   D+V   ++LRD+P C F   ID+CGVD
Sbjct: 24  LRAMGERIAGALGPAVTEWAITRGELTLVVQGSDIVYALTYLRDEPACAFRCFIDICGVD 83

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RFDVVYH LS ++N R+RVK+       VPS + ++P A+W+ERE +D+YGI F
Sbjct: 84  YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWYERETYDLYGILF 143

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLSP
Sbjct: 144 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP 203

Query: 185 WEGVNSLFAKEDSK 198
           WEG + +   ++  
Sbjct: 204 WEGTDYVLPGDEKT 217


>gi|163850515|ref|YP_001638558.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           extorquens PA1]
 gi|218534307|sp|A9W1N1|NUOC_METEP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|163662120|gb|ABY29487.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
           extorquens PA1]
          Length = 219

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 98/194 (50%), Positives = 134/194 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  +G+ I  +   +V     + GEL+L V   D+V   ++LRD+P C F   ID+CGVD
Sbjct: 24  LRAMGERIAGALGPAVTEWAITRGELTLVVQGSDIVYALTYLRDEPACAFRCFIDICGVD 83

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RFDVVYH LS ++N R+RVK+       VPS + ++P A+W+ERE +D+YGI F
Sbjct: 84  YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWYERETYDLYGILF 143

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TGFVE+ YD    +VVY PV+L QE R++DFLSP
Sbjct: 144 SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP 203

Query: 185 WEGVNSLFAKEDSK 198
           WEG + +   ++  
Sbjct: 204 WEGTDYVLPGDEKT 217


>gi|319898884|ref|YP_004158977.1| NADH dehydrogenase I chain C [Bartonella clarridgeiae 73]
 gi|319402848|emb|CBI76399.1| NADH dehydrogenase I chain C [Bartonella clarridgeiae 73]
          Length = 202

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (70%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L +Y+ +     +  +V + GEL++      ++ +  F+RDD  C F+NI D+ GVD+ 
Sbjct: 7   ELSNYLKDKLGDKIEESVFAFGELTIVSRLNAIIDVLMFVRDDSRCQFINITDISGVDYP 66

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           SR  RFDV Y  LSP++N RLR+K+   E   + S   +YPGA+W+ERE +DMYGI F G
Sbjct: 67  SREKRFDVSYQLLSPRHNLRLRIKVRTDENTPIASACSVYPGAEWYERETYDMYGILFSG 126

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y PV L QE R +DFLSPWE
Sbjct: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVILRQEMRSFDFLSPWE 186

Query: 187 G 187
           G
Sbjct: 187 G 187


>gi|294677056|ref|YP_003577671.1| NADH-quinone oxidoreductase subunit C [Rhodobacter capsulatus SB
           1003]
 gi|6647659|sp|O84971|NUOC_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|3282561|gb|AAC24987.1| NUOC [Rhodobacter capsulatus]
 gi|294475876|gb|ADE85264.1| NADH-quinone oxidoreductase, C subunit [Rhodobacter capsulatus SB
           1003]
          Length = 199

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 134/198 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K++DL  ++     G V  A    GEL++ V    +     FLRDD  C F  ++DL
Sbjct: 1   MSEKLQDLAAHVAQQRPGDVISAEVVQGELTVTVKPEGIADFVRFLRDDAGCRFTTLVDL 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RF++V+HFLS   N+R+RVK  +AE    PSIV +YP A+W+EREV+DM+
Sbjct: 61  TAVDWPERVERFEMVWHFLSMWKNQRIRVKAGLAEDAMCPSIVEVYPAANWYEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG++EL YD+  K+VVY PV+L QE+R +D
Sbjct: 121 GILFSGHPDLRRLLTDYGFRGHPLRKDFPTTGYIELRYDEVQKRVVYEPVKLAQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           FLSPWEG  S+   ++ +
Sbjct: 181 FLSPWEGAQSVLPGDEKR 198


>gi|319407265|emb|CBI80904.1| NADH dehydrogenase I chain C [Bartonella sp. 1-1C]
          Length = 202

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 130/187 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+ +     +  ++ + GEL++      +  +  F+RDD  C F++I D+
Sbjct: 1   MSETLSELSSYLKDKLGDKIEESILAFGELTIVSRLDAITDVLMFVRDDSRCQFISITDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP++N RLR+K+   E  +V S   IYPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSREKRFDVSYQLLSPRHNLRLRIKVRTDENIAVASACSIYPGAEWYEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEG 187
           FLSPWEG
Sbjct: 181 FLSPWEG 187


>gi|49474179|ref|YP_032221.1| NADH dehydrogenase subunit C [Bartonella quintana str. Toulouse]
 gi|81827625|sp|Q6FZY9|NUOC_BARQU RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|49239683|emb|CAF26058.1| NADH dehydrogenase I, C subunit [Bartonella quintana str. Toulouse]
          Length = 202

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 128/189 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+ N     +   + + GEL++      +  +  F+RDD  C F+N+ D+
Sbjct: 1   MNESLVELSAYLKNKLGDKLEETILAFGELTIVSRLDAITGVLMFVRDDSRCQFINLTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  L+P++N RLR+K+   E   V S   IYPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSRDKRFDVSYQLLAPRHNLRLRIKVRTDENTPVASACSIYPGAEWYEREAYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 181 FLSPWEGAQ 189


>gi|240850585|ref|YP_002971985.1| NADH dehydrogenase I subunit C [Bartonella grahamii as4aup]
 gi|240267708|gb|ACS51296.1| NADH dehydrogenase I subunit C [Bartonella grahamii as4aup]
          Length = 201

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M + + +L  Y+ N     +   V + GEL++      ++ +  F+RDD  C F+N+ D+
Sbjct: 1   MDKTLVELAAYLENKLKNKLEETVIAFGELTIVARLDAIIDVLMFVRDDSRCQFINLTDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+ SR  RFDV Y  LSP+ N RLRVK+   E   V S   +YPGA+W+ERE +DMY
Sbjct: 61  SGVDYPSRDKRFDVSYQLLSPRENLRLRVKVRTDENTPVASACTVYPGAEWYERETYDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGFEG+PLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++D
Sbjct: 121 GILFSGHPDLRRILTDYGFEGYPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFD 180

Query: 181 FLSPWEG 187
           FLSPWEG
Sbjct: 181 FLSPWEG 187


>gi|260434180|ref|ZP_05788151.1| NADH-quinone oxidoreductase subunit c [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418008|gb|EEX11267.1| NADH-quinone oxidoreductase subunit c [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 201

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 139/199 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG +I       V     + GEL+++V   +LV    FL+ D +C F  ++D+
Sbjct: 1   MSEALKELGAHIELKRPDCVLSWAVAHGELTVEVSPSNLVEFVEFLKTDQNCKFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R++I+V E   VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPERAKRFDVVYHFLSMYQNQRIRIRISVREEDMVPSIVDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG N +   ++ K+
Sbjct: 181 FMSPWEGANYILPGDEKKE 199


>gi|126729551|ref|ZP_01745364.1| NADH dehydrogenase subunit C [Sagittula stellata E-37]
 gi|126709670|gb|EBA08723.1| NADH dehydrogenase subunit C [Sagittula stellata E-37]
          Length = 202

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/202 (49%), Positives = 140/202 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           MV+ +++LGD+I       V     + GEL++DV   ++     FL+ DP C F  ++D+
Sbjct: 1   MVQALKELGDHIATKRPDCVVAWDVTHGELNVDVAPSNIRGFVDFLKTDPTCRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+  R  RFDVVYHFLS   N R+R++++V E + VPSIV ++P A+WFERE +DMY
Sbjct: 61  TGVDYPERPKRFDVVYHFLSMYQNHRIRLRVSVREDEMVPSIVPVHPSANWFERETFDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD++ K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEERKRVVYEPVTLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDDMS 202
           F+SPWEG   +   ++  +  +
Sbjct: 181 FMSPWEGAKYVLPGDEKTEGQA 202


>gi|121602302|ref|YP_989072.1| NADH dehydrogenase subunit C [Bartonella bacilliformis KC583]
 gi|218534252|sp|A1USW9|NUOC_BARBK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|120614479|gb|ABM45080.1| NADH dehydrogenase (quinone), C subunit [Bartonella bacilliformis
           KC583]
          Length = 205

 Score =  217 bits (553), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 100/183 (54%), Positives = 128/183 (69%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L  Y+       +  +  + GEL++      ++ +  F+RDD  C F+NIID+ GVD+ 
Sbjct: 8   ELAAYLKEKLGDKLEESALAFGELTIVSRLDAIIDVLMFIRDDSRCQFINIIDISGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           +R  RFDV Y  LSP  N RLRVK+   E   VPS+  +YPGA+W+ERE +DMYGI F G
Sbjct: 68  ARDKRFDVSYQLLSPFQNLRLRVKVRTDEDVPVPSVCSVYPGAEWYERETYDMYGILFSG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHPLRKDFPVTGFVE  YD++ K+V+Y PV L QE R++DFLSPWE
Sbjct: 128 HPDLRRILTDYGFEGHPLRKDFPVTGFVECRYDNEAKRVIYEPVVLRQEMRNFDFLSPWE 187

Query: 187 GVN 189
           G +
Sbjct: 188 GAD 190


>gi|110680470|ref|YP_683477.1| NADH dehydrogenase subunit C [Roseobacter denitrificans OCh 114]
 gi|122972618|sp|Q163Q2|NUOC_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|109456586|gb|ABG32791.1| NADH-quinone oxidoreductase chain C [Roseobacter denitrificans OCh
           114]
          Length = 199

 Score =  217 bits (553), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 138/199 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG+YI    +  V     +  EL+LDV   ++V L  FL+ D  C F  +ID+
Sbjct: 1   MSEPLQELGNYIATKRADCVLAWDVTNKELNLDVTPSNIVGLVEFLKTDATCRFSTLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ R+DVVYH LS   N R+R+++++ E + +PS++ ++P A+WFEREV+DM+
Sbjct: 61  TAVDYTGRAKRYDVVYHLLSMYQNHRVRLRVSIREDQMMPSVISVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   +   ++ K+
Sbjct: 181 FMSPWEGAEYILPGDEKKE 199


>gi|304322206|ref|YP_003855849.1| NADH dehydrogenase subunit C [Parvularcula bermudensis HTCC2503]
 gi|303301108|gb|ADM10707.1| NADH dehydrogenase subunit C [Parvularcula bermudensis HTCC2503]
          Length = 200

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 134/193 (69%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L D+I      ++     + GELS+ V  G +V    FLRDDP C FV +IDLCGVD+ 
Sbjct: 8   ELKDHIAAWGGEAIIAQEVAFGELSVTVAAGKIVDTLKFLRDDPICRFVQLIDLCGVDYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RF+VVYH LS   N R+R+K+ V +  S PS+  I+P ADW+ERE +DMYGI F+G
Sbjct: 68  ERRKRFEVVYHLLSLHNNTRIRIKVPVGQSDSCPSVRSIFPNADWYEREAFDMYGIVFDG 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEG+PLRKDFP+TGF E+ +DD+  +VVY PVEL QE R++D LSPW 
Sbjct: 128 HPDLRRILTDYGFEGYPLRKDFPLTGFTEVRWDDEQSRVVYEPVELAQEFRNFDTLSPWR 187

Query: 187 GVNSLFAKEDSKD 199
           G + +   ++  D
Sbjct: 188 GSDYVLPGDEKAD 200


>gi|114799741|ref|YP_760448.1| NADH dehydrogenase subunit C [Hyphomonas neptunium ATCC 15444]
 gi|123128796|sp|Q0C1E5|NUOC_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|114739915|gb|ABI78040.1| NADH-quinone oxidoreductase, C subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 202

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 103/199 (51%), Positives = 136/199 (68%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
            + + DL  +I      +VR     VGEL+L  +   +V L  FLRDD  C F   ID+C
Sbjct: 3   TQALSDLAAHIEGRMPDAVRSWQIHVGELTLLAERDHIVPLLRFLRDDQQCNFETFIDVC 62

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  RS RF+VVYH LS + N R+RV+I   E  +VPS+V ++P A+WFERE +DMYG
Sbjct: 63  GVDYPERSERFEVVYHLLSMRMNHRIRVRIRTDEETAVPSVVSLWPAANWFEREAFDMYG 122

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           I F  HPDLRRILTDYGFEG PLRKDFP+TG  E+ YDD  K+V+Y PV+L QE+R++DF
Sbjct: 123 IQFADHPDLRRILTDYGFEGWPLRKDFPLTGHYEVRYDDLEKRVIYEPVKLAQEYRNFDF 182

Query: 182 LSPWEGVNSLFAKEDSKDD 200
           LSPWEG+ ++   ++   +
Sbjct: 183 LSPWEGMTTVIPGDEKAKE 201


>gi|83858413|ref|ZP_00951935.1| NADH dehydrogenase subunit C [Oceanicaulis alexandrii HTCC2633]
 gi|83853236|gb|EAP91088.1| NADH dehydrogenase subunit C [Oceanicaulis alexandrii HTCC2633]
          Length = 205

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 136/189 (71%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG ++  + S  VR    +  EL+L +    +V +  FLRDD  C F  +ID+
Sbjct: 3   MTETMTELGAHLSAALSDDVRSVDVAHEELTLTIHRDRVVKVLRFLRDDALCRFTTLIDI 62

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+ SRS+RFDVVYH LS   N+R+RV ++  E   V S+V ++P A+WFERE +DMY
Sbjct: 63  CGVDWPSRSDRFDVVYHLLSMHLNQRIRVVLSTDEDTPVNSVVELFPAANWFEREAFDMY 122

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F+ HPDLRRILTDYGF GHPLRKDFP++GF ++ YDD+ K+VVY PVEL+QE+RD+D
Sbjct: 123 GILFDHHPDLRRILTDYGFHGHPLRKDFPLSGFNQVVYDDEQKRVVYEPVELVQEYRDFD 182

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 183 FLSPWEGAK 191


>gi|300023454|ref|YP_003756065.1| NADH (or F420H2) dehydrogenase, subunit C [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525275|gb|ADJ23744.1| NADH (or F420H2) dehydrogenase, subunit C [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 199

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 138/194 (71%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +I +L  ++   F   +  +  +  E S+ V    +V + + LRDDP C F  +ID+CGV
Sbjct: 2   EIANLITHVGTLFGADILASSTAFDEASISVPRDRIVEVLTKLRDDPKCQFEVLIDICGV 61

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R+ RF+VVYH LSP+ N+RLR+KI+  E  +V S+  ++P A+W+ERE +D+YGI 
Sbjct: 62  DYPERAERFEVVYHLLSPRLNQRLRIKISTDETTAVQSVNDVFPAANWYEREAYDLYGIR 121

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPDLRRILTDYGF+GHPLRKDFP+TG+VE+ YDD+ K+VVY PV+L QE RD+DF S
Sbjct: 122 FIGHPDLRRILTDYGFQGHPLRKDFPLTGYVEVRYDDEKKRVVYEPVKLTQEFRDFDFES 181

Query: 184 PWEGVNSLFAKEDS 197
           PWEG N +   ++ 
Sbjct: 182 PWEGPNYIIPGDEK 195


>gi|288958987|ref|YP_003449328.1| NADH dehydrogenase I chain C [Azospirillum sp. B510]
 gi|288911295|dbj|BAI72784.1| NADH dehydrogenase I chain C [Azospirillum sp. B510]
          Length = 209

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 133/196 (67%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           + +++LGD I     G V      +GEL + V    ++++ + LRDDP   F  + D+  
Sbjct: 4   QALKELGDVIAAKIGGDVLKVEVRLGELMVTVKRPAILAVLTTLRDDPATRFEQLTDITA 63

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD+  R+ RF+VVY  LS  +NRR+RVK+A  E   VPS V ++  A+WFEREVWD++GI
Sbjct: 64  VDYPDRAERFEVVYQLLSYSHNRRMRVKLATDEDTPVPSAVSVFSAANWFEREVWDLFGI 123

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FFE HPDLRRILTDYGFEGHP RKDFP+TG+VE  YD+  K+VVY PV L Q+ R +DFL
Sbjct: 124 FFENHPDLRRILTDYGFEGHPFRKDFPLTGYVEARYDEDQKRVVYEPVRLTQDFRAFDFL 183

Query: 183 SPWEGVNSLFAKEDSK 198
           SPWEG+ ++    D K
Sbjct: 184 SPWEGMTNVMLPGDEK 199


>gi|83951740|ref|ZP_00960472.1| NADH dehydrogenase subunit C [Roseovarius nubinhibens ISM]
 gi|83836746|gb|EAP76043.1| NADH dehydrogenase subunit C [Roseovarius nubinhibens ISM]
          Length = 202

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 137/200 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG YI    S  V       GEL++DV   ++  L  FLR+D  C F  ++D+
Sbjct: 1   MSEALKELGAYIEAKRSDCVLSWEVVHGELTVDVALANITGLVEFLRNDQTCRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+ +R  RFDVVYHFLS   N R+R++ AV E   VPSI  ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPARPKRFDVVYHFLSMYQNHRIRLRAAVREEDMVPSITDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+ +K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEALKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           F+SPWEG   +   ++ +++
Sbjct: 181 FMSPWEGAEYILPGDEKQEE 200


>gi|260427526|ref|ZP_05781505.1| NADH-quinone oxidoreductase subunit c [Citreicella sp. SE45]
 gi|260422018|gb|EEX15269.1| NADH-quinone oxidoreductase subunit c [Citreicella sp. SE45]
          Length = 202

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 139/199 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M + + +LG ++       V     ++GEL++DV   ++     FL+ DP C F  ++D+
Sbjct: 1   MTQAMSELGGHLELKRPDCVLGWNVALGELNVDVASSNIAGFVEFLKTDPSCRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+RV++AV E + VPSI G++  A+WFEREV+DM+
Sbjct: 61  TAVDYPERAKRFDVVYHFLSMYQNHRIRVRVAVREDEVVPSITGVHVSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+++K+VVY PV L+QE+R +D
Sbjct: 121 GIIFSGHPDLRRLLTDYGFRGHPLRKDFPTTGYVEVRYDEELKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   +   ++  +
Sbjct: 181 FMSPWEGAQYVLPGDEKAE 199


>gi|255263161|ref|ZP_05342503.1| NADH-quinone oxidoreductase subunit c [Thalassiobium sp. R2A62]
 gi|255105496|gb|EET48170.1| NADH-quinone oxidoreductase subunit c [Thalassiobium sp. R2A62]
          Length = 203

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 135/200 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M +++ DLG +IV      V     S GEL++ V   +LV    FL+ D  C    ++D+
Sbjct: 1   MSQEMNDLGAHIVAKRPDCVLSHEVSYGELNVTVSVSNLVDFVEFLKSDATCKLSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+ SR+ RFDVVYH LS   N R+R+++ + E   VPSI+ +YP A+WFEREV+DM+
Sbjct: 61  TAVDYPSRAKRFDVVYHMLSMYQNHRIRIRVQIREEDMVPSIIDVYPAANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           F+SPWEG   +   +D  ++
Sbjct: 181 FMSPWEGAEYILPGDDKVEE 200


>gi|163732065|ref|ZP_02139511.1| NADH dehydrogenase subunit C [Roseobacter litoralis Och 149]
 gi|161394363|gb|EDQ18686.1| NADH dehydrogenase subunit C [Roseobacter litoralis Och 149]
          Length = 201

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 140/199 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG+YI    +  V     + GEL++DV   ++V L  FL+ D  C F +++D+
Sbjct: 1   MSEPLQELGNYIATKRTDCVLAWDVTHGELNVDVTPSNIVGLVEFLKTDATCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ R+DVVYH LS   N R+R+++++ + + +PS++ ++P A+WFEREV+DM+
Sbjct: 61  TAVDYTGRAKRYDVVYHLLSMYQNHRVRLRVSIRDDQMMPSVISVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   +   ++ ++
Sbjct: 181 FMSPWEGAEYILPGDEKQE 199


>gi|84516741|ref|ZP_01004099.1| NADH dehydrogenase subunit C [Loktanella vestfoldensis SKA53]
 gi|84509209|gb|EAQ05668.1| NADH dehydrogenase subunit C [Loktanella vestfoldensis SKA53]
          Length = 203

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 138/197 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG ++       V+    + GEL++ V    LVS   FL+ D +C F +++D+
Sbjct: 1   MTEALQELGAHLDLKRIDCVQSWDVTHGELTVTVAPSSLVSFVEFLKTDANCLFTSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+ SR+ RFD++YHFLS   N+R+RV++ + +   +PSI+G++P A+WFEREV+DM+
Sbjct: 61  TAVDYPSRAKRFDMIYHFLSMYQNQRIRVRVQIRDDDMMPSIIGVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           F+SPWEG   +   +D 
Sbjct: 181 FMSPWEGAKYVLPGDDK 197


>gi|154253663|ref|YP_001414487.1| NADH dehydrogenase subunit C [Parvibaculum lavamentivorans DS-1]
 gi|218534317|sp|A7HY47|NUOC_PARL1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|154157613|gb|ABS64830.1| NADH (or F420H2) dehydrogenase, subunit C [Parvibaculum
           lavamentivorans DS-1]
          Length = 200

 Score =  214 bits (545), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 135/199 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG++I+ +   SV     + GEL++      +  +  FLRDDP C F  ++D+
Sbjct: 1   MDESLAELGEHILGTLEESVLGFHVAFGELNVLAQAQSIARVLKFLRDDPACRFGTLLDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RFDVVYH LS   N+R+RV +   E  +VPS+V +YP A+W+ERE +DMY
Sbjct: 61  TAVDYPQRPERFDVVYHLLSMHQNQRIRVTVRTNEETAVPSVVAVYPSANWYERETFDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F  HPDLRRILTDYGF G+PLRKDFP+TG+VE+ YDD  K+VVY PV+L+QE R++D
Sbjct: 121 GVLFSDHPDLRRILTDYGFNGYPLRKDFPLTGYVEVRYDDDEKRVVYEPVKLVQEFRNFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   L   ++  +
Sbjct: 181 FMSPWEGAEYLLPGDEKAE 199


>gi|254466123|ref|ZP_05079534.1| NADH-quinone oxidoreductase chain c [Rhodobacterales bacterium Y4I]
 gi|206687031|gb|EDZ47513.1| NADH-quinone oxidoreductase chain c [Rhodobacterales bacterium Y4I]
          Length = 201

 Score =  214 bits (545), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 137/198 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG  I       V     S  EL++DV   ++  L  FL+ DP+C F  ++D+
Sbjct: 1   MTDALKELGAQIEAKRPDCVVAWSVSFDELTIDVTPSNIAGLVEFLKSDPNCKFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R++ AV E + VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPDRAKRFDVVYHFLSMYRNQRIRLRAAVREDEMVPSIVKVHPSANWFEREVYDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV+L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|254511854|ref|ZP_05123921.1| NADH-quinone oxidoreductase, c subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535565|gb|EEE38553.1| NADH-quinone oxidoreductase, c subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 200

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 94/172 (54%), Positives = 130/172 (75%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL++DV   +LV    FL+ D  C F +++D+ GVD+  R+ RFDVVYHFLS   N+R+
Sbjct: 28  GELNVDVAPSNLVEFVEFLKSDRSCQFSSLVDVTGVDYPERAKRFDVVYHFLSMYQNQRI 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+++++ E   VPSIV ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF G+PLRKD
Sbjct: 88  RLRVSIREDDMVPSIVDVHPSANWFEREVFDMFGILFSGHPDLRRILTDYGFRGYPLRKD 147

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           FP TG+ E+ YD+  K+VVY PV L+QE+R +DF+SPWEG N +   ++ ++
Sbjct: 148 FPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFDFMSPWEGANYILPGDEKQE 199


>gi|304391400|ref|ZP_07373342.1| NADH-quinone oxidoreductase chain 5 [Ahrensia sp. R2A130]
 gi|303295629|gb|EFL89987.1| NADH-quinone oxidoreductase chain 5 [Ahrensia sp. R2A130]
          Length = 204

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 128/188 (68%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           V  + DL  Y+  + S  +  AV +  EL+L     ++ ++  FLRDD    F+  IDL 
Sbjct: 3   VADLPDLKAYLDEALSDKLDGAVIAFNELTLTTTASNIHAVLRFLRDDVQTSFICFIDLA 62

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD+  R  RF+VVYH LSP+ N R+R+K++      VPSI  I+P ADWFERE +D+YG
Sbjct: 63  AVDYPQRRQRFEVVYHLLSPRQNLRVRIKLSTDAETPVPSINDIFPAADWFEREAYDLYG 122

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           + F GHPD+RR+LTDYGFEGHPLRKDFP+TGF ++ YDD  K+VVY PV L QE RD+DF
Sbjct: 123 VLFTGHPDMRRLLTDYGFEGHPLRKDFPLTGFTQVRYDDAEKRVVYEPVLLRQEFRDFDF 182

Query: 182 LSPWEGVN 189
            SPWEG +
Sbjct: 183 QSPWEGTD 190


>gi|163793189|ref|ZP_02187165.1| NADH dehydrogenase subunit C [alpha proteobacterium BAL199]
 gi|159181835|gb|EDP66347.1| NADH dehydrogenase subunit C [alpha proteobacterium BAL199]
          Length = 214

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 130/201 (64%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  + DL  +I +     V       GEL L      ++ + +FLRDD  C F  ++DLC
Sbjct: 10  ITALRDLAAHIESQLDQDVSDVTLIQGELCLRCRPSSVIKVLTFLRDDSQCQFKALMDLC 69

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD   R  RFDVVY+ LS + N R+R+K+A  E   VPS  G++  A W ERE WD++G
Sbjct: 70  GVDHPQREQRFDVVYNLLSIRQNTRVRLKVATDENTPVPSATGLFSSAGWMEREAWDLFG 129

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           I+F  HPDLRR+LTDYGFEGHPLRKDFP+TG+VE+ YDD  K+VVY PV+L Q+ R++DF
Sbjct: 130 IYFSEHPDLRRLLTDYGFEGHPLRKDFPLTGYVEVRYDDAQKRVVYEPVKLTQDFRNFDF 189

Query: 182 LSPWEGVNSLFAKEDSKDDMS 202
           LSPWEG  +    ++  D  +
Sbjct: 190 LSPWEGARAALPGDEKADQTA 210


>gi|266655|sp|P29917|NQO5_PARDE RecName: Full=NADH-quinone oxidoreductase chain 5; AltName:
           Full=NADH dehydrogenase I, chain 5; AltName: Full=NDH-1,
           chain 5
          Length = 207

 Score =  213 bits (543), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 94/168 (55%), Positives = 126/168 (75%)

Query: 22  FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSP 81
            +  +VGEL+++     ++ L  FLR+DP+C F  +ID+  VD  +R  RFDVVYH LS 
Sbjct: 26  ISTQAVGELTVNATLSGVIGLIEFLRNDPNCRFSTLIDITAVDNPARPARFDVVYHLLSM 85

Query: 82  KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
             N+R+RVK+ V E + VPS++G++PGA+W+EREV+D++GI F GH DLRRILTDYGF G
Sbjct: 86  YQNQRIRVKVQVREDELVPSLIGVFPGANWYEREVFDLFGILFSGHSDLRRILTDYGFRG 145

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           HPLRKDFP TG+VE+ + D  K+VVY PV L+QE+R +DFLSPWEG  
Sbjct: 146 HPLRKDFPTTGYVEVRWSDIEKRVVYEPVNLVQEYRQFDFLSPWEGAK 193


>gi|259418836|ref|ZP_05742753.1| NADH-quinone oxidoreductase subunit c [Silicibacter sp. TrichCH4B]
 gi|259345058|gb|EEW56912.1| NADH-quinone oxidoreductase subunit c [Silicibacter sp. TrichCH4B]
          Length = 201

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 136/198 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+  ++DLG  I       V     + GEL++DV   ++  L  FLR D  C F  ++D+
Sbjct: 1   MIEALQDLGHQIEAKRPDCVLSWDIAHGELNIDVKPANIAGLVEFLRVDSACRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYH LS   N R+R+++AV E   VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPERTKRFDVVYHLLSMYQNHRIRLRVAVREEDMVPSIVDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV+L+QE+R +D
Sbjct: 121 GILFTGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVKLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG + +   ++ +
Sbjct: 181 FMSPWEGADYILPGDEKE 198


>gi|85703211|ref|ZP_01034315.1| NADH-quinone oxidoreductase, C subunit [Roseovarius sp. 217]
 gi|85672139|gb|EAQ26996.1| NADH-quinone oxidoreductase, C subunit [Roseovarius sp. 217]
          Length = 200

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG YI       V     + GEL++DV    +  L  FL+ D +C F +++D+
Sbjct: 1   MSATLKELGGYIEAKRVDCVLGWEVAHGELTVDVAINHIAGLAEFLKTDQNCAFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+R+++AV E   VPSI   YP A+WFERE++DM+
Sbjct: 61  TAVDYPERAKRFDVVYHFLSMYQNHRIRLRVAVREEDMVPSITEPYPAANWFEREIFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           F+SPWEG   +   ++ 
Sbjct: 181 FMSPWEGAEYILPGDEK 197


>gi|99080584|ref|YP_612738.1| NADH dehydrogenase subunit C [Ruegeria sp. TM1040]
 gi|122398270|sp|Q1GIP0|NUOC_SILST RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|99036864|gb|ABF63476.1| NADH (or F420H2) dehydrogenase subunit C [Ruegeria sp. TM1040]
          Length = 201

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 135/198 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+  ++DLG  I       V     + GEL++DV   ++  L  FLR D  C F  ++D+
Sbjct: 1   MIEALQDLGHQIEAKRPECVLSWDIAHGELNIDVKPANIAGLVEFLRVDSACRFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYH LS   N+R+R++ AV E   VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPERTKRFDVVYHLLSMYQNQRIRLRAAVREEDMVPSIVDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV+L+QE+R +D
Sbjct: 121 GILFTGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVKLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|254485931|ref|ZP_05099136.1| NADH-quinone oxidoreductase chain c [Roseobacter sp. GAI101]
 gi|214042800|gb|EEB83438.1| NADH-quinone oxidoreductase chain c [Roseobacter sp. GAI101]
          Length = 201

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 137/198 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++ +LG Y+       +     S GEL++DV   +L  L  F++ D  C F +++D+
Sbjct: 1   MSEQLNELGAYLEAKRPDCILGWDISHGELNMDVTKANLPGLVDFIKGDATCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R+++A+ E   VPSIV I+P A+WFEREV+DM+
Sbjct: 61  TAVDYPGRAKRFDVVYHFLSMYQNQRIRLRVAIREEDMVPSIVDIHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|84502606|ref|ZP_01000725.1| NADH dehydrogenase subunit C [Oceanicola batsensis HTCC2597]
 gi|84389001|gb|EAQ01799.1| NADH dehydrogenase subunit C [Oceanicola batsensis HTCC2597]
          Length = 202

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 137/200 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG +I       V     ++ EL++DV   ++     FLR D  C F  +ID+
Sbjct: 1   MTEALKELGSHIEMKRPDCVLGWEITLDELTIDVTPANIAGFVEFLRTDATCRFTTLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+  R  RFD++YHFLS   N R+R+++A  E + VP+I  ++P A+W+EREV+DM+
Sbjct: 61  TGVDYPERPKRFDLIYHFLSMYQNHRVRLRLAAREDEMVPTITEVHPSANWYEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPD+RR+LTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV+L+QE+R +D
Sbjct: 121 GIIFSGHPDMRRLLTDYGFRGYPLRKDFPTTGYTEVRYDETTKRVVYEPVKLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           F+SPWEG N +   ++ K++
Sbjct: 181 FMSPWEGANYILPGDEKKEE 200


>gi|114764720|ref|ZP_01443905.1| NADH dehydrogenase subunit C [Pelagibaca bermudensis HTCC2601]
 gi|114542920|gb|EAU45941.1| NADH dehydrogenase subunit C [Roseovarius sp. HTCC2601]
          Length = 197

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/171 (54%), Positives = 125/171 (73%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++DV   ++     FL+ DP C F  ++D+  VD   R  RFDVVYHFLS   N+R+R
Sbjct: 25  ELTVDVTPANIPGFVEFLKTDPSCRFSTLVDITAVDHPERPKRFDVVYHFLSMYQNQRIR 84

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +++AV E   VPS+ G +P ADWFEREV+DM+GI F GHPDLRRILTDYGF GHPLRKDF
Sbjct: 85  LRVAVREDDVVPSVTGTHPSADWFEREVFDMFGIIFSGHPDLRRILTDYGFRGHPLRKDF 144

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           P TG+VE+ YD+++K+VVY PV L+QE+R +DF+SPWEG   +   ++  +
Sbjct: 145 PTTGYVEVRYDEELKRVVYEPVSLVQEYRQFDFMSPWEGAQYVLPGDEKAE 195


>gi|149202672|ref|ZP_01879644.1| NADH dehydrogenase subunit C [Roseovarius sp. TM1035]
 gi|149143954|gb|EDM31988.1| NADH dehydrogenase subunit C [Roseovarius sp. TM1035]
          Length = 200

 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG YI +     V     + GEL++DV    +  L  FL+ D +C F  ++D+
Sbjct: 1   MSATLKELGGYIEHKRGDCVLGWDVAFGELTVDVALNHIDGLAEFLKTDQNCAFSTLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+R+++AV +   VPSI   YP A+WFEREV+DM+
Sbjct: 61  TAVDYPDRAKRFDVVYHFLSMYQNHRIRLRVAVRDEDMVPSITEAYPAANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           F+SPWEG   +   ++ 
Sbjct: 181 FMSPWEGAEYILPGDEK 197


>gi|149914579|ref|ZP_01903109.1| NADH dehydrogenase subunit C [Roseobacter sp. AzwK-3b]
 gi|149811372|gb|EDM71207.1| NADH dehydrogenase subunit C [Roseobacter sp. AzwK-3b]
          Length = 202

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 134/198 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG YI       V     S GEL++DV   ++ +L  FL+ D  C F +++D+
Sbjct: 1   MSNALKELGAYIEVKRPDCVLGWDVSHGELNVDVALPNIAALVEFLKTDQTCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+R++ A  E   VPSI  I+P A+WFEREV+DM+
Sbjct: 61  TAVDYPDRAKRFDVVYHFLSMYQNHRIRLRAAAREEDMVPSITEIHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ K
Sbjct: 181 FMSPWEGAEYILPGDEKK 198


>gi|89067784|ref|ZP_01155238.1| NADH dehydrogenase subunit C [Oceanicola granulosus HTCC2516]
 gi|89046754|gb|EAR52809.1| NADH dehydrogenase subunit C [Oceanicola granulosus HTCC2516]
          Length = 209

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 132/200 (66%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG +I       V       GEL++ V   +L     F++ D  C F  ++D+
Sbjct: 7   MTDALNELGGHIEARRPDCVAAWQVDHGELTVTVALANLPGFVEFIKTDATCRFSTLVDI 66

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD   R+ RFDVVYHFLS   N+R+R++  V E   VPSI GI+P A+WFERE++DM+
Sbjct: 67  TAVDHPGRAKRFDVVYHFLSMYQNQRIRLRTLVREEDLVPSITGIHPSANWFEREIFDMF 126

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV+L+QE+R +D
Sbjct: 127 GILFSGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFD 186

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           FLSPWEG N +   +D  D+
Sbjct: 187 FLSPWEGANYILPGDDKADE 206


>gi|294083713|ref|YP_003550470.1| NADH (or F420H2) dehydrogenase subunit C [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663285|gb|ADE38386.1| NADH (or F420H2) dehydrogenase, subunit C [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 219

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 128/193 (66%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  + +Y+    +      V +  E+ + V+  D+ S+ + LRDD H  F  + DL  VD
Sbjct: 20  LSTMANYVREILADIYESVVATNDEVLVRVNSQDITSVLTKLRDDNHAAFTQLSDLTAVD 79

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RF++VY  LS   N RLR+   VAEG+SVPS+ G++  A+W ERE WDM+GIFF
Sbjct: 80  YPERPVRFEMVYQLLSISNNMRLRILAGVAEGQSVPSVSGVFSAANWAEREAWDMFGIFF 139

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGFEGHPLRKDFP+TG VE+ YDD  ++VV  PV L+QE RD+DFLSP
Sbjct: 140 AGHPDLRRLLTDYGFEGHPLRKDFPLTGHVEVRYDDTQRRVVNEPVHLVQEFRDFDFLSP 199

Query: 185 WEGVNSLFAKEDS 197
           WEG+       DS
Sbjct: 200 WEGMQHAIDAADS 212


>gi|126736071|ref|ZP_01751815.1| NADH dehydrogenase subunit C [Roseobacter sp. CCS2]
 gi|126714628|gb|EBA11495.1| NADH dehydrogenase subunit C [Roseobacter sp. CCS2]
          Length = 203

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/202 (47%), Positives = 138/202 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG ++    +  V     +  EL++ V    LVS   FL++D  C F +++D+
Sbjct: 1   MTEALQELGTHLELKRTDCVLSWDVAHDELTVTVAPSSLVSFVEFLKNDATCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+ SR+ RFDVVYHFLS   N R+R+++ + E   +PSI+ ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPSRAKRFDVVYHFLSMYQNHRIRLRVQIREEDMLPSIMSVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHPLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGHPLRKDFPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDDMS 202
           F+SPWEG   +   ++  D+ +
Sbjct: 181 FMSPWEGAEYILPGDEKTDEKA 202


>gi|16126197|ref|NP_420761.1| NADH dehydrogenase subunit C [Caulobacter crescentus CB15]
 gi|221234968|ref|YP_002517404.1| NADH dehydrogenase subunit C [Caulobacter crescentus NA1000]
 gi|81782638|sp|Q9A6X2|NUOC_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|13423413|gb|AAK23929.1| NADH dehydrogenase I, C subunit [Caulobacter crescentus CB15]
 gi|220964140|gb|ACL95496.1| NADH-quinone oxidoreductase chain C [Caulobacter crescentus NA1000]
          Length = 197

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 133/189 (70%), Gaps = 2/189 (1%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +E LG  IV    G +  +V + GEL++      ++   +FLRDD  C F  +IDL
Sbjct: 1   MSEALELLGQDIVARAPGVLGHSV-AFGELTIVARAASVIDTLTFLRDDAACRFHQLIDL 59

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVD+  R+ RFDVVYH LS   N R+R+K++  E   VPS+  ++P ADWFERE +DMY
Sbjct: 60  TGVDYPERAARFDVVYHLLSLVKNHRIRLKVSTDEDTPVPSVTPVFPVADWFEREAFDMY 119

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFF+GHPDLRRILTDYGF GHPLRKDFP+TG+VE+ YDD++K+VVY PV++  E R +D
Sbjct: 120 GIFFDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKI-TEFRAFD 178

Query: 181 FLSPWEGVN 189
           FLSPWEG  
Sbjct: 179 FLSPWEGAK 187


>gi|119384980|ref|YP_916036.1| NADH dehydrogenase subunit C [Paracoccus denitrificans PD1222]
 gi|409252|gb|AAA03037.1| NADH dehydrogenase [Paracoccus denitrificans]
 gi|119374747|gb|ABL70340.1| NADH dehydrogenase subunit C [Paracoccus denitrificans PD1222]
          Length = 208

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +L ++I       V     + GEL+++     ++ L  FLR+DP+C F  +ID+  VD  
Sbjct: 12  ELAEHIALRRENDVISTQVAFGELTVNATLSGVIGLIEFLRNDPNCRFSTLIDITAVDNP 71

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           +R  RFDVVYH LS   N+R+RVK+ V E + VPS++G++PGA+W+EREV+D++GI F G
Sbjct: 72  ARPARFDVVYHLLSMYQNQRIRVKVQVREDELVPSLIGVFPGANWYEREVFDLFGILFSG 131

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           H DLRRILTDYGF GHPLRKDFP TG+VE+ + D  K+VVY PV L+QE+R +DFLSPWE
Sbjct: 132 HSDLRRILTDYGFRGHPLRKDFPTTGYVEVRWSDIEKRVVYEPVNLVQEYRQFDFLSPWE 191

Query: 187 GVN 189
           G  
Sbjct: 192 GAK 194


>gi|260574760|ref|ZP_05842763.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodobacter sp. SW2]
 gi|259023177|gb|EEW26470.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodobacter sp. SW2]
          Length = 200

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 95/171 (55%), Positives = 123/171 (71%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+++V    L  L  FLR D  C F  +ID+  VD+  R+ RFDVVYH LS   N+R+
Sbjct: 28  GELTVEVSVARLHGLVDFLRGDAACRFSTLIDITAVDYPGRAARFDVVYHLLSMYQNQRI 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+  AV E + VPS+V ++PGA+W+EREV+DM+GI F GHPDLRRILTDYGF GHPLRKD
Sbjct: 88  RLVAAVREDEMVPSLVSLFPGANWYEREVFDMFGILFSGHPDLRRILTDYGFRGHPLRKD 147

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSK 198
           FP TG+ E+ YDD  K+VVY PV L QE+R +DF+SPWEG   +   ++ +
Sbjct: 148 FPTTGYTEVRYDDVQKRVVYEPVSLTQEYRQFDFMSPWEGAAYILPGDEKQ 198


>gi|84686429|ref|ZP_01014323.1| NADH dehydrogenase subunit C [Maritimibacter alkaliphilus HTCC2654]
 gi|84665612|gb|EAQ12088.1| NADH dehydrogenase subunit C [Rhodobacterales bacterium HTCC2654]
          Length = 204

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 123/174 (70%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           + GEL++ V    L+    FL+ D  C    ++D+  VD+  R  RFDVVYHFLS   N 
Sbjct: 27  AFGELTVTVRPEALIGFVEFLKTDRGCRLSTLVDITAVDYPEREARFDVVYHFLSMYQNH 86

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           R+RVK AV E + VPSIV +YP A+WFERE++DM+GI F+GHPDLRRILTDYGF GHPLR
Sbjct: 87  RIRVKAAVEEREMVPSIVTVYPAANWFEREIFDMFGIIFKGHPDLRRILTDYGFRGHPLR 146

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           KDFP TGF E+ YD+  K+VVY PV L+QE+R +DF+SPWEG   +   ++  D
Sbjct: 147 KDFPTTGFTEVRYDEVEKRVVYEPVSLVQEYRQFDFMSPWEGAEYVLPGDEKAD 200


>gi|56697622|ref|YP_167991.1| NADH dehydrogenase subunit C [Ruegeria pomeroyi DSS-3]
 gi|81676163|sp|Q5LPR5|NUOC_SILPO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|56679359|gb|AAV96025.1| NADH-quinone oxidoreductase, C subunit [Ruegeria pomeroyi DSS-3]
          Length = 200

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 128/174 (73%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           + GEL++DV   +LV    FLR D  C F  ++D+  VD+  R+ RFDVVYHFLS   N+
Sbjct: 26  TFGELNVDVAPSNLVDFVDFLRSDSSCRFSTLVDITAVDYPERAKRFDVVYHFLSMYQNQ 85

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           R+R+++++ E   VPSI  ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF G+PLR
Sbjct: 86  RIRLRVSIREDDMVPSITDVHPSANWFEREVFDMFGILFTGHPDLRRILTDYGFRGYPLR 145

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           KDFP TG+ E+ YD+  K+VVY PV L+QE+R +DF+SPWEG + +   ++ K+
Sbjct: 146 KDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFDFMSPWEGADYILPGDEKKE 199


>gi|295689627|ref|YP_003593320.1| NADH (or F420H2) dehydrogenase subunit C [Caulobacter segnis ATCC
           21756]
 gi|295431530|gb|ADG10702.1| NADH (or F420H2) dehydrogenase, subunit C [Caulobacter segnis ATCC
           21756]
          Length = 213

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 130/188 (69%), Gaps = 1/188 (0%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  +E LG  IV + +G++     + GEL++      ++    FLRD P C F  ++DL 
Sbjct: 11  ISPLETLGQAIVANSAGAITAYHVAFGELTVLGPANRVIQALEFLRDHPDCRFHQLVDLT 70

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD+  R  RFDVVYH LS   N R+R+K+   E  +VPS+  ++  ADWFERE +DMYG
Sbjct: 71  AVDYPQRERRFDVVYHLLSLVKNHRIRLKVQTDEDTAVPSVTPVFAVADWFEREAFDMYG 130

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FFEGHPDLRRILTDYGF GHPLRKDFP+TG+VE+ YDD++K+VVY PV++  E R +DF
Sbjct: 131 VFFEGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKIT-EFRAFDF 189

Query: 182 LSPWEGVN 189
           LSPWEG  
Sbjct: 190 LSPWEGAK 197


>gi|254475901|ref|ZP_05089287.1| NADH-quinone oxidoreductase, c subunit [Ruegeria sp. R11]
 gi|214030144|gb|EEB70979.1| NADH-quinone oxidoreductase, c subunit [Ruegeria sp. R11]
          Length = 201

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/198 (47%), Positives = 137/198 (69%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG  I       V     +  EL++DV   ++     FL++DP C F +++D+
Sbjct: 1   MTEALKELGAQIEAKRPDCVIGWDVTFDELNVDVAPANIAGFVEFLKNDPTCKFSSLVDV 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R+++++ E + VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPERAKRFDVVYHFLSMYQNQRIRLRVSIREDEMVPSIVDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|221638928|ref|YP_002525190.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides KD131]
 gi|254767813|sp|B9KQW2|NUOC_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|221159709|gb|ACM00689.1| NADH-quinone oxidoreductase [Rhodobacter sphaeroides KD131]
          Length = 200

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 125/170 (73%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+LDV    +V L  FLR D  C F +++D+  +D   R  RFDVVYHFLS   N+R+
Sbjct: 28  GELTLDVVPNRIVGLVEFLRSDASCRFSSLVDITAIDHPERPARFDVVYHFLSMYQNQRI 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+K+ V E ++V SI  ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF GHP+RKD
Sbjct: 88  RLKMQVREDETVASIHSVHPSANWFEREVFDMFGILFTGHPDLRRILTDYGFRGHPMRKD 147

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           FP TG+ E+ YD+  K+VVY PV+L+QE+R +DFLSPWEG + +   +D 
Sbjct: 148 FPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFLSPWEGADYILPGDDK 197


>gi|163738799|ref|ZP_02146213.1| NADH dehydrogenase subunit C [Phaeobacter gallaeciensis BS107]
 gi|161388127|gb|EDQ12482.1| NADH dehydrogenase subunit C [Phaeobacter gallaeciensis BS107]
          Length = 201

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 134/198 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG  I       V     S  EL++DV   +L     FL+ D  C F +++D+
Sbjct: 1   MTEALNELGTQIAAKRPDCVIGWDVSFDELNVDVAPSNLAGFVEFLKADATCKFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RFDVVYHFLS   N+R+R+++++ E + +PSIVGI+P A+WFEREV+DM+
Sbjct: 61  TAVDYPDRPKRFDVVYHFLSMYQNQRIRLRVSIREDEMLPSIVGIHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAQKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|197105266|ref|YP_002130643.1| NADH dehydrogenase I, C subunit [Phenylobacterium zucineum HLK1]
 gi|218534305|sp|B4RCM7|NUOC_PHEZH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|196478686|gb|ACG78214.1| NADH dehydrogenase I, C subunit [Phenylobacterium zucineum HLK1]
          Length = 209

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (70%), Gaps = 3/190 (1%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++E LG  +V    G       + GELSL      +V   + LRDD    F  ++D+CGV
Sbjct: 9   ELEALGRELVAGGLGPFGGYEVAFGELSLTGPAHRIVEGLTLLRDD--HGFQQLVDICGV 66

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R  RFDVVYH LS   NRR+RVK+   E  +VPS+ G+YP ADW+ERE +DMYG+F
Sbjct: 67  DYPERERRFDVVYHLLSFTKNRRIRVKVQADEDTAVPSVTGVYPNADWYEREAFDMYGVF 126

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F+GHPDLRRILTDYGF GHPLRKDFP+TG+VE+ YDD++K+VVY PV+ + E R++DFLS
Sbjct: 127 FDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKSV-EWRNWDFLS 185

Query: 184 PWEGVNSLFA 193
           PWEGV   FA
Sbjct: 186 PWEGVERGFA 195


>gi|77463072|ref|YP_352576.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1]
 gi|126461944|ref|YP_001043058.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides ATCC 17029]
 gi|123592236|sp|Q3J3F9|NUOC_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534328|sp|A3PIX0|NUOC_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|77387490|gb|ABA78675.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain C [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103608|gb|ABN76286.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 200

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 125/170 (73%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+LDV    +V L  FLR D  C F +++D+  +D   R  RFDVVYHFLS   N+R+
Sbjct: 28  GELTLDVVPNRIVGLVEFLRSDASCRFSSLVDITAIDHPERPARFDVVYHFLSMYQNQRI 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+K+ V E ++V SI  ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF GHP+RKD
Sbjct: 88  RLKMQVREDETVASIHSVHPSANWFEREVFDMFGILFTGHPDLRRILTDYGFRGHPMRKD 147

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           FP TG+ E+ YD+  K+VVY PV+L+QE+R +DFLSPWEG + +   +D 
Sbjct: 148 FPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFLSPWEGADYILPGDDK 197


>gi|310816714|ref|YP_003964678.1| NADH dehydrogenase subunit C [Ketogulonicigenium vulgare Y25]
 gi|308755449|gb|ADO43378.1| NADH dehydrogenase subunit C [Ketogulonicigenium vulgare Y25]
          Length = 198

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/199 (52%), Positives = 140/199 (70%), Gaps = 2/199 (1%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++DL  Y+ +   G+   A  + GEL+L     DL +L  FLRDD  C F  ++D+  VD
Sbjct: 1   MQDLATYLRDMAPGAPT-AQLAYGELTLTSTLTDLPALLMFLRDDVQCRFSTLVDITAVD 59

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + +R  RFD+VYHFLS   N RLR+K+AVA+G+  PS +  YP ADWFEREV+DM+GI F
Sbjct: 60  YPARIKRFDLVYHFLSMHLNHRLRLKVAVADGEMPPSAIPAYPAADWFEREVFDMFGILF 119

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRR+LTDYGF GHPLRKDFP TG+ E+ YD+  K+VV+ PV+L+Q +R +DFLSP
Sbjct: 120 TGHPDLRRLLTDYGFSGHPLRKDFPTTGYTEVLYDEVEKRVVHAPVQLVQAYRQFDFLSP 179

Query: 185 WEGV-NSLFAKEDSKDDMS 202
           WEG+ N+L   +  K D +
Sbjct: 180 WEGMGNTLPGDQTGKGDAT 198


>gi|167646796|ref|YP_001684459.1| NADH dehydrogenase subunit C [Caulobacter sp. K31]
 gi|218534261|sp|B0SZ50|NUOC_CAUSK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|167349226|gb|ABZ71961.1| NADH (or F420H2) dehydrogenase, subunit C [Caulobacter sp. K31]
          Length = 214

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 131/185 (70%), Gaps = 1/185 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +E LG  IV + +G++     + GEL+L      +V   ++LRD P   F  ++DL GVD
Sbjct: 15  LEALGQAIVANSAGAITAWSVAFGELNLLGPANRIVQALTYLRDHPDYRFHQLVDLTGVD 74

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RFDVVYH LS   N R+R+K+   E  +VPS+  ++P ADWFERE +DMYGIFF
Sbjct: 75  YPERERRFDVVYHLLSLIKNHRVRLKVQTDEDTAVPSVTPVFPVADWFEREAFDMYGIFF 134

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           +GHPDLRRILTDYGF GHPLRKDFP+TG+VE+ YDD++K+VVY PV++  E R +DFLSP
Sbjct: 135 DGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKIT-EFRAFDFLSP 193

Query: 185 WEGVN 189
           WEG  
Sbjct: 194 WEGAK 198


>gi|254461949|ref|ZP_05075365.1| NADH-quinone oxidoreductase, c subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206678538|gb|EDZ43025.1| NADH-quinone oxidoreductase, c subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 202

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 136/200 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG +I       V       GEL++ V   ++V L  FL+ DP+C F +++D+
Sbjct: 1   MSAALIELGTHIEAKRPDCVLAWAIEQGELNVTVAPSNIVGLVDFLKTDPNCKFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RFDVVYHFLS   N R+R+++ V E   VPSIV ++P A+WFERE++DM+
Sbjct: 61  TAVDYPERGKRFDVVYHFLSMYLNHRIRLRLQVREDDMVPSIVEVHPSANWFEREIYDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+ F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GLLFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEVEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           F+SPWEG   +   ++ +++
Sbjct: 181 FMSPWEGAKYVLPGDEKQEE 200


>gi|254294102|ref|YP_003060125.1| NADH dehydrogenase subunit C [Hirschia baltica ATCC 49814]
 gi|254042633|gb|ACT59428.1| NADH (or F420H2) dehydrogenase, subunit C [Hirschia baltica ATCC
           49814]
          Length = 209

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 135/195 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +++L  +I      SV+       EL +      ++SL  FLR D  C F  + DLC VD
Sbjct: 11  LDELVSHIETEQPHSVKSCAVVNDELVVYAVRDQIMSLMRFLRSDSQCRFETLTDLCAVD 70

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R+ RF+VVYH LS   N+R+RVK++  E   VPS+V ++P A+W ERE +DMYG+ F
Sbjct: 71  YPERAERFEVVYHMLSMSLNQRIRVKVSTDEESPVPSLVELFPCANWNEREAFDMYGVLF 130

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRRILTDYGFEGHPLRKDFP+TG VE+ YD+  K+VVY+PV+L+QE+R++DF+SP
Sbjct: 131 SGHPDLRRILTDYGFEGHPLRKDFPLTGHVEVRYDEVEKRVVYQPVKLVQEYRNFDFMSP 190

Query: 185 WEGVNSLFAKEDSKD 199
           WEG+ S+   ++  D
Sbjct: 191 WEGMQSVLPGDEKAD 205


>gi|146278042|ref|YP_001168201.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides ATCC 17025]
 gi|226737323|sp|A4WU32|NUOC_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|145556283|gb|ABP70896.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 200

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 133/197 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++L  ++      ++       GEL+LDV    +V L  FLR D  C F +++D+
Sbjct: 1   MAEALQELAAHVEMRQPDAILGHRIEFGELTLDVAPNRIVGLVEFLRTDARCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD   R  RFD+VYHFLS   N R+R+K+ V E ++V SI  ++P A+WFEREV+DM+
Sbjct: 61  TAVDHPERPARFDMVYHFLSMYQNHRIRLKMQVREDETVASIHSVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF GHP+RKDFP TG+ E+ YD+  K+V+Y PV+L+QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFRGHPMRKDFPTTGYTEVRYDEVQKRVIYEPVKLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDS 197
           FLSPWEG + +   +D 
Sbjct: 181 FLSPWEGADYILPGDDK 197


>gi|126727143|ref|ZP_01742980.1| NADH dehydrogenase subunit C [Rhodobacterales bacterium HTCC2150]
 gi|126703571|gb|EBA02667.1| NADH dehydrogenase subunit C [Rhodobacterales bacterium HTCC2150]
          Length = 201

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 135/198 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG+ I    S +V       GEL +++    +V    FL+ D +C F +++D+
Sbjct: 1   MSDALKELGELIALKQSDAVLNWSVERGELCVEITANSVVEFTEFLKTDRNCQFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             +DF SR  RFDVVYH LS   N R+RV+  + E + +PSI+ ++P A+WFERE++DMY
Sbjct: 61  TAIDFPSRDKRFDVVYHHLSMYQNHRIRVRTQILEKEVMPSIISVHPSANWFEREIFDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD++ K+VVY PV L+Q++R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEEQKRVVYEPVSLVQDYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|329850727|ref|ZP_08265572.1| NADH-quinone oxidoreductase subunit C [Asticcacaulis biprosthecum
           C19]
 gi|328841042|gb|EGF90613.1| NADH-quinone oxidoreductase subunit C [Asticcacaulis biprosthecum
           C19]
          Length = 200

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/194 (50%), Positives = 133/194 (68%), Gaps = 1/194 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K++ L +     F  ++     + GEL+L V    +V + S L+ +P+  F  +IDLCG 
Sbjct: 5   KLQTLAERAQAEFKEAILETKFAFGELTLTVSRERIVEILSKLKQEPYR-FHQLIDLCGA 63

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+  R+ RFDVVYH LS  +N RLRVK+   E   VPS+  +YP ADW+ERE +DMYG+ 
Sbjct: 64  DYPKRAERFDVVYHLLSLNHNVRLRVKVTTDEIVPVPSVRSVYPNADWYEREAFDMYGML 123

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F GHPDLRR+LTDYGF G+PLRKDFP+TG VE+ YD++ K+VVY PV+L QE+R +DFLS
Sbjct: 124 FSGHPDLRRLLTDYGFSGYPLRKDFPMTGHVEVRYDEEQKRVVYEPVKLTQEYRKFDFLS 183

Query: 184 PWEGVNSLFAKEDS 197
           PWEG + +   +D 
Sbjct: 184 PWEGASYVLPGDDK 197


>gi|332557945|ref|ZP_08412267.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides WS8N]
 gi|332275657|gb|EGJ20972.1| NADH dehydrogenase subunit C [Rhodobacter sphaeroides WS8N]
          Length = 200

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 125/170 (73%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+LDV    +V L  FLR D  C F +++D+  +D   R  RFD+VYHFLS   N+R+
Sbjct: 28  GELTLDVVPNRIVGLVEFLRSDASCRFSSLVDITAIDHPERPARFDMVYHFLSMYQNQRI 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+K+ V E ++V SI  ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF GHP+RKD
Sbjct: 88  RLKMQVREDETVASIHSVHPSANWFEREVFDMFGILFTGHPDLRRILTDYGFRGHPMRKD 147

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           FP TG+ E+ YD+  K+VVY PV+L+QE+R +DFLSPWEG + +   +D 
Sbjct: 148 FPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFLSPWEGADYILPGDDK 197


>gi|86137599|ref|ZP_01056176.1| NADH dehydrogenase subunit C [Roseobacter sp. MED193]
 gi|85825934|gb|EAQ46132.1| NADH dehydrogenase subunit C [Roseobacter sp. MED193]
          Length = 197

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 96/196 (48%), Positives = 133/196 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++LG  I       V     + GEL++DV   ++  L  FL+ D  C F +++D+
Sbjct: 1   MTEALQELGTQIAAKRPDCVLSWDVAHGELNVDVAPANIAGLVEFLKSDSSCKFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RFDVVYH LS   N+R+R++++V E   VPSIV ++P A+WFEREV+DM+
Sbjct: 61  TAVDYPERGKRFDVVYHLLSMYQNQRIRLRVSVREDDMVPSIVDVHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKED 196
           F+SPWEG   +   ++
Sbjct: 181 FMSPWEGAEYILPGDE 196


>gi|159043858|ref|YP_001532652.1| NADH dehydrogenase subunit C [Dinoroseobacter shibae DFL 12]
 gi|218534283|sp|A8LIT7|NUOC_DINSH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|157911618|gb|ABV93051.1| NADH (or F420H2) dehydrogenase, subunit C [Dinoroseobacter shibae
           DFL 12]
          Length = 215

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 96/202 (47%), Positives = 133/202 (65%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +++L  +I       V     +  EL++      +V L +FL+ D  C F  +ID+
Sbjct: 10  MTAALQELAAHIEMKRPDCVISTEIAHDELTVVATPNSIVGLVAFLKTDATCKFSTLIDI 69

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N R+R+++ V E   VPSI+  +P A+WFEREV+DM+
Sbjct: 70  TAVDYPERAQRFDVVYHFLSMYQNHRIRIRVPVREDDIVPSIISEHPSANWFEREVFDMF 129

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD++ K+VVY PV L+QE+R +D
Sbjct: 130 GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEEKKRVVYEPVNLVQEYRQFD 189

Query: 181 FLSPWEGVNSLFAKEDSKDDMS 202
           F+SPWEG   +   ++  DD +
Sbjct: 190 FMSPWEGAEYILPGDEKTDDKA 211


>gi|126740378|ref|ZP_01756066.1| NADH dehydrogenase subunit C [Roseobacter sp. SK209-2-6]
 gi|126718514|gb|EBA15228.1| NADH dehydrogenase subunit C [Roseobacter sp. SK209-2-6]
          Length = 203

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 126/171 (73%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           S GEL++DV   ++     FL+ D  C F +++D+  VD+  R+ RFDVVYHFLS   N+
Sbjct: 30  SFGELNVDVAPANIAEFVEFLKTDSSCKFSSLVDVTAVDYPERAKRFDVVYHFLSMYRNQ 89

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           R+R+++++ E   VPSIV ++P A+WFEREV+DM+GI F GHPDLRRILTDYGF G+PLR
Sbjct: 90  RIRLRVSIREDDMVPSIVDVHPSANWFEREVFDMFGILFSGHPDLRRILTDYGFRGYPLR 149

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKED 196
           KDFP TG+ E+ YD+  K+VVY PV L+QE+R +DF+SPWEG   +   ++
Sbjct: 150 KDFPTTGYTEVRYDEAEKRVVYEPVNLVQEYRQFDFMSPWEGAEYILPGDE 200


>gi|83942673|ref|ZP_00955134.1| NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. EE-36]
 gi|83846766|gb|EAP84642.1| NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. EE-36]
          Length = 201

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++ +LG YI       +     +  EL++DV   +L  L  F++ D  C F +++D+
Sbjct: 1   MSEQLNELGAYIEAKRPDCILGWDIAFDELNMDVTQANLPGLVEFIKSDATCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R+++A  E   VPSIV I+P A+WFEREV+DM+
Sbjct: 61  TAVDYPGRAKRFDVVYHFLSMYQNQRIRLRVAAREEDMVPSIVDIHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GIIFAGHPDLRRLLTDYGFRGYPLRKDFPTTGYTEVRYDETEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEG 187
           F+SPWEG
Sbjct: 181 FMSPWEG 187


>gi|83953912|ref|ZP_00962633.1| NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841857|gb|EAP81026.1| NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. NAS-14.1]
          Length = 201

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 134/199 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++ +LG YI       +     +  EL++DV   +L  L  F++ D  C F +++D+
Sbjct: 1   MSEQLNELGAYIEAKRPDCILGWDIAFDELNMDVTQANLPGLVEFIKSDATCRFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R+ RFDVVYHFLS   N+R+R+++   E   VPSIV I+P A+WFEREV+DM+
Sbjct: 61  TAVDYPGRAKRFDVVYHFLSMYQNQRIRLRVVAREEDMVPSIVDIHPSANWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRR+LTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GIIFAGHPDLRRLLTDYGFRGYPLRKDFPTTGYTEVRYDETEKRVVYEPVSLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSKD 199
           F+SPWEG   +   ++  +
Sbjct: 181 FMSPWEGAEYILPGDEKPE 199


>gi|326428094|gb|EGD73664.1| NADH dehydrogenase iron-sulfur protein 3 [Salpingoeca sp. ATCC
           50818]
          Length = 246

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 135/189 (71%), Gaps = 1/189 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +K+E+LG +I ++    ++ A V++  EL L +    ++ + +FLRD+  C F  + D C
Sbjct: 49  QKLEELGQFIASALPKYIQVAQVSACDELELFIAPASVLPVLTFLRDNTLCQFKVLADQC 108

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD   R+NRF++VY+ LS ++N R+RV+    E  +V S   ++  A+W+ERE+WDMYG
Sbjct: 109 GVDIPKRANRFEIVYNLLSLRHNLRVRVRTYTDELSAVDSACSVFNAANWYEREIWDMYG 168

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           ++F GHPDLRRILTDYGFEGHPLRKDFP++GFVE+ YD+ VK+VV  PVEL QE R +DF
Sbjct: 169 VYFLGHPDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDEDVKRVVCEPVELAQEFRKFDF 228

Query: 182 LSPWEGVNS 190
            SPWE + S
Sbjct: 229 ESPWEQLPS 237


>gi|321259926|ref|XP_003194683.1| NADH-ubiquinone oxidoreductase mitochondrial precursor
           [Cryptococcus gattii WM276]
 gi|317461155|gb|ADV22896.1| NADH-ubiquinone oxidoreductase mitochondrial precursor, putative
           [Cryptococcus gattii WM276]
          Length = 286

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/185 (51%), Positives = 130/185 (70%), Gaps = 1/185 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + + G YI+NS    V+       EL+L +    ++ + +FLRD   C +  ++D+  VD
Sbjct: 76  LHEYGQYILNSLPRYVQQFSVYKDELTLYIPPQAVIPVFTFLRDHTQCQYRQVVDITAVD 135

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F ++ +RF+VVYH LS  +  R+RVK    E  +VPS+VG++ GA+WFEREVWDMYGIFF
Sbjct: 136 FPTKPSRFEVVYHLLSHAHQSRIRVKTYADEVTAVPSVVGLFNGANWFEREVWDMYGIFF 195

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLS 183
           EGHPDLRRILTDYGFEG PLRKDFP+TG+ E+ YDD+ K+VVY P++L Q  R++ D  S
Sbjct: 196 EGHPDLRRILTDYGFEGFPLRKDFPLTGYTEVRYDDEKKRVVYEPLQLTQAFRNFNDAAS 255

Query: 184 PWEGV 188
           PWE V
Sbjct: 256 PWEQV 260


>gi|163741490|ref|ZP_02148881.1| NADH dehydrogenase subunit C [Phaeobacter gallaeciensis 2.10]
 gi|161385224|gb|EDQ09602.1| NADH dehydrogenase subunit C [Phaeobacter gallaeciensis 2.10]
          Length = 201

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 133/198 (67%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +LG  I       V     +  EL++DV   +L     FL+ D  C F +++D+
Sbjct: 1   MTEALNELGTQIAAKRPDCVIGWDVTFDELNVDVAPSNLAGFVEFLKADATCKFSSLVDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD+  R  RFDVVYHFLS   N+R+R+++++ E + +PSIV I+P ++WFEREV+DM+
Sbjct: 61  TAVDYPDRPKRFDVVYHFLSMYQNQRIRLRVSIREDEMLPSIVTIHPSSNWFEREVFDMF 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GHPDLRRILTDYGF G+PLRKDFP TG+ E+ YD+  K+VVY PV L+QE+R +D
Sbjct: 121 GILFTGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAQKRVVYEPVNLVQEYRQFD 180

Query: 181 FLSPWEGVNSLFAKEDSK 198
           F+SPWEG   +   ++ +
Sbjct: 181 FMSPWEGAEYILPGDEKE 198


>gi|218673425|ref|ZP_03523094.1| NADH dehydrogenase subunit C [Rhizobium etli GR56]
          Length = 169

 Score =  203 bits (517), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 112/163 (68%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L  Y+  +    +  +    GEL+L     +L++L +FLRDD  C FVN+ID+
Sbjct: 1   MSEALTELASYLGEARGNLIAASQLKYGELTLTTTGENLIALLTFLRDDAKCGFVNLIDI 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD+  R  RFDVVYH LSPK N R+RVK+A  E   VPS   +YPGADWFERE WDMY
Sbjct: 61  CGVDWPQRELRFDVVYHLLSPKQNLRVRVKVATDEDTPVPSACAVYPGADWFERETWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVK 163
           G+ F GHPDLRRILTDYGFE HPLRKDFP TGFVE+ YDD   
Sbjct: 121 GVLFTGHPDLRRILTDYGFESHPLRKDFPTTGFVEVRYDDAAS 163


>gi|11466534|ref|NP_044783.1| NADH dehydrogenase subunit 9 [Reclinomonas americana]
 gi|6647648|sp|O21271|NDUS3_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
 gi|2258364|gb|AAD11898.1| NADH dehydrogenase subunit 9 [Reclinomonas americana]
          Length = 204

 Score =  203 bits (517), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 129/184 (70%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +++ G  ++  F   +  A+ S GEL+L V   +L++L   L++  +C F ++ DLC VD
Sbjct: 10  LKEFGISLIKMFPKYIDKAIYSKGELTLHVKPTNLIALMKILKNHTNCQFKSLSDLCAVD 69

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F  +  RF++VY+ LS +YN R+RVK  V E   VPS+  ++  A WFEREVWD++G++F
Sbjct: 70  FPEKKERFEIVYNLLSVRYNSRIRVKTFVDELTPVPSVTCLFQAAGWFEREVWDLFGVYF 129

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
             HPDLRRILTDYGFEGHP+RKDFP+TG+VE+ YDD+ K+VV   +E+ QE R ++F SP
Sbjct: 130 TNHPDLRRILTDYGFEGHPMRKDFPLTGYVEVRYDDEQKRVVTESLEMTQEFRSFNFTSP 189

Query: 185 WEGV 188
           WE +
Sbjct: 190 WEQI 193


>gi|299755128|ref|XP_001828448.2| NADH-ubiquinone oxidoreductase kDa subunit [Coprinopsis cinerea
           okayama7#130]
 gi|298411082|gb|EAU93440.2| NADH-ubiquinone oxidoreductase kDa subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 275

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/161 (55%), Positives = 117/161 (72%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL+L +    +V + +FLRD   C F  ++D+ GVDF  R  RF+VVYH LS ++  R+R
Sbjct: 92  ELTLYIAPSAVVPVLTFLRDHTQCQFKAVMDISGVDFPEREKRFEVVYHLLSIRHAGRIR 151

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS V ++ GADW+ERE WDMYGI+FE HPDLRRILTDYGFEGHPLRKDF
Sbjct: 152 VKTYAGEADPVPSAVEVFRGADWYEREAWDMYGIYFENHPDLRRILTDYGFEGHPLRKDF 211

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P+TG+ EL YD++ K+VVY P++L Q  R+++ LSPWE + 
Sbjct: 212 PLTGYTELRYDEEKKRVVYEPLQLTQAFRNFESLSPWEQIG 252


>gi|83592892|ref|YP_426644.1| NADH dehydrogenase subunit C [Rhodospirillum rubrum ATCC 11170]
 gi|123526696|sp|Q2RU38|NUOC_RHORT RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|83575806|gb|ABC22357.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodospirillum rubrum
           ATCC 11170]
          Length = 213

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 129/188 (68%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           V  +++LG  I  +    V     +  EL +      +  + +FLRDD  C F  ++D+ 
Sbjct: 9   VESLKELGARIEAALPTDVVRVEMAKDELQVIAQRPSIAKVLTFLRDDSACRFSQLVDIA 68

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+ SR  RF+VVY+ LS  +N+R+RVKI+ +E   VPS+  ++  A+WFERE WDMYG
Sbjct: 69  GVDYPSREERFEVVYNMLSMHHNQRIRVKISASEDTPVPSVTRVFSSANWFEREAWDMYG 128

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           IFF  HPDLRR+L+DYGFEGH  RKDFP+TG+ E+ YD+++K+VVY PV L Q+ R +DF
Sbjct: 129 IFFSEHPDLRRLLSDYGFEGHAQRKDFPLTGYKEVRYDEELKRVVYEPVRLSQDFRTFDF 188

Query: 182 LSPWEGVN 189
           LSPWEG++
Sbjct: 189 LSPWEGMD 196


>gi|110225659|ref|YP_665665.1| NADH dehydrogenase subunit 9 [Nephroselmis olivacea]
 gi|6066174|gb|AAF03192.1|AF110138_24 NADH dehydrogenase subunit 9 [Nephroselmis olivacea]
          Length = 189

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 122/182 (67%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E     I++     V+ +V    EL L V    LV L  FLR+  +  F  ++D CGVD+
Sbjct: 3   EQFEQSIISILPKWVKSSVRVENELILSVSPEHLVPLLFFLRNHTNTQFELLVDACGVDY 62

Query: 66  LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
            SR  RF++VY  LS +YN RLR+K+AV E   +PS   +YP A W ERE WDMYGIFF 
Sbjct: 63  PSRPLRFEMVYQLLSVQYNSRLRIKVAVDEFTPIPSATEVYPSAGWLEREAWDMYGIFFS 122

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
            HPDLRRILTDYGFEGHPLRKDFP+TG+ E+ YDD  K+VV  P+++ QE+R ++FLSPW
Sbjct: 123 NHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRYDDSEKRVVIEPIQMTQEYRYFNFLSPW 182

Query: 186 EG 187
           + 
Sbjct: 183 DN 184


>gi|315499790|ref|YP_004088593.1| NADH (or f420h2) dehydrogenase, subunit c [Asticcacaulis
           excentricus CB 48]
 gi|315417802|gb|ADU14442.1| NADH (or F420H2) dehydrogenase, subunit C [Asticcacaulis
           excentricus CB 48]
          Length = 204

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (0%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKY 83
           +++ GEL+L V+   +V + S LR +P+  F  +IDLCG D+  R  RFDVVYH LS   
Sbjct: 25  IHAFGELTLVVERERIVEVLSKLRAEPYR-FHQLIDLCGADYPKRERRFDVVYHLLSLTQ 83

Query: 84  NRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHP 143
           N RLRVK+   E   VP++  +YP ADW+ERE +DMYG+ F G PDLRRILTDYGF GHP
Sbjct: 84  NLRLRVKVMTDETVPVPTVRSVYPNADWYEREAFDMYGMLFSGQPDLRRILTDYGFSGHP 143

Query: 144 LRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           LRKDFP+TG VE+ YD++ K+VVY PV+L+QE R +DFLSPWEG +
Sbjct: 144 LRKDFPMTGHVEVRYDEEQKRVVYEPVKLVQEFRRFDFLSPWEGAS 189


>gi|33943525|gb|AAQ55457.1| putative NADH dehydrogenase subunit 9 precursor [Chlamydomonas
           reinhardtii]
          Length = 282

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 126/190 (66%), Gaps = 7/190 (3%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVG-------ELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            L DYI+ +    V+ AV           E ++      LV L  FLRD  +  F  ++D
Sbjct: 92  QLTDYIIKTVPKFVKMAVTGPAQSSVLYQEPTIYTTPESLVPLMVFLRDHTNTQFKCLLD 151

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  VDF SR+ RF+VVYH LSP++N R+RVK+ V E  +VP++  ++  A+WFERE WDM
Sbjct: 152 VTAVDFPSRAARFEVVYHLLSPRWNNRIRVKVCVDEVTAVPTLCKVFNTANWFERETWDM 211

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G+FF GHPDLRRILTDYGF GHPLRKDFP+TG+ E+ YD   K+VV  P+EL QE R +
Sbjct: 212 FGVFFSGHPDLRRILTDYGFTGHPLRKDFPMTGYQEVRYDYGKKRVVSEPLELTQEFRYF 271

Query: 180 DFLSPWEGVN 189
           DF SPWE +N
Sbjct: 272 DFNSPWETLN 281


>gi|254453925|ref|ZP_05067362.1| NADH-quinone oxidoreductase, c subunit [Octadecabacter antarcticus
           238]
 gi|198268331|gb|EDY92601.1| NADH-quinone oxidoreductase, c subunit [Octadecabacter antarcticus
           238]
          Length = 215

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 124/173 (71%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+++V   +L     FL+ D  C F +++D+  VD+  R  RFDVVYHFLS   N R+
Sbjct: 36  GELTVNVAPANLAGFIEFLKVDTACKFSSLVDITAVDYPGRDKRFDVVYHFLSMYQNHRI 95

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+++ V E + V SI  ++P A+WFEREV+DM+G+ F+GHPDLRRILTDYGF G+PLRKD
Sbjct: 96  RLRVKVREDEMVASITDVHPSANWFEREVFDMFGLIFKGHPDLRRILTDYGFRGYPLRKD 155

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKDD 200
           FP +G+ E+ YD+  K+VVY P+ L+QE+R +DF+SPWEG   +   +D  D+
Sbjct: 156 FPTSGYTEVRYDEVQKRVVYEPISLVQEYRQFDFMSPWEGAQYILPGDDKADE 208


>gi|58268506|ref|XP_571409.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|134112874|ref|XP_774980.1| hypothetical protein CNBF1440 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257628|gb|EAL20333.1| hypothetical protein CNBF1440 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227644|gb|AAW44102.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 284

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/185 (50%), Positives = 127/185 (68%), Gaps = 1/185 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y++ S    V+       EL++ +    ++ + +FLRD   C +  I+D+  VD
Sbjct: 74  LHQYGQYLLASLPKYVQQFSVYKDELTIYIPPQAVLPVFTFLRDHTQCQYRQIVDITAVD 133

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F ++ NRF+VVYH LS  +  R+RVK    E   VPS+VG++ GA+W+EREVWDMYGIFF
Sbjct: 134 FPTKPNRFEVVYHLLSHAHQSRIRVKTYADEVTPVPSVVGLFNGANWYEREVWDMYGIFF 193

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLS 183
           EGHPDLRRILTDYGFEG PLRKDFP+TG+ E+ YDD+ K+VVY P++L Q  R++ D  S
Sbjct: 194 EGHPDLRRILTDYGFEGFPLRKDFPLTGYTEVRYDDEKKRVVYEPLQLTQAFRNFNDAAS 253

Query: 184 PWEGV 188
           PWE V
Sbjct: 254 PWEQV 258


>gi|291243572|ref|XP_002741672.1| PREDICTED: NADH dehydrogenase iron-sulfur protein 3,
           mitochondrial-like [Saccoglossus kowalevskii]
          Length = 257

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/183 (49%), Positives = 126/183 (68%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+ +     ++   V    EL L +    +V + +FL+D  +C F NI D+  +
Sbjct: 53  LSDFGRYVADCLPKYIQLVQVTHYNELELMIHPEGVVPVMTFLKDHHNCQFKNISDITAI 112

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D  +R NRF+++Y+ LS +YN R+RVK    E   + SIV ++ GADW+EREVWDMYG+F
Sbjct: 113 DVPTRENRFEIIYNILSLRYNSRIRVKTYTDELTPIDSIVSVHKGADWYEREVWDMYGVF 172

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD+VK++V  P+EL QE R +D  +
Sbjct: 173 FANHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDDEVKRIVVEPLELSQEFRKFDLST 232

Query: 184 PWE 186
           PWE
Sbjct: 233 PWE 235


>gi|302383047|ref|YP_003818870.1| NADH (or F420H2) dehydrogenase, subunit C [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193675|gb|ADL01247.1| NADH (or F420H2) dehydrogenase, subunit C [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 231

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 2/167 (1%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           A  + GEL+L      +V + + LRD     F  ++D+CGVD+  R+ RFDVVYH LS  
Sbjct: 39  ATVAYGELTLTCHRDRIVGVLTDLRD--RFGFQQLLDVCGVDYPDRAERFDVVYHLLSLT 96

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
            N R+RVK+   E   VP+++ +YP A+WFERE +DMYG+ F  HPDLRR+LTDYGF+GH
Sbjct: 97  RNARVRVKVTTDEVAPVPTVISVYPSAEWFEREAFDMYGMLFSDHPDLRRLLTDYGFQGH 156

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           PLRKDFP+TG+VE+ YD++ K+VVY PV+L QE R++DFLSPWEG  
Sbjct: 157 PLRKDFPMTGYVEVRYDEEQKRVVYEPVKLTQEFRNFDFLSPWEGAE 203


>gi|159464845|ref|XP_001690652.1| NADH:ubiquinone oxidoreductase ND9 subunit [Chlamydomonas
           reinhardtii]
 gi|158280152|gb|EDP05911.1| NADH:ubiquinone oxidoreductase ND9 subunit [Chlamydomonas
           reinhardtii]
          Length = 282

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 125/190 (65%), Gaps = 7/190 (3%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVG-------ELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            L DYI+ +    V+ AV           E ++      LV L  FLRD  +  F  ++D
Sbjct: 92  QLTDYIIKTVPKFVKMAVTGPAQSSVLYQEPTIYTTPESLVPLMVFLRDHTNTQFKCLLD 151

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  VDF  R+ RF+VVYH LSP++N R+RVK+ V E  +VP++  ++  A+WFERE WDM
Sbjct: 152 VTAVDFPERAARFEVVYHLLSPRWNNRIRVKVCVDEVTAVPTLCKVFNTANWFERETWDM 211

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G+FF GHPDLRRILTDYGF GHPLRKDFP+TG+ E+ YD   K+VV  P+EL QE R +
Sbjct: 212 FGVFFSGHPDLRRILTDYGFTGHPLRKDFPMTGYQEVRYDYGKKRVVSEPLELTQEFRYF 271

Query: 180 DFLSPWEGVN 189
           DF SPWE +N
Sbjct: 272 DFNSPWETLN 281


>gi|302843459|ref|XP_002953271.1| NADH:ubiquinone oxidoreductase 30 kDa subunit [Volvox carteri f.
           nagariensis]
 gi|300261368|gb|EFJ45581.1| NADH:ubiquinone oxidoreductase 30 kDa subunit [Volvox carteri f.
           nagariensis]
          Length = 285

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 125/190 (65%), Gaps = 7/190 (3%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSL-------DVDCGDLVSLCSFLRDDPHCCFVNIID 59
            L DYI+ +    V+ AV   G+ +L             L+ L +FLRD     F  +ID
Sbjct: 95  QLTDYIIKTVPKFVKMAVVGPGQSTLLYQEPTIYTTPDSLLPLMTFLRDHVQTQFKCLID 154

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  VDF  R+ RF+VVYH LSP++N R+RVK+ V E   VPSI  I+  A+WFERE WDM
Sbjct: 155 ITAVDFPERAARFEVVYHLLSPRWNNRIRVKVCVDEVTPVPSIWKIFNTANWFERETWDM 214

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G+FF GHPDLRRIL+DYGF GHPLRKDFP++G+ E+ YD   K+VV  P+EL QE R +
Sbjct: 215 FGVFFSGHPDLRRILSDYGFTGHPLRKDFPLSGYTEVRYDYGKKRVVSEPLELTQEFRYF 274

Query: 180 DFLSPWEGVN 189
           DF SPWE +N
Sbjct: 275 DFNSPWETLN 284


>gi|238581805|ref|XP_002389728.1| hypothetical protein MPER_11103 [Moniliophthora perniciosa FA553]
 gi|215452310|gb|EEB90658.1| hypothetical protein MPER_11103 [Moniliophthora perniciosa FA553]
          Length = 240

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/196 (48%), Positives = 125/196 (63%), Gaps = 7/196 (3%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
              ++   G Y+       ++       EL+L V    ++ +  FLRD   C F +I+D+
Sbjct: 21  TTEQLHTYGSYLTQCLPKFIQQFSVVNDELTLYVAPSAILPVLQFLRDHSQCQFKSIMDI 80

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVDF  R  RF+VVYH LS KY  R+RVK    EG  VPS V ++ GADW+ERE WD++
Sbjct: 81  SGVDFPEREKRFEVVYHMLSVKYRGRIRVKTYAGEGDHVPSAVELFRGADWYEREAWDLF 140

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVT-------GFVELHYDDKVKKVVYRPVELM 173
           GIFF GHPDLRRILTDYGFEGHPLRKDFP+T       G+ EL YD++ K+VVY P++L 
Sbjct: 141 GIFFSGHPDLRRILTDYGFEGHPLRKDFPLTVGIIEVSGYTELRYDEERKRVVYEPLQLT 200

Query: 174 QEHRDYDFLSPWEGVN 189
           Q  R+++ LSPWE V 
Sbjct: 201 QAFRNFEALSPWEQVG 216


>gi|296536154|ref|ZP_06898282.1| NADH-quinone oxidoreductase subunit C [Roseomonas cervicalis ATCC
           49957]
 gi|296263525|gb|EFH10022.1| NADH-quinone oxidoreductase subunit C [Roseomonas cervicalis ATCC
           49957]
          Length = 221

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (70%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ L V    L ++   LRDDP   F   +D+CGVD+ +R+ RFDVVY+ LS  +N R+R
Sbjct: 45  EVELRVRREALHAVLQMLRDDPRLAFEQCMDICGVDWPTRAARFDVVYNLLSLTHNHRIR 104

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           V         V ++  ++P A WFERE WDMYGI F+G PDLRRILTDYGFEGHPLRKDF
Sbjct: 105 VITETDAATPVATVCDLWPAATWFEREAWDMYGIVFDGQPDLRRILTDYGFEGHPLRKDF 164

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKE 195
           P+TGFVE+ YD + ++VVY PV+L Q+ R++DFLSPWEG+ +L   E
Sbjct: 165 PLTGFVEVRYDAERQQVVYEPVKLQQDFRNFDFLSPWEGMTTLPGDE 211


>gi|170084847|ref|XP_001873647.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651199|gb|EDR15439.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 273

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/185 (50%), Positives = 120/185 (64%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G YI       V+       EL++      ++ + +FLRD   C F   +D+ GVD
Sbjct: 65  LHTYGSYITQCLPKFVQQFSVLKDELTIYTAPSGIIPVLTFLRDHSQCQFKACMDISGVD 124

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F  R  RF+VVY  LS K   R+RVK    E   VPS V +Y GADW+ERE WD+YGIFF
Sbjct: 125 FPEREKRFEVVYSLLSVKLGGRIRVKTYAGEADPVPSAVEVYRGADWYEREAWDLYGIFF 184

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           EGHPDLRRILTDYGFEGHPLRKDFP+TG+ E+ YD++ K+VVY P++L Q  R+++ LSP
Sbjct: 185 EGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRYDEERKRVVYEPLQLTQAFRNFEALSP 244

Query: 185 WEGVN 189
           WE V 
Sbjct: 245 WEQVG 249


>gi|254418963|ref|ZP_05032687.1| NADH (or F420H2) dehydrogenase, subunit C subfamily, putative
           [Brevundimonas sp. BAL3]
 gi|196185140|gb|EDX80116.1| NADH (or F420H2) dehydrogenase, subunit C subfamily, putative
           [Brevundimonas sp. BAL3]
          Length = 209

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 2/167 (1%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           A  + GEL+L      +V + + LRD     F  ++DLCG D+  R  RF+VVYH LS  
Sbjct: 29  AQVAFGELTLLAPRERIVEVMTALRD--QFGFQQLLDLCGADYPDREERFEVVYHLLSMT 86

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
            N R+RVK+   E + V ++ G+YP A WFERE +DMYG+ F GHPD+RR+LTDYGFEGH
Sbjct: 87  RNARVRVKVVTDEVQPVATVTGVYPSAGWFEREAYDMYGVIFSGHPDMRRLLTDYGFEGH 146

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           PLRKDFP+TG+VE+ YD++ K+VVY PV+L QE R +DFLSPWEG +
Sbjct: 147 PLRKDFPMTGYVEVRYDEEQKRVVYEPVKLTQEFRTFDFLSPWEGAD 193


>gi|302694895|ref|XP_003037126.1| hypothetical protein SCHCODRAFT_80667 [Schizophyllum commune H4-8]
 gi|300110823|gb|EFJ02224.1| hypothetical protein SCHCODRAFT_80667 [Schizophyllum commune H4-8]
          Length = 269

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 85/161 (52%), Positives = 114/161 (70%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++      L+ + +FLRD   C F + +D+ G D+  R  RF+ VYH LS +   R+R
Sbjct: 81  ELTIYTAPSGLIPVLTFLRDHGQCQFKSCMDVSGADYPEREKRFESVYHLLSYRSGGRIR 140

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   +PS VG+YPGA+W+ERE WD+YGIF+ GHPDLRRILTDYGFEGHPLRKDF
Sbjct: 141 VKTYAGEADPIPSAVGVYPGANWYEREAWDLYGIFYSGHPDLRRILTDYGFEGHPLRKDF 200

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G+ EL YD++ K+VVY P++L Q  R+++  SPWE V 
Sbjct: 201 PISGYTELRYDEERKRVVYEPLQLTQAFRNFEAQSPWEQVG 241


>gi|330994056|ref|ZP_08317986.1| NADH-quinone oxidoreductase subunit C [Gluconacetobacter sp.
           SXCC-1]
 gi|329759002|gb|EGG75516.1| NADH-quinone oxidoreductase subunit C [Gluconacetobacter sp.
           SXCC-1]
          Length = 224

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 134/197 (68%), Gaps = 11/197 (5%)

Query: 12  IVNSFSGSVRFAVNSV--GELSLDVDCGDLV---------SLCSFLRDDPHCCFVNIIDL 60
           +V    G++ F +++   G LS  ++ G+LV         +L S LRDDP      ++D+
Sbjct: 17  VVPGTLGAIAFRLSTAVPGILSASIEKGELVVRTTRTRLLALMSLLRDDPRYACQQVMDI 76

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVDF  R+ RFDVVY+ LS  +N R+RV +   E  +VPS+  ++P A W+ERE +D++
Sbjct: 77  CGVDFPERAERFDVVYNLLSVTHNHRIRVIVTTDETSAVPSVHQLWPAATWWEREAYDLF 136

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F   PDLRRILTDYGFEGHPLRKDFP+TG+VEL YD++ ++VVY PV L+Q+ R++D
Sbjct: 137 GILFTDQPDLRRILTDYGFEGHPLRKDFPLTGYVELRYDEERRQVVYEPVNLVQDFRNFD 196

Query: 181 FLSPWEGVNSLFAKEDS 197
           F SPWEG+ +L   E +
Sbjct: 197 FESPWEGILTLPGDEKA 213


>gi|320164785|gb|EFW41684.1| mitochondrial complex I subunit NDUFS3 [Capsaspora owczarzaki ATCC
           30864]
          Length = 272

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 125/188 (66%), Gaps = 1/188 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++E+ G Y+V+     V+   V    EL + V    ++ +  FLRD  +  F  ++D+ 
Sbjct: 78  KQLEEYGQYLVDVLPKFVQATQVQHTNELEVLVAPEGVLPVLQFLRDHTNAQFKQLLDVA 137

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  R+NRF+VVY+ LS ++N R+RVK    E   V S   +Y  A WFERE WD+YG
Sbjct: 138 GVDYPKRTNRFEVVYNLLSLRFNARIRVKTYTDEVTPVESATCLYSSATWFEREAWDLYG 197

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           I F  HPDLRRILTDYGFEGHP+RKDFP+TG+VE  YDD++K+VV  P+E+ QE R ++F
Sbjct: 198 ILFSNHPDLRRILTDYGFEGHPMRKDFPLTGYVEARYDDELKRVVVEPLEMTQEMRRFEF 257

Query: 182 LSPWEGVN 189
            SPWE + 
Sbjct: 258 QSPWEHIQ 265


>gi|225718856|gb|ACO15274.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Caligus clemensi]
          Length = 264

 Score =  197 bits (502), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/185 (48%), Positives = 126/185 (68%), Gaps = 1/185 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           + + D G Y+  S    V+    + G EL L +    ++ + SFL+D  +  F N++DLC
Sbjct: 56  QNLSDFGQYVAESMPKYVQKVQLTAGDELELLIHPDGVIPVISFLKDHHNAQFTNLVDLC 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           G+D  +R NRF+++Y+ LS ++N R+RVK    E   + SI  I+  A+W+EREVWDMYG
Sbjct: 116 GLDVPTRKNRFEIIYNLLSLRFNSRVRVKTYTDELSPIDSIEDIHKAANWYEREVWDMYG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           ++F  HPDLRRILTDYGFEGHPLRKDFP+TGF EL YD + +++V  PVEL QE+R +D 
Sbjct: 176 VYFSNHPDLRRILTDYGFEGHPLRKDFPLTGFYELRYDMEHQRIVQEPVELAQEYRKFDL 235

Query: 182 LSPWE 186
            +PWE
Sbjct: 236 AAPWE 240


>gi|328772973|gb|EGF83010.1| hypothetical protein BATDEDRAFT_8530 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 181

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (69%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +++ G YI +     ++       EL+L +    L+ + +FLRD     F  + ++  VD
Sbjct: 1   LQEFGKYIASCMPKYIQQITVYKDELTLFIAPSGLIPVATFLRDHQATQFQQVQNITVVD 60

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + SR NRF+VVY+FLS ++N R+RVK    E   VPS+V +Y GA+W+EREVWDM+G+FF
Sbjct: 61  YPSRENRFEVVYNFLSVRFNNRIRVKTYTNEIDPVPSLVPLYTGANWYEREVWDMFGVFF 120

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRRILTDYGFEGHPLRKDFP+TG+VE+ YD++ K+V+  P+EL Q  R +++ SP
Sbjct: 121 TGHPDLRRILTDYGFEGHPLRKDFPLTGYVEMRYDEEKKRVIAEPLELAQSFRMFEYQSP 180

Query: 185 W 185
           W
Sbjct: 181 W 181


>gi|288856261|ref|NP_001165786.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Nasonia vitripennis]
          Length = 264

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 132/201 (65%), Gaps = 1/201 (0%)

Query: 2   VRKIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           V +++D G Y+       V +  + +  EL + +    ++   SFL+D  +C F N+ D+
Sbjct: 58  VAQLKDFGQYVAECLPKYVQKVQIEAGDELEICIAPEGIIPTVSFLKDHHNCQFTNLSDI 117

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD  SR  RF++VY+ LS +YN R+RVK    E   V SI  ++  ADW+EREVWDM+
Sbjct: 118 TAVDIPSRPYRFELVYNILSIRYNTRIRVKTYTDELTPVDSIYDVHKAADWYEREVWDMF 177

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI+F GHPDLRRILTDYGFEGHP+RKDFP+TG++E+ YDD+ K+VV  P+EL QE+R ++
Sbjct: 178 GIYFAGHPDLRRILTDYGFEGHPMRKDFPLTGYIEVRYDDEKKRVVAEPLELAQEYRKFE 237

Query: 181 FLSPWEGVNSLFAKEDSKDDM 201
             +PWE   +     +S +D+
Sbjct: 238 LSAPWEQFPNFRNASNSAEDV 258


>gi|254437425|ref|ZP_05050919.1| NADH dehydrogenase, subunit C subfamily, putative [Octadecabacter
           antarcticus 307]
 gi|198252871|gb|EDY77185.1| NADH dehydrogenase, subunit C subfamily, putative [Octadecabacter
           antarcticus 307]
          Length = 211

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 120/173 (69%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+++V   +L     FL+ D  C F +++D+  VD+  R  RFDVVYHFLS   N R+
Sbjct: 36  GELTVNVAPANLAVFIEFLKVDSACKFSSLVDITAVDYPGRDKRFDVVYHFLSMYQNHRI 95

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R++  V   + V SI  ++  A+WFEREV+DM+GI F+GHPDLRRILTDYGF G+PLRKD
Sbjct: 96  RLRAKVRSDEMVASITDVHKSANWFEREVFDMFGIIFKGHPDLRRILTDYGFRGYPLRKD 155

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKDD 200
           FP TG+ E+ YD+  K+VVY PV L+QE+R +DF+SPWEG   +   +D   D
Sbjct: 156 FPTTGYTEVRYDEVQKRVVYEPVSLVQEYRQFDFMSPWEGAQYILPGDDKAKD 208


>gi|225709662|gb|ACO10677.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Caligus rogercresseyi]
 gi|225709712|gb|ACO10702.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Caligus rogercresseyi]
          Length = 266

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 127/187 (67%), Gaps = 1/187 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M + + D G Y+       V+    + G EL + +    +V + SFL+D  +  F N++D
Sbjct: 55  MRQNLSDFGQYVAECMPKYVQKIQLTAGDELEILIHPDGVVPIISFLKDHHNAEFTNLVD 114

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           LCG+D  +R +RF+++Y+ LS ++N R+RVK    E   + SIV I+  A+W+EREVWDM
Sbjct: 115 LCGMDVPTRKHRFEIIYNLLSLRFNSRIRVKTYTDELTPIDSIVDIHKAANWYEREVWDM 174

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG++F  HPDLRRILTDYGFEGHPLRKDFP+TG+ EL YD + +++V  PVEL QE+R +
Sbjct: 175 YGVYFANHPDLRRILTDYGFEGHPLRKDFPLTGYYELRYDMEHRRIVQEPVELAQEYRKF 234

Query: 180 DFLSPWE 186
           D  +PWE
Sbjct: 235 DLAAPWE 241


>gi|241736746|ref|XP_002413990.1| NADH-ubiquinone oxidoreductase, NDUFS3/30 kDa subunit, putative
           [Ixodes scapularis]
 gi|215507844|gb|EEC17298.1| NADH-ubiquinone oxidoreductase, NDUFS3/30 kDa subunit, putative
           [Ixodes scapularis]
          Length = 268

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/185 (48%), Positives = 126/185 (68%), Gaps = 1/185 (0%)

Query: 3   RKIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +K+ED G Y+       V +  +    EL + +    +V + SFL+D  +  + NI+D+ 
Sbjct: 57  QKLEDFGRYVAECLPKYVQKVQITQGDELEVMIAPEGVVPVLSFLKDHHNAQYANIVDIA 116

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD  +R  RF+VVY+ LS  +N R+RVK    E  ++ S   +Y GA+W+EREVWDM+G
Sbjct: 117 GVDVPTRQYRFEVVYNLLSLHFNSRIRVKTYTDELTALDSATPVYKGANWYEREVWDMFG 176

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  P+EL QE+R +D 
Sbjct: 177 VFFGNHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVVEPLELTQEYRKFDL 236

Query: 182 LSPWE 186
            +PWE
Sbjct: 237 ATPWE 241


>gi|225714070|gb|ACO12881.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Lepeophtheirus salmonis]
 gi|290562133|gb|ADD38463.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 266

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 127/187 (67%), Gaps = 1/187 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M + ++D G Y+       V+    + G EL + +    +V + SFL+D  +  F N++D
Sbjct: 57  MRQNLQDFGQYVAECMPKYVQKIQLTAGDELEVLIHPDGVVPVMSFLKDHHNAQFTNLVD 116

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           LCG+D  +R  RF+++Y+ LS +YN R+RVK    E   + SIV I+  A+W+EREVWDM
Sbjct: 117 LCGMDVPTRKYRFEIIYNLLSLRYNSRIRVKTYTDELTPIDSIVEIHKAANWYEREVWDM 176

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G++F  HPDLRRILTDYGFEGHPLRKDFP+TGF EL YD + ++VV  PVEL QE+R +
Sbjct: 177 FGVYFSNHPDLRRILTDYGFEGHPLRKDFPLTGFYELRYDMEHQRVVQEPVELAQEYRKF 236

Query: 180 DFLSPWE 186
           D  +PWE
Sbjct: 237 DLAAPWE 243


>gi|225715412|gb|ACO13552.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Esox lucius]
          Length = 255

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 1/185 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V    EL + +    +V + +FLRD  +  F N+IDL 
Sbjct: 49  KQLAVFGEYVAEMLPKYVQQVQVTCYNELEVMIHPDGVVPVLTFLRDHTNAQFRNMIDLT 108

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  SR NRF++VY+ LS +YN R+R+K    E   V S V ++  A+W+EREVWDMYG
Sbjct: 109 AVDIPSRQNRFEIVYNLLSLRYNSRIRLKTYTDELTPVDSAVSVHNAANWYEREVWDMYG 168

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++GFVE+ YDD+VK+VV  PVEL +E R +D 
Sbjct: 169 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGFVEVRYDDEVKRVVAEPVELAREFRKFDL 228

Query: 182 LSPWE 186
            SPWE
Sbjct: 229 NSPWE 233


>gi|209738000|gb|ACI69869.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Salmo salar]
          Length = 255

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++   G+Y+       V+   V    EL + +    ++ + +FLRD  +  F N+IDL  
Sbjct: 50  QLAAFGEYVAEMLPKYVQQVQVTCYNELEVMIHPDGVIPVLTFLRDHSNAQFRNMIDLTA 109

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +R NRF++VY+ LS +YN R+R+K    E   V S V ++  A+W+EREVWDMYG+
Sbjct: 110 VDIPTRQNRFEIVYNLLSLRYNSRIRLKTYTDELTPVDSSVSVHNAANWYEREVWDMYGV 169

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++GFVE+ YDD+VK+VV  PVEL QE R +D  
Sbjct: 170 FFANHPDLRRILTDYGFEGHPFRKDFPLSGFVEVRYDDEVKRVVAEPVELSQEFRKFDLN 229

Query: 183 SPWE 186
           SPWE
Sbjct: 230 SPWE 233


>gi|71006324|ref|XP_757828.1| hypothetical protein UM01681.1 [Ustilago maydis 521]
 gi|46097031|gb|EAK82264.1| hypothetical protein UM01681.1 [Ustilago maydis 521]
          Length = 389

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 121/184 (65%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + D G YI +     ++       EL+L V    ++   SFLRD     F   +D+ G D
Sbjct: 182 LHDFGSYITSCLPRFIQQFSVVKDELTLYVAPDAVIPTLSFLRDHTQTQFRACMDISGAD 241

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + +RS RF+VVYH LS +YN R+RVK    E   VPS   ++  ADW+ERE+WDMYG+FF
Sbjct: 242 YPTRSQRFEVVYHLLSVQYNARIRVKTYADEVHPVPSATAVFRSADWYEREIWDMYGVFF 301

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            GHPDLRRILTDYGFEGHPLRKDFP+TG+ E+ YD++ K+VV  P++L Q  R+++  SP
Sbjct: 302 IGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRYDEEKKRVVSEPLQLTQAFRNFEANSP 361

Query: 185 WEGV 188
           WE V
Sbjct: 362 WEQV 365


>gi|218460351|ref|ZP_03500442.1| NADH dehydrogenase subunit C [Rhizobium etli Kim 5]
          Length = 133

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/130 (67%), Positives = 100/130 (76%)

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R  RFDVVYH LSPK N R+RVK+A  E   VPS   +YPGADWFERE WDMYG+ F GH
Sbjct: 1   RELRFDVVYHLLSPKQNLRIRVKVATDEDTPVPSACAVYPGADWFERETWDMYGVLFTGH 60

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           PDLRRILTDYGFEGHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++DF+SPWEG
Sbjct: 61  PDLRRILTDYGFEGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFDFMSPWEG 120

Query: 188 VNSLFAKEDS 197
              +   ++ 
Sbjct: 121 TEYVLPGDEK 130


>gi|209733838|gb|ACI67788.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Salmo salar]
          Length = 255

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++   G+Y+V      V+   V    EL + +    +  + +FLRD  +  F N+IDL  
Sbjct: 50  QLAAFGEYVVEMLPKYVQQVQVTCYNELEVMIHPDGVAPVLTFLRDHSNAQFRNMIDLTA 109

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +R NRF++VY+ LS +YN R+R+K    E   V S V ++  A+W+EREVWDMYG+
Sbjct: 110 VDIPTRQNRFEIVYNLLSLRYNSRIRLKTYTDELTPVDSSVSVHNAANWYEREVWDMYGV 169

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++GFVE+ YDD+VK+ V  PVEL QE R +D  
Sbjct: 170 FFANHPDLRRILTDYGFEGHPFRKDFPLSGFVEVRYDDEVKRAVAEPVELSQEFRKFDLN 229

Query: 183 SPWE 186
           SPWE
Sbjct: 230 SPWE 233


>gi|114327964|ref|YP_745121.1| NADH-quinone oxidoreductase chain C [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316138|gb|ABI62198.1| NADH-quinone oxidoreductase chain C [Granulibacter bethesdensis
           CGDNIH1]
          Length = 205

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 92/185 (49%), Positives = 128/185 (69%), Gaps = 1/185 (0%)

Query: 13  VNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRF 72
           +++  G  R  +    E+ ++V    L ++   LRDDP      ++D+CGVD+ SRS RF
Sbjct: 5   LSAIHGVTRAQLEK-NEVVVEVTRDQLEAVALTLRDDPRFLCQQLMDVCGVDWPSRSPRF 63

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRR 132
           DVVY+ LS   N R+R+ +   +G  VPS+  I+P A WFERE WD++GI F G PD RR
Sbjct: 64  DVVYNLLSISLNHRIRMIVGTDDGVPVPSVHTIWPVATWFERETWDLFGILFSGQPDHRR 123

Query: 133 ILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLF 192
           ILTDYGFEGHPLRKDFP+TG+VEL +D++ ++VVY PV+L Q+ R++DFLSPWEG+ +L 
Sbjct: 124 ILTDYGFEGHPLRKDFPLTGYVELRWDEERRQVVYEPVKLTQDFRNFDFLSPWEGMTTLP 183

Query: 193 AKEDS 197
             E +
Sbjct: 184 GDEKA 188


>gi|226372312|gb|ACO51781.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Rana catesbeiana]
          Length = 253

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 123/185 (66%), Gaps = 1/185 (0%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++   G+Y+       V+   V   GEL + +  G ++ + +FLRD  +  F N+ DL  
Sbjct: 47  QLSAFGEYVSEILPKYVQQVQVTCFGELEIMIHPGGVIPVLTFLRDHTNAQFKNMADLTA 106

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           V   +R NRF+++Y+ LS ++N R+RVK    E   V SIV ++   +W+EREVWDMYG+
Sbjct: 107 VGIPTRENRFEIIYNLLSLRFNARIRVKTYADELTPVESIVSVHKAVNWYEREVWDMYGV 166

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PV+L QE R +D  
Sbjct: 167 FFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKFDLS 226

Query: 183 SPWEG 187
           SPWE 
Sbjct: 227 SPWEA 231


>gi|162148809|ref|YP_001603270.1| NADH-quinone oxidoreductase subunit C [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545443|ref|YP_002277672.1| NADH (or F420H2) dehydrogenase subunit C [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787386|emb|CAP56981.1| NADH-quinone oxidoreductase chain C [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533120|gb|ACI53057.1| NADH (or F420H2) dehydrogenase, subunit C [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 213

 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 129/189 (68%)

Query: 11  YIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           + +++    ++ A    GEL +     +L++L   LRDDP      ++DLCGVD+ +R+ 
Sbjct: 16  FALSTSVPGIQSAAIEGGELVVRTGRDNLIALMGMLRDDPRYACEQLMDLCGVDYPARTE 75

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RFDVVY+ LS   N R+RV +   E   VPS+  ++P A W+ERE +D++G+ F G PDL
Sbjct: 76  RFDVVYNLLSVTLNHRIRVIVTTDETNPVPSVHHLWPAATWWERECYDLFGVLFSGQPDL 135

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           RRILTDYGFEGHPLRKDFP+TG+VE+ YD+  ++VVY PV+L Q+ R++DF SPWEG+ +
Sbjct: 136 RRILTDYGFEGHPLRKDFPLTGYVEVRYDEDRREVVYEPVKLTQDFRNFDFESPWEGILT 195

Query: 191 LFAKEDSKD 199
           L   E + +
Sbjct: 196 LPGDEKAHE 204


>gi|164422317|gb|ABY55256.1| NADH dehydrogenase ubiquinone Fe-S protein 3 [Oncorhynchus masou
           formosanus]
          Length = 255

 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++   G+Y+       V+   V    EL + +    ++ + +FLRD  +  F N+IDL  
Sbjct: 50  QLAAFGEYVAEMLPKYVQQVQVTCYNELEVMIHPDGVIPVLTFLRDHSNAQFRNMIDLTA 109

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +R NRF++VY+ LS +YN ++R+K    E   V S V ++  A+W+EREVWDMYG+
Sbjct: 110 VDIPTRQNRFEIVYNLLSLRYNSQIRLKTYTDELTPVDSSVSVHNAANWYEREVWDMYGV 169

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++GFVE+ YDD+VK+VV  PVEL QE R +D  
Sbjct: 170 FFANHPDLRRILTDYGFEGHPFRKDFPLSGFVEVRYDDEVKRVVAEPVELSQEFRKFDLN 229

Query: 183 SPWE 186
           SPWE
Sbjct: 230 SPWE 233


>gi|167516306|ref|XP_001742494.1| NADH dehydrogenase Fe S [Monosiga brevicollis MX1]
 gi|163779118|gb|EDQ92732.1| NADH dehydrogenase Fe S [Monosiga brevicollis MX1]
          Length = 206

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/188 (50%), Positives = 124/188 (65%), Gaps = 1/188 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++E LG +I       V+ A V +  EL L +    +  + +FLRD   C F N+ DLC 
Sbjct: 9   RLEKLGQHIAEMLPRYVQVAQVTAHDELELLIAPSGVKPVLTFLRDHTACQFKNLSDLCA 68

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD   R  RF+VVY+ LS   N R+RV+    E   V SIV I+  ADW+ERE WDMYG+
Sbjct: 69  VDVPRREKRFEVVYNLLSVHLNERIRVRTYCDELTPVDSIVDIHMAADWYEREAWDMYGV 128

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           +F GHPDLRRILTDYGFEGHPLRKDFP++GFVE+ YD+ VK+VV  P+EL QE R ++  
Sbjct: 129 YFLGHPDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDEDVKRVVCEPLELAQEFRKFELQ 188

Query: 183 SPWEGVNS 190
           SPW+ + +
Sbjct: 189 SPWQQIPA 196


>gi|73983298|ref|XP_533185.2| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, 30kDa (NADH-coenzyme Q reductase) [Canis familiaris]
          Length = 263

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 115 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVYKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|164656983|ref|XP_001729618.1| hypothetical protein MGL_3162 [Malassezia globosa CBS 7966]
 gi|159103511|gb|EDP42404.1| hypothetical protein MGL_3162 [Malassezia globosa CBS 7966]
          Length = 275

 Score =  193 bits (491), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 123/188 (65%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + D G ++++     ++       EL+  V    L+   +FLRD     F  ++D+
Sbjct: 62  MQGPLHDYGSWVLSVLPRFIQQFSVYKDELTFYVAPAGLIPTMTFLRDHTLTQFKVLMDI 121

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G D+ +RS RF+V YH LS + N R+RVK    E   VP++  ++  ADWFERE WDMY
Sbjct: 122 SGADYPTRSQRFEVNYHLLSIRNNARIRVKTYADEVTPVPTVTSLFRSADWFEREAWDMY 181

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFF GHPDLRRILTDYGFEGHPLRKDFP+TG+ E+ +D++ K+VVY PV+LMQ HR+++
Sbjct: 182 GIFFAGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRWDEEKKRVVYEPVQLMQAHRNFE 241

Query: 181 FLSPWEGV 188
             S WE V
Sbjct: 242 PASAWEQV 249


>gi|115957411|ref|XP_796382.2| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, 30kDa (NADH-coenzyme Q reductase) [Strongylocentrotus
           purpuratus]
          Length = 256

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 128/185 (69%), Gaps = 1/185 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ + G+Y+ +     V+    + G EL + +    ++ + +FLRD  +  F ++ID+  
Sbjct: 48  RLVEFGNYVADCLPKYVQEVQVTYGNELEVMIHPEGIIPVITFLRDHHNAQFKSLIDITA 107

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +RS RF++VY+ LS +YN R+R+K    E  +V S+V ++  ADW EREVWDMYG+
Sbjct: 108 VDVPTRSQRFELVYNLLSLRYNERIRIKTYTDELSAVDSLVPVFKAADWLEREVWDMYGV 167

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHPLRKDFP++GFVE+ YDD++K+VV  P+E+ QE R +D  
Sbjct: 168 FFANHPDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDDELKRVVAEPLEMTQEFRKFDLS 227

Query: 183 SPWEG 187
           SPWE 
Sbjct: 228 SPWES 232


>gi|115975222|ref|XP_001178712.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, 30kDa (NADH-coenzyme Q reductase) [Strongylocentrotus
           purpuratus]
          Length = 258

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 128/185 (69%), Gaps = 1/185 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ + G+Y+ +     V+    + G EL + +    ++ + +FLRD  +  F ++ID+  
Sbjct: 50  RLVEFGNYVADCLPKYVQEVQVTYGNELEVMIHPEGIIPVITFLRDHHNAQFKSLIDITA 109

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +RS RF++VY+ LS +YN R+R+K    E  +V S+V ++  ADW EREVWDMYG+
Sbjct: 110 VDVPTRSQRFELVYNLLSLRYNERIRIKTYTDELSAVDSLVPVFKAADWLEREVWDMYGV 169

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHPLRKDFP++GFVE+ YDD++K+VV  P+E+ QE R +D  
Sbjct: 170 FFANHPDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDDELKRVVAEPLEMTQEFRKFDLS 229

Query: 183 SPWEG 187
           SPWE 
Sbjct: 230 SPWES 234


>gi|50261313|ref|YP_052922.1| NADH dehydrogenase subunit 9 [Saprolegnia ferax]
 gi|48237626|gb|AAT40675.1| NADH dehydrogenase subunit 9 [Saprolegnia ferax]
          Length = 187

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 129/178 (72%), Gaps = 2/178 (1%)

Query: 9   GDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR 68
           G Y++ +    + +  N   ELSL++    ++ +  FL+   +C +  I D+C VD+L+R
Sbjct: 8   GQYLLKTLP-IINYTFNK-KELSLNIPANKMIPIFFFLKYHTNCQYKVISDICAVDYLNR 65

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHP 128
            NRF+V+Y+ LS ++N R+R+KI + E +S+ SI  IY GA W+EREVWDM+GIFF  HP
Sbjct: 66  LNRFEVIYNLLSIRFNTRIRIKIIINELQSIDSITNIYKGASWWEREVWDMFGIFFINHP 125

Query: 129 DLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DLRRILTDYGFEG+PLRKDFP++G++E++Y++  K+VVY P+ L Q++R ++F SPW 
Sbjct: 126 DLRRILTDYGFEGYPLRKDFPLSGYLEVYYNELKKRVVYEPIHLSQKYRLFEFNSPWN 183


>gi|148223905|ref|NP_001088888.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [Xenopus laevis]
 gi|56789788|gb|AAH88695.1| LOC496233 protein [Xenopus laevis]
          Length = 250

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 125/188 (66%), Gaps = 1/188 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           ++ ++   G+Y+       V+   V   GEL + V    ++ +  FLRD  +  F ++ D
Sbjct: 44  LLNQLSAFGEYVAEIMPKYVQQVQVTCNGELEVMVHPDGVIPVLIFLRDHTNAQFKSLAD 103

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           L  VD  +R+NRF++VY+ LS ++N R+RVK    E   V S V ++  A+W+EREVWDM
Sbjct: 104 LTAVDIPARTNRFEIVYNLLSLRFNSRMRVKTYTDELTPVESSVPVFQAANWYEREVWDM 163

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PV+L QE R +
Sbjct: 164 YGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKF 223

Query: 180 DFLSPWEG 187
           D  SPWE 
Sbjct: 224 DLSSPWEA 231


>gi|148224598|ref|NP_001088497.1| hypothetical protein LOC495365 [Xenopus laevis]
 gi|54311248|gb|AAH84829.1| LOC495365 protein [Xenopus laevis]
          Length = 250

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 125/188 (66%), Gaps = 1/188 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           ++ ++   G+Y+       V+   V   GEL + V    ++ +  FLRD  +  F ++ D
Sbjct: 44  LLNQLSAFGEYVAEIMPKYVQQVQVTCNGELEVMVHPDGVIPVLVFLRDHTNAQFKSLAD 103

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           L  VD  +R+NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+EREVWDM
Sbjct: 104 LTAVDIPARTNRFEIVYNLLSLRFNSRMRVKTYADELTPIESAVPVFQAANWYEREVWDM 163

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PV+L QE R +
Sbjct: 164 YGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKF 223

Query: 180 DFLSPWEG 187
           D  SPWE 
Sbjct: 224 DLSSPWEA 231


>gi|329889334|ref|ZP_08267677.1| NADH-quinone oxidoreductase subunit C [Brevundimonas diminuta ATCC
           11568]
 gi|328844635|gb|EGF94199.1| NADH-quinone oxidoreductase subunit C [Brevundimonas diminuta ATCC
           11568]
          Length = 177

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 118/164 (71%), Gaps = 2/164 (1%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           + GEL+L      +V + + LRD     F   +D+CG D+  R+ RF+VVYH LS     
Sbjct: 2   AYGELTLIAQREKIVEVMTALRD--QFGFQQCMDVCGADYPDRAERFEVVYHLLSLTRAA 59

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           R+RVK++  E K VPS+  +YP A WFERE +DMYG+ F  HPD+RRILTDYGF+GHPLR
Sbjct: 60  RVRVKVSTDEVKPVPSVSSVYPSAGWFEREAFDMYGMIFSDHPDMRRILTDYGFQGHPLR 119

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           KDFP+TG+VE+ YD++ K++VY PV+L QE R++DFLSPWEG +
Sbjct: 120 KDFPMTGYVEVRYDEEQKRIVYEPVKLTQEFRNFDFLSPWEGAD 163


>gi|193657123|ref|XP_001952447.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Acyrthosiphon pisum]
          Length = 255

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 122/180 (67%), Gaps = 1/180 (0%)

Query: 8   LGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
            G+++       + +  ++S  EL L +    ++ +  FL++  +C F N+ DLC VD  
Sbjct: 53  FGNFVAECLPKYIQKIQISSKNELELLIAPEGVLPVFHFLKNQTNCQFANLSDLCAVDVP 112

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            RSNRF++VY+ LS ++N R+RVK    E   + SI  IY  A+W+ERE+WDM+G+FF  
Sbjct: 113 QRSNRFEIVYNLLSLRFNTRIRVKTYTDELTPIDSITSIYEAANWYEREIWDMFGVFFTN 172

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+ K+VV  P+E+ QE R ++  +PWE
Sbjct: 173 HPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLEMSQEFRRFELSTPWE 232


>gi|120952190|ref|NP_001073382.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Pan troglodytes]
 gi|115502345|sp|Q0MQG8|NDUS3_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
 gi|111661908|gb|ABH12175.1| mitochondrial complex I subunit NDUFS3 [Pan troglodytes]
          Length = 264

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 56  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|4758788|ref|NP_004542.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Homo sapiens]
 gi|6166589|sp|O75489|NDUS3_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
 gi|10443631|gb|AAG17541.1|AF200954_1 NADH dehydrogenase-ubiquinone 30 kDa subunit [Homo sapiens]
 gi|3337441|gb|AAC27451.1| NADH:ubiquinone oxidoreductase NDUFS3 subunit [Homo sapiens]
 gi|12653669|gb|AAH00617.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [Homo sapiens]
 gi|119588301|gb|EAW67895.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase), isoform CRA_a [Homo
           sapiens]
 gi|123982062|gb|ABM82860.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [synthetic construct]
 gi|123996891|gb|ABM86047.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [synthetic construct]
 gi|189054031|dbj|BAG36538.1| unnamed protein product [Homo sapiens]
          Length = 264

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 56  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|281340496|gb|EFB16080.1| hypothetical protein PANDA_010603 [Ailuropoda melanoleuca]
          Length = 219

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ +  FLRD  +  F ++ DL 
Sbjct: 11  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLIFLRDHTNAQFKSLADLT 70

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 71  AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVYKAANWYEREIWDMFG 130

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 131 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 190

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 191 NSPWEA 196


>gi|115502344|sp|Q0MQG7|NDUS3_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
 gi|111661910|gb|ABH12176.1| mitochondrial complex I subunit NDUFS3 [Gorilla gorilla]
          Length = 263

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|297493932|gb|ADI40688.1| NADH dehydrogenase Fe-S protein 3, 30kDa [Cynopterus sphinx]
          Length = 218

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 30  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLT 89

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 90  AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVHKAANWYEREIWDMFG 149

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 150 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 209

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 210 NSPWEA 215


>gi|332259910|ref|XP_003279027.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Nomascus leucogenys]
          Length = 266

 Score =  191 bits (486), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 58  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 117

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 118 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 177

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 178 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 237

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 238 NSPWEA 243


>gi|27807353|ref|NP_777244.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Bos taurus]
 gi|163416|gb|AAA30663.1| NADH dehydrogenase (ubiquinone) [Bos taurus]
          Length = 266

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 58  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLT 117

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 118 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVPVYKAANWYEREIWDMFG 177

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 178 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 237

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 238 NSPWEA 243


>gi|115502346|sp|Q0MQG6|NDUS3_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
 gi|111661912|gb|ABH12177.1| mitochondrial complex I subunit NDUFS3 [Pongo pygmaeus]
          Length = 263

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 55  QQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|5138999|gb|AAD40386.1| NADH-Ubiquinone reductase [Homo sapiens]
          Length = 263

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|128860|sp|P23709|NDUS3_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
          Length = 266

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 58  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLT 117

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 118 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVPVYKAANWYEREIWDMFG 177

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 178 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 237

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 238 NSPWEA 243


>gi|297688775|ref|XP_002821850.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Pongo abelii]
          Length = 269

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 61  QQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 120

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 121 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 180

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 181 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 240

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 241 NSPWEA 246


>gi|12832533|dbj|BAB22149.1| unnamed protein product [Mus musculus]
          Length = 263

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+ + EL + +    ++   +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|58037117|ref|NP_080964.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Mus musculus]
 gi|146345462|sp|Q9DCT2|NDUS3_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           3, mitochondrial; AltName: Full=Complex I-30kD;
           Short=CI-30kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 30 kDa subunit; Flags: Precursor
 gi|26353322|dbj|BAC40291.1| unnamed protein product [Mus musculus]
 gi|110831747|gb|AAI19268.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Mus musculus]
 gi|110831791|gb|AAI19270.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Mus musculus]
 gi|123213328|emb|CAM15313.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Mus musculus]
 gi|148695558|gb|EDL27505.1| mCG13496, isoform CRA_a [Mus musculus]
          Length = 263

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+ + EL + +    ++   +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|296479642|gb|DAA21757.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Bos taurus]
          Length = 251

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 58  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLT 117

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 118 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVPVYKAANWYEREIWDMFG 177

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 178 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 237

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 238 NSPWEA 243


>gi|301772554|ref|XP_002921693.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 265

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ +  FLRD  +  F ++ DL 
Sbjct: 57  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLIFLRDHTNAQFKSLADLT 116

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 117 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVYKAANWYEREIWDMFG 176

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 177 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 236

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 237 NSPWEA 242


>gi|311247859|ref|XP_003122849.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like isoform 1 [Sus scrofa]
          Length = 264

 Score =  191 bits (484), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 56  KQLSAFGQYVAEILPKYVQQVQVSCFNELEIFIHPDGVIPVLTFLRDHTNAQFKSLADLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVTVYKAANWYEREIWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|20071222|gb|AAH27270.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Mus musculus]
          Length = 263

 Score =  191 bits (484), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+ + EL + +    ++   +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|194217899|ref|XP_001491322.2| PREDICTED: similar to NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 3, mitochondrial precursor (NADH-ubiquinone
           oxidoreductase 30 kDa subunit) (Complex I-30kD)
           (CI-30kD) [Equus caballus]
          Length = 263

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 115 AVDIPTRQNRFEIVYNLLSLRFNCRIRVKTYTDELTPIESAVSVHKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|62955483|ref|NP_001017755.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Danio rerio]
 gi|62205446|gb|AAH93359.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q
           reductase) [Danio rerio]
 gi|182889640|gb|AAI65450.1| Ndufs3 protein [Danio rerio]
          Length = 255

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 126/195 (64%), Gaps = 1/195 (0%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ + G+Y+       V+   V    EL + V    ++ + +FL+D  +  F N+ DL  
Sbjct: 50  QLSEFGEYVAEILPKYVQQVQVTCFNELEIMVHPEGIIPVLTFLKDHTNAQFRNLADLTA 109

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  S+ NRF++VY+ LS  YN R+RVK    E   + S V ++  ++W+EREVWDM+G+
Sbjct: 110 VDIPSKQNRFEIVYNLLSLHYNSRIRVKTYTDELTPLDSSVPVFQASNWYEREVWDMFGV 169

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D  
Sbjct: 170 FFTNHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLN 229

Query: 183 SPWEGVNSLFAKEDS 197
           SPWE   +    +D+
Sbjct: 230 SPWEAFPAYRGPKDA 244


>gi|291384976|ref|XP_002709147.1| PREDICTED: NADH dehydrogenase (ubiquinone) Fe-S protein 3
           [Oryctolagus cuniculus]
          Length = 263

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQHVQVSCFDELEICIHPDGVIPVLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  SR NRF++VY+ LS ++N R+RVK    E   V S V ++  A+W+ERE+WDM+G
Sbjct: 115 AVDIPSRQNRFEIVYNLLSLRFNTRIRVKTYTDELTPVDSAVPVHKAANWYEREIWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|50554965|ref|XP_504891.1| YALI0F02123p [Yarrowia lipolytica]
 gi|6689654|emb|CAB65522.1| NUGM protein [Yarrowia lipolytica]
 gi|49650761|emb|CAG77693.1| YALI0F02123p [Yarrowia lipolytica]
          Length = 281

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 119/161 (73%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL+L V    ++ + +FLRD+    + +IID+  VD+ SR NRF+VVY+FLS ++N R+R
Sbjct: 95  ELTLHVAPSAVIPVTTFLRDNTSTQYKSIIDITAVDYPSRENRFEVVYNFLSVRHNSRIR 154

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   VPSI  +Y GA+WFERE +DMYG+FFEGHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 155 LKTYATEVTPVPSITCLYEGANWFEREAYDMYGVFFEGHPDLRRIMTDYGFEGHPLRKDF 214

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS-PWEGV 188
           P+TG+ E+ +D++ ++VVY P+EL Q  R++   S  WE V
Sbjct: 215 PLTGYTEVRWDEEKRRVVYEPLELTQAFRNFSAGSTAWEPV 255


>gi|157817227|ref|NP_001099959.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Rattus norvegicus]
 gi|149022595|gb|EDL79489.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 (predicted), isoform
           CRA_c [Rattus norvegicus]
          Length = 264

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V    EL + +    ++   +FL+D  +  F ++ DL 
Sbjct: 56  KRLSAFGEYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E  ++ SIV ++  A+W+EREVWDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|62898071|dbj|BAD96975.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) variant [Homo sapiens]
          Length = 264

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 56  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP +KDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFANHPDLRRILTDYGFEGHPFQKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|302563721|ref|NP_001181232.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Macaca mulatta]
          Length = 264

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F +++DL 
Sbjct: 56  KQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGIIPVLTFLRDHTNAQFKSLVDLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S + ++  A+W+ERE+WDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAMSVFKAANWYEREIWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D 
Sbjct: 176 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKFDL 235

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 236 NSPWEA 241


>gi|297493934|gb|ADI40689.1| NADH dehydrogenase Fe-S protein 3, 30kDa [Rousettus leschenaultii]
          Length = 214

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 124/185 (67%), Gaps = 1/185 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FL+D  +  F ++ DL 
Sbjct: 30  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLKDHSNAQFKSLADLT 89

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V ++  A+W+ERE+WDM+G
Sbjct: 90  AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVHKAANWYEREIWDMFG 149

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 150 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 209

Query: 182 LSPWE 186
            SPWE
Sbjct: 210 NSPWE 214


>gi|51592063|ref|NP_001003921.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Xenopus (Silurana)
           tropicalis]
 gi|51261601|gb|AAH79960.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [Xenopus (Silurana)
           tropicalis]
 gi|68085134|gb|AAH62521.2| NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [Xenopus (Silurana)
           tropicalis]
          Length = 250

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 124/188 (65%), Gaps = 1/188 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            + ++   G+Y+       V+   V   GEL + V    ++ + +FLRD  +  F ++ D
Sbjct: 44  QLNQLSAFGEYVAEILPKYVQQVQVTCNGELEVMVHPDGVIPVLTFLRDHTNAQFKSLAD 103

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           L  VD  +++NRF++VY+ LS ++N R+RV     E   V S V ++  A+W+EREVWDM
Sbjct: 104 LTAVDVPAKTNRFEIVYNLLSLRFNTRMRVMTYTDELTPVESAVPVFEAANWYEREVWDM 163

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PV+L QE R +
Sbjct: 164 YGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKF 223

Query: 180 DFLSPWEG 187
           D  SPWE 
Sbjct: 224 DLSSPWEA 231


>gi|89272859|emb|CAJ82146.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Xenopus (Silurana)
           tropicalis]
          Length = 250

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 124/188 (65%), Gaps = 1/188 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            + ++   G+Y+       V+   V   GEL + V    ++ + +FLRD  +  F ++ D
Sbjct: 44  QLNQLSAFGEYVAEILPKYVQQVQVTCNGELEVMVHPDGVIPVLTFLRDHTNAQFKSLAD 103

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           L  VD  +++NRF++VY+ LS ++N R+RV     E   V S V ++  A+W+EREVWDM
Sbjct: 104 LTAVDVPAKTNRFEIVYNLLSLRFNTRMRVMTYTDELTPVESAVPVFEAANWYEREVWDM 163

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PV+L QE R +
Sbjct: 164 YGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKF 223

Query: 180 DFLSPWEG 187
           D  SPWE 
Sbjct: 224 DLSSPWEA 231


>gi|149022594|gb|EDL79488.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 (predicted), isoform
           CRA_b [Rattus norvegicus]
          Length = 299

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V    EL + +    ++   +FL+D  +  F ++ DL 
Sbjct: 91  KRLSAFGEYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLT 150

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E  ++ SIV ++  A+W+EREVWDM+G
Sbjct: 151 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFG 210

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 211 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDL 270

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 271 NSPWEA 276


>gi|296218072|ref|XP_002755284.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Callithrix jacchus]
          Length = 262

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FL+D  +  F ++ DL 
Sbjct: 54  KQLSAFGEYVAEILPKYVQQVQVSLFDELEICIHPDGIIPVLTFLKDHTNAQFKSLADLT 113

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S+  ++  A+W+EREVWDM+G
Sbjct: 114 AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESLTSVFKAANWYEREVWDMFG 173

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 174 VFFVNHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 233

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 234 NSPWEA 239


>gi|149632743|ref|XP_001513308.1| PREDICTED: similar to NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 3, mitochondrial precursor (NADH-ubiquinone
           oxidoreductase 30 kDa subunit) (Complex I-30kD)
           (CI-30kD) [Ornithorhynchus anatinus]
          Length = 300

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FL+D  +  F ++ DL 
Sbjct: 92  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLKDHTNAQFKSLADLT 151

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 152 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVTVYKAANWYEREIWDMFG 211

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 212 VFFFNHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 271

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 272 NSPWEA 277


>gi|327259697|ref|XP_003214672.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Anolis carolinensis]
          Length = 268

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 124/187 (66%), Gaps = 1/187 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            ++++   G+Y+       V+   V    EL + +    ++ + +FL+D  +  F ++ D
Sbjct: 58  TLKQLSAFGEYVAEILPKYVQQVQVTCFNELEILIHPDGVIPVLTFLKDHTNAQFKSLAD 117

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           L  VD  SR  RF++VY+ LS +YN R+RVK    E   + S+V ++  ++W+EREVWDM
Sbjct: 118 LTAVDVPSRQYRFEIVYNLLSLRYNSRIRVKTYTDELTPIDSVVPVHQASNWYEREVWDM 177

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +
Sbjct: 178 YGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKF 237

Query: 180 DFLSPWE 186
           D  SPWE
Sbjct: 238 DLNSPWE 244


>gi|226437575|ref|NP_001139804.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial precursor [Gallus gallus]
          Length = 257

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 119/181 (65%), Gaps = 1/181 (0%)

Query: 8   LGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
            G+Y+       ++   V    EL L +    ++ + +FLRD  +  F ++ DL  VD  
Sbjct: 54  FGEYVAEILPKYIQQVQVTCFNELELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVP 113

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           SR  RF++VY+ LS ++N R+RVK    E   + S V ++  A+W+EREVWDMYG+FF  
Sbjct: 114 SRQYRFEIVYNLLSLRFNSRIRVKTYTDELTPIDSAVSVHKAANWYEREVWDMYGVFFAN 173

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D  SPWE
Sbjct: 174 HPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELSQEFRKFDLNSPWE 233

Query: 187 G 187
            
Sbjct: 234 A 234


>gi|6624942|emb|CAB63881.1| hypothetical protein [Homo sapiens]
          Length = 190

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 116/164 (70%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKY 83
           V+   EL + +    ++ + +FLRD  +  F +++DL  VD  +R NRF++VY+ LS ++
Sbjct: 4   VSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRF 63

Query: 84  NRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHP 143
           N R+RVK    E   + S V ++  A+W+ERE+WDM+G+FF  HPDLRRILTDYGFEGHP
Sbjct: 64  NSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHP 123

Query: 144 LRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
            RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D  SPWE 
Sbjct: 124 FRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA 167


>gi|326920390|ref|XP_003206457.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Meleagris gallopavo]
          Length = 344

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 122/189 (64%), Gaps = 1/189 (0%)

Query: 9   GDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           G+Y+       ++   V    EL L +    ++ + +FLRD  +  F ++ DL  VD  S
Sbjct: 142 GEYVAEILPKYIQQVQVTCFNELELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVPS 201

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R  RF++VY+ LS ++N R+RVK    E   + S V ++  A+W+EREVWDMYG+FF  H
Sbjct: 202 RQYRFEIVYNLLSLRFNSRIRVKTYTDELTPIDSAVSVHKAANWYEREVWDMYGVFFANH 261

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           PDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D  SPWE 
Sbjct: 262 PDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELSQEFRKFDLNSPWEA 321

Query: 188 VNSLFAKED 196
             +  A  +
Sbjct: 322 FPAYRAPPE 330


>gi|331225012|ref|XP_003325177.1| NADH-ubiquinone oxidoreductase subunit [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309304167|gb|EFP80758.1| NADH-ubiquinone oxidoreductase subunit [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 270

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/159 (54%), Positives = 114/159 (71%), Gaps = 1/159 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL+L      +V   +FLRD   C +  +ID+ GVD+ +R  RF+VVYH LS +Y  RLR
Sbjct: 84  ELTLYTAPSGIVGTLTFLRDHKQCQYKQLIDISGVDYPTRPKRFEVVYHLLSIQYASRLR 143

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+ GI+  ADWFEREV+DM+G+FF  HPDLRRILTDYGFEG+PLRKDF
Sbjct: 144 VKTYADEVSPVPSVSGIFRSADWFEREVYDMFGVFFHNHPDLRRILTDYGFEGYPLRKDF 203

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL-SPWE 186
           P+TG+ E+ YD++ K+VVY P++L Q  R+++   SPWE
Sbjct: 204 PLTGYTEVRYDEEKKRVVYEPLQLSQAFRNFEGANSPWE 242


>gi|224051042|ref|XP_002199900.1| PREDICTED: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase), partial [Taeniopygia
           guttata]
          Length = 224

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 119/181 (65%), Gaps = 1/181 (0%)

Query: 8   LGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
            G+Y+       ++   V    EL L +    ++ + +FLRD  +  F ++ DL  VD  
Sbjct: 21  FGEYVAEILPKYIQQVQVTCFNELELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVP 80

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           SR  RF++VY+ LS ++N R+RVK    E   + S V ++  A+W+EREVWDMYG+FF  
Sbjct: 81  SRQYRFEIVYNLLSLRFNSRIRVKTYTDELTPIDSAVPVHKAANWYEREVWDMYGVFFAN 140

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D  SPWE
Sbjct: 141 HPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWE 200

Query: 187 G 187
            
Sbjct: 201 A 201


>gi|126332740|ref|XP_001370635.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3 [Monodelphis domestica]
          Length = 354

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 146 KQLSAFGEYVAEILPKYVQQVQVSYFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLG 205

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   V S+V ++  A+W+ERE+WDM+G
Sbjct: 206 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPVDSVVSVHKAANWYEREIWDMFG 265

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           ++F  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D 
Sbjct: 266 VYFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKFDL 325

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 326 NSPWEA 331


>gi|296116533|ref|ZP_06835143.1| NADH (or F420H2) dehydrogenase, subunit C [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976745|gb|EFG83513.1| NADH (or F420H2) dehydrogenase, subunit C [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 221

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 130/191 (68%), Gaps = 11/191 (5%)

Query: 18  GSVRFAVNSV--GELSLDVDCGDLV---------SLCSFLRDDPHCCFVNIIDLCGVDFL 66
           GSV FA+ +   G +S  ++ G+LV         ++ + LRDDP      ++DLCGVD+ 
Sbjct: 20  GSVAFALGTSVPGIISAGIEGGELVVRTTRPYLLAIMTMLRDDPRYACEQMMDLCGVDYP 79

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R+ RFDVVY+ LS  +N R+RV +   E + V S+  ++P A W+ERE +D++G+ F  
Sbjct: 80  DRAERFDVVYNLLSVTHNHRIRVIVTTDETQPVASVHRLWPSATWWERECYDLFGVLFAD 139

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
            PDLRRILTDYGFEG+PLRKDFP+TG+VE  YD++ ++VVY PV+L Q+ R++DF SPWE
Sbjct: 140 QPDLRRILTDYGFEGYPLRKDFPLTGYVETRYDEERRQVVYEPVQLKQDFRNFDFESPWE 199

Query: 187 GVNSLFAKEDS 197
           G+ +L   E +
Sbjct: 200 GILTLPGDEKA 210


>gi|195337045|ref|XP_002035143.1| GM14080 [Drosophila sechellia]
 gi|194128236|gb|EDW50279.1| GM14080 [Drosophila sechellia]
          Length = 265

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|224051044|ref|XP_002198697.1| PREDICTED: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa
           (NADH-coenzyme Q reductase) [Taeniopygia guttata]
          Length = 278

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (65%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       ++   V    EL L +    ++ + +FLRD  +  F ++ DL 
Sbjct: 70  KQLCAFGEYVAEILPKYIQQVQVTCFNELELLIHPDGIIPVLTFLRDHTNAQFKSLADLT 129

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  SR  RF++VY+ LS ++N R+RVK    E   + S V ++  A+W+EREVWDMYG
Sbjct: 130 AVDVPSRQYRFEIVYNLLSLRFNSRIRVKTYTDELTPIDSAVPVHKAANWYEREVWDMYG 189

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+VK+VV  PVEL QE R +D 
Sbjct: 190 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVELAQEFRKFDL 249

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 250 NSPWEA 255


>gi|195587367|ref|XP_002083436.1| GD13354 [Drosophila simulans]
 gi|194195445|gb|EDX09021.1| GD13354 [Drosophila simulans]
          Length = 265

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|148675792|gb|EDL07739.1| mCG50233, isoform CRA_a [Mus musculus]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++    +Y+       V+   V+ + +L + +    ++   +FLRD  +  F ++ DL 
Sbjct: 6   KQLSAFAEYVAEILPKYVQQVQVSCLDKLEICIHHDGVIPTLTFLRDHTNAQFKSLADLT 65

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 66  AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 125

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+ G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 126 VFFFNHPDLRRILTDYGFEGHPFRKDFPLAGYVELRYDDEVKRVVAEPVELAQEFRKFDL 185

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 186 NSPWEA 191


>gi|103486795|ref|YP_616356.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingopyxis alaskensis
           RB2256]
 gi|98976872|gb|ABF53023.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingopyxis alaskensis
           RB2256]
          Length = 274

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (71%), Gaps = 2/164 (1%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           +VGE S+ V    +  +   LRD+    +  ++++ GVD+  R  RF+VVYH LS   N 
Sbjct: 7   TVGEDSITVRREAIAGVMISLRDN--LDYQQLMEIAGVDYPDRPERFEVVYHLLSVTKNH 64

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           RLRV+++  E   VPSIV ++P A W EREV+DMYG+ F G+PDLRRILTDYGF+GHP R
Sbjct: 65  RLRVRVSTDEATPVPSIVPVWPVAGWLEREVFDMYGVLFAGNPDLRRILTDYGFQGHPQR 124

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           KDFP+TG++EL Y ++ K+VVY PV+L Q+ R++DFLSPWEG +
Sbjct: 125 KDFPLTGYIELRYSEEDKRVVYEPVKLAQDFRNFDFLSPWEGAD 168


>gi|321455691|gb|EFX66817.1| hypothetical protein DAPPUDRAFT_115970 [Daphnia pulex]
          Length = 202

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 118/181 (65%), Gaps = 1/181 (0%)

Query: 7   DLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           D G Y+       V +  + +  EL + +    +V +  FL+D   C F ++ D+  +D 
Sbjct: 2   DFGLYVAECMPKYVQKVQIVTGNELEVLIAPDGIVPVLQFLKDHHQCQFASLADIGAMDV 61

Query: 66  LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
            SR NRF+V+Y+ LS ++N R+RVK    E   V S   ++  ADW+EREVWDMYG+FF 
Sbjct: 62  PSRENRFEVIYNLLSLRFNSRIRVKSYTDELTPVDSSYEVFKAADWYEREVWDMYGVFFA 121

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
            HPDLRRILTDYGFEGHP RKDFP+TG+VE+ YDD+ K+VV  PVEL QE R +D  SPW
Sbjct: 122 NHPDLRRILTDYGFEGHPFRKDFPLTGYVEVRYDDEAKRVVVEPVELAQEFRKFDLSSPW 181

Query: 186 E 186
           E
Sbjct: 182 E 182


>gi|24656494|ref|NP_647775.1| CG12079 [Drosophila melanogaster]
 gi|7292316|gb|AAF47723.1| CG12079 [Drosophila melanogaster]
 gi|21428482|gb|AAM49901.1| LD25561p [Drosophila melanogaster]
 gi|40882445|gb|AAR96134.1| RH59487p [Drosophila melanogaster]
 gi|220944318|gb|ACL84702.1| CG12079-PA [synthetic construct]
 gi|220954090|gb|ACL89588.1| CG12079-PA [synthetic construct]
          Length = 265

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|194865281|ref|XP_001971351.1| GG14478 [Drosophila erecta]
 gi|190653134|gb|EDV50377.1| GG14478 [Drosophila erecta]
          Length = 265

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|332373832|gb|AEE62057.1| unknown [Dendroctonus ponderosae]
          Length = 259

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 124/184 (67%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +++D G Y+ +     V  A  + G EL L +    +V +  FL+D  +C F N+ D+ G
Sbjct: 54  QLKDFGKYVADCLPKYVETAQITHGDELELLISPDGVVPVLQFLKDHHNCQFTNLSDIAG 113

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D  SR+ RF+++Y+ LS ++N R+RVK    E   V S   ++  A+W+ERE+WDMYG+
Sbjct: 114 MDVPSRTYRFELIYNLLSLRFNSRIRVKTYTDELTPVDSCDEVFKAANWYEREIWDMYGV 173

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+ K+VV  P+EL QE R ++  
Sbjct: 174 FFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLELAQEFRKFELS 233

Query: 183 SPWE 186
           +PWE
Sbjct: 234 APWE 237


>gi|328858908|gb|EGG08019.1| hypothetical protein MELLADRAFT_35287 [Melampsora larici-populina
           98AG31]
          Length = 224

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + D G Y+ +     ++       EL+L      +V +  FLRD   C +  ++D+ G D
Sbjct: 25  LHDYGTYLTSCIPKFIQQFSVYKDELTLYTSPDGIVPVLGFLRDHTQCQYKQLMDISGAD 84

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + +R  RF++VYH LS KY  R+RVK    E   VPS  G++  ADW+EREV+DMYG+FF
Sbjct: 85  YPTRPKRFEIVYHLLSLKYASRIRVKTYADEVSPVPSATGLFRSADWYEREVYDMYGVFF 144

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL-S 183
           + HPDLRRILTDYGFEG+PLRKDFP+TG+ E+ YD++ K+VVY P++L Q  R+++   S
Sbjct: 145 QNHPDLRRILTDYGFEGYPLRKDFPLTGYTEVRYDEEKKRVVYEPLQLSQAFRNFEGANS 204

Query: 184 PWEGVNS 190
           PWE    
Sbjct: 205 PWEQTGQ 211


>gi|319412294|gb|ADV41831.1| NADH dehydrogenase subunit 9 [Bigelowiella natans]
          Length = 185

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 114/177 (64%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           D +  S S S+        +L       +LV +  F++      F ++ D+   DF  ++
Sbjct: 8   DQLQTSLSLSLTEVSAKGWDLRAHTTASNLVGVLFFIKSSTSSLFNSLSDIAASDFPDKA 67

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            RF++ Y+ LS KY  RL +K+ V EG  VPSI  ++PGA+W ERE WD+ G+FF GHPD
Sbjct: 68  ERFELSYNLLSTKYGSRLLLKLTVGEGDVVPSITTLFPGANWMEREAWDLLGVFFNGHPD 127

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           LRRILTDYGFEGHPLRKDFP+TG++E  YD    ++VY PVEL QE+RD+ F SPW+
Sbjct: 128 LRRILTDYGFEGHPLRKDFPLTGYLEARYDVARARIVYEPVELAQEYRDFSFKSPWK 184


>gi|195376229|ref|XP_002046899.1| GJ12236 [Drosophila virilis]
 gi|194154057|gb|EDW69241.1| GJ12236 [Drosophila virilis]
          Length = 267

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 120/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ G+
Sbjct: 59  LSDFGRYVAECLPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGL 118

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS ++N R+RVK    E   + S+  ++  A+W+ERE+WDMYG+F
Sbjct: 119 DVPCRKNRFEVVYNLLSLRFNSRIRVKTYTDELTPLDSVCEVHKAANWYEREIWDMYGVF 178

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 179 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 238

Query: 184 PWE 186
           PWE
Sbjct: 239 PWE 241


>gi|82934613|ref|XP_894449.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Mus musculus]
          Length = 263

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++    +Y+       V+   V+ + +L + +    ++   +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFAEYVAEILPKYVQQVQVSCLDKLEICIHHDGVIPTLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+ G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 175 VFFFNHPDLRRILTDYGFEGHPFRKDFPLAGYVELRYDDEVKRVVAEPVELAQEFRKFDL 234

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 235 NSPWEA 240


>gi|113170491|ref|YP_717282.1| nad9 [Ostreococcus tauri]
 gi|112806898|emb|CAL36404.1| unnamed protein product [Ostreococcus tauri]
          Length = 186

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 115/174 (66%), Gaps = 1/174 (0%)

Query: 16  FSGSVRFAVNSVGELSLDVDC-GDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDV 74
           F   V+  +    E++L +    DL  +   L++     F  +ID+  VD+ SR  RF+V
Sbjct: 9   FPKWVQKVIAQSNEVTLVLKSPQDLHPVLEILKNHSATQFKMLIDITAVDYPSREARFEV 68

Query: 75  VYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
           VYH LS + N RLR+K+  +E   V S+  +YP A+WFERE WDM+GI F  HPDLRRIL
Sbjct: 69  VYHLLSVQRNTRLRLKVQCSEHAIVESVTSLYPAANWFERETWDMFGICFTNHPDLRRIL 128

Query: 135 TDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           TDYGFEGHPLRKDFP+TG+VE  YDD  K+VV  PVEL Q+ R ++F SPWE +
Sbjct: 129 TDYGFEGHPLRKDFPLTGYVEFKYDDTKKRVVAEPVELAQQFRQFEFRSPWEVI 182


>gi|198427805|ref|XP_002131761.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, (NADH-coenzyme Q reductase) [Ciona intestinalis]
          Length = 275

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 126/186 (67%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +K+ + G+++       V+   +    EL L VD   +V + SFL+D+    F N+ D+ 
Sbjct: 69  QKLVEYGNFVSECLPKFVQQVQITHTNELELLVDPEYIVQVISFLKDNALSQFTNLSDIT 128

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R  RF++VY+ LS  YN+R+RVK    E  +V SIV I+ GA+W+ERE+WDM+G
Sbjct: 129 VVDVPTRPCRFELVYNLLSLAYNQRIRVKSYTDELTAVDSIVEIHEGANWYEREIWDMFG 188

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF+ HPDLRRILTDYGF+GHP RKDFP++G+ E+ YDD+ +++V  P+E+ QE R +D 
Sbjct: 189 VFFKNHPDLRRILTDYGFDGHPFRKDFPLSGYYEVRYDDETERIVREPLEMAQEFRKFDL 248

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 249 TSPWEA 254


>gi|195492783|ref|XP_002094139.1| GE21665 [Drosophila yakuba]
 gi|194180240|gb|EDW93851.1| GE21665 [Drosophila yakuba]
          Length = 265

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRYNSRVRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|170055789|ref|XP_001863738.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial [Culex
           quinquefasciatus]
 gi|167875613|gb|EDS38996.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial [Culex
           quinquefasciatus]
          Length = 491

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ G+
Sbjct: 286 LSDFGKYVAECMPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHQAQFANLVDIAGM 345

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D  SR  RF+V+Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 346 DVPSRQYRFEVIYNILSLRYNSRIRVKTYTDELTPIDSCNEVFKAANWYEREIWDMYGVF 405

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP+TG+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 406 FANHPDLRRILTDYGFEGHPQRRDFPLTGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 465

Query: 184 PWE 186
           PWE
Sbjct: 466 PWE 468



 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 117/181 (64%), Gaps = 1/181 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ G+
Sbjct: 34  LSDFGKYVAECMPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHQAQFANLVDIAGM 93

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D  SR  RF+V+Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 94  DVPSRQYRFEVIYNILSLRYNSRIRVKTYTDELTPIDSCNEVFKAANWYEREIWDMYGVF 153

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP+TG+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 154 FANHPDLRRILTDYGFEGHPQRRDFPLTGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 213

Query: 184 P 184
           P
Sbjct: 214 P 214


>gi|91208867|ref|YP_539028.1| NADH dehydrogenase subunit 9 [Physcomitrella patens]
 gi|90991407|dbj|BAE93099.1| NADH dehydrogenase subunit 9 [Physcomitrella patens]
          Length = 195

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 110/148 (74%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +V E   
Sbjct: 37  LFQLLWFLKYHTNTRFQVLIDICGVDYPSRKQRFEVVYNLLSIQYNSRIRVQTSVDEITP 96

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S V I+P A W+EREVWDM+G++F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 97  ICSAVSIFPSAGWWEREVWDMFGVYFSNHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRY 156

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 157 DDSEKRVVSEPIEMTQEFRYFDFASPWE 184


>gi|309262569|ref|XP_003085834.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like [Mus musculus]
          Length = 233

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++    +Y+       V+   V+ + +L + +    ++   +FLRD  +  F ++ DL 
Sbjct: 25  KQLSAFAEYVAEILPKYVQQVQVSCLDKLEICIHHDGVIPTLTFLRDHTNAQFKSLADLT 84

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 85  AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 144

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP+ G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 145 VFFFNHPDLRRILTDYGFEGHPFRKDFPLAGYVELRYDDEVKRVVAEPVELAQEFRKFDL 204

Query: 182 LSPWEG 187
            SPWE 
Sbjct: 205 NSPWEA 210


>gi|260942471|ref|XP_002615534.1| hypothetical protein CLUG_04416 [Clavispora lusitaniae ATCC 42720]
 gi|238850824|gb|EEQ40288.1| hypothetical protein CLUG_04416 [Clavispora lusitaniae ATCC 42720]
          Length = 282

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++   G YI++     ++       EL++ V    +  +  +L++     F   +D+   
Sbjct: 71  ELHKFGTYIMSCMPKYIQQFSVWKDELTIYVAPSAIRPVMVYLKNHTPAQFKACMDITAA 130

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+ SR+NRFDVVY+ LS ++N R+RVK   +E  SVPS+V IY GA+W+EREV+DM+G+F
Sbjct: 131 DYPSRANRFDVVYNLLSVRHNSRIRVKTYASETSSVPSVVPIYQGANWYEREVYDMFGVF 190

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           FEGHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+VVY P+EL Q  R++   S
Sbjct: 191 FEGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVVYEPLELTQAWRNFTVGS 250

Query: 184 P-WEGV 188
             WE V
Sbjct: 251 SVWEQV 256


>gi|254455280|ref|ZP_05068709.1| NADH dehydrogenase i chain c [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082282|gb|EDZ59708.1| NADH dehydrogenase i chain c [Candidatus Pelagibacter sp. HTCC7211]
          Length = 201

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/195 (42%), Positives = 126/195 (64%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +EDL   I +  +  +        +L ++ D  DL+ +  F++ +    F  +ID+  VD
Sbjct: 4   LEDLEKKINSELTTKINSTEIKHNQLYIETDKDDLIDVTLFIKTNQDTKFRQLIDITVVD 63

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +   + RF +VY FLS +YN+R+ +  ++ E + +PS+  I+P ++W EREV+DMYG+ F
Sbjct: 64  YPENTQRFKMVYLFLSHEYNQRIILSYSINENEIIPSLTSIFPASNWMEREVFDMYGVSF 123

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           + HPDLRRILTDYGFEGHPLRKDFP+TG  E+ Y +  KKV+  PV+L Q +R++D+ SP
Sbjct: 124 KDHPDLRRILTDYGFEGHPLRKDFPLTGHTEVRYSEDQKKVINEPVKLEQNYRNFDYESP 183

Query: 185 WEGVNSLFAKEDSKD 199
           WEG   +  + DS D
Sbjct: 184 WEGTKYIKEELDSND 198


>gi|238880572|gb|EEQ44210.1| NADH-ubiquinone oxidoreductase subunit 9 [Candida albicans WO-1]
          Length = 279

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 123/189 (65%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI+      V+       EL++ V    ++    FL+++  C F  + D+
Sbjct: 63  QIEELHKFGTYIMACLPKYVQQFSVWKDELTIYVAPSAILPTMLFLKNNTACQFKQVSDV 122

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK    E   VPSI  ++ GA+WFERE +D++
Sbjct: 123 TAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETTPVPSITPLFNGANWFERETYDLF 182

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FFEGHPDLRRILTDYGFEGHPLRKDFP TG+ E+ YD++ K+++Y P+EL Q  R++ 
Sbjct: 183 GVFFEGHPDLRRILTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRIIYEPLELTQAWRNFT 242

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 243 VGSSVWEPV 251


>gi|229315931|ref|YP_002860157.1| NADH dehydrogenase subunit 9 [Micromonas sp. RCC299]
 gi|226431216|gb|ACO55621.1| NADH dehydrogenase subunit 9 [Micromonas sp. RCC299]
          Length = 188

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 109/155 (70%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAV 93
           V    L+   +FL++  +  F  +ID+  VD+ SRS+RF+VVY  LS  YN R+RVK  V
Sbjct: 31  VPSWALLPFLTFLKNHTNTQFKMLIDITAVDYPSRSSRFEVVYQLLSIHYNARIRVKTNV 90

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            E   + S+  ++P A+WFERE WDM+GI F  HPDLRRILTDYGFEGHPLRKDFPV+G+
Sbjct: 91  DELTPIESVSSLFPSANWFERETWDMFGICFLNHPDLRRILTDYGFEGHPLRKDFPVSGY 150

Query: 154 VELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           VE  YDD  K+V+  PVEL QE R +DF SPWE +
Sbjct: 151 VEFRYDDSKKRVISEPVELAQEFRYFDFASPWELI 185


>gi|2499319|sp|Q33994|NDUS3_BETTR RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 192

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|308072463|dbj|BAJ22093.1| NADH dehydrogenase subunit 9 [Cycas taitungensis]
          Length = 197

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 120/175 (68%), Gaps = 4/175 (2%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           S  E  L  +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN 
Sbjct: 25  SEHENRLYTNTDYLFQLLWFLKSHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNS 84

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           R+ V+ +V E   + S+V ++P A W+EREVWDM+G++F  HPDLRRILTDYGFEGHPLR
Sbjct: 85  RICVRTSVDEITRISSVVSLFPSAGWWEREVWDMFGVYFINHPDLRRILTDYGFEGHPLR 144

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKDD 200
           KDFP++G+VE+ YDD  K+VV+ P+ + QE R +DF SPWE +    A+ D  D+
Sbjct: 145 KDFPLSGYVEVRYDDSEKRVVFEPIGMTQEFRYFDFASPWEQM----ARSDGSDN 195


>gi|321268765|gb|ADW79214.1| NADH dehydrogenase subunit 9 [Cyanophora paradoxa]
          Length = 198

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 118/165 (71%), Gaps = 2/165 (1%)

Query: 22  FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSP 81
           F +N   EL L V+  +L S   FL+   +  +  + D+  VDFL R  RF+VVY FLS 
Sbjct: 33  FIIN--NELILIVENNNLNSTLFFLKYHTYTQYKVLCDITAVDFLDRIERFEVVYQFLSV 90

Query: 82  KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
            Y  RLR+K+ + E + + SI  +YP A+W+ERE+WD++GIFF  HPDLRRILTDYGFEG
Sbjct: 91  SYASRLRIKVNLKETELINSISTLYPCANWYEREIWDLFGIFFMNHPDLRRILTDYGFEG 150

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPL+KDFP++G++E+ YDD VK+V+  PV++ QE R+++F SPWE
Sbjct: 151 HPLKKDFPLSGYLEVRYDDIVKQVICEPVDITQEFRNFNFSSPWE 195


>gi|7545239|gb|AAA32025.2| NADH dehydrogenase [Phytophthora megasperma]
          Length = 188

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 118/159 (74%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +++    L+ +  FL++  +  F  + ++C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELCINIPTKKLIPILFFLKNHTNSQFKILSEICAVDYINKEKRFEIIYNLLSIRFNSRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           +VKI + E + V SI+ IY  A+W EREVWDM+GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 85  KVKITINEVQPVDSIINIYKAANWCEREVWDMFGIFFSNHPDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           FP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 145 FPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 183


>gi|241952715|ref|XP_002419079.1| NADH-ubiquinone oxidoreductase subunit, mitochondrial precursor,
           putative [Candida dubliniensis CD36]
 gi|223642419|emb|CAX42664.1| NADH-ubiquinone oxidoreductase subunit, mitochondrial precursor,
           putative [Candida dubliniensis CD36]
          Length = 280

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 122/189 (64%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI+      ++       EL++ V    ++    FL+++  C F  + D+
Sbjct: 64  QIEELHKFGTYIMACLPKYIQQFSVWKDELTIYVAPTAILPTMLFLKNNTSCQFKQVSDI 123

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK    E   VPSI   + GA+WFERE +D++
Sbjct: 124 TAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETTPVPSITPYFNGANWFERETYDLF 183

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFFEGHPDLRRILTDYGFEGHPLRKDFP TG+ E+ YD++ K+++Y P+EL Q  R++ 
Sbjct: 184 GIFFEGHPDLRRILTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRIIYEPLELTQAWRNFT 243

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 244 VGSSVWEPV 252


>gi|307101738|ref|YP_003875482.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|296040729|gb|ADG85332.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|301338033|gb|ADK73325.1| NADH dehydrogenase subunit 9 [Silene latifolia]
          Length = 192

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/158 (53%), Positives = 112/158 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|148555891|ref|YP_001263473.1| NADH (or F420H2) dehydrogenase subunit C [Sphingomonas wittichii
           RW1]
 gi|148501081|gb|ABQ69335.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingomonas wittichii
           RW1]
          Length = 217

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 2/177 (1%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           A + VGE++L V+   LV     LRD+    +  ++++ GVD+  R+ RF+VVY  LS  
Sbjct: 32  ARSCVGEIALHVERASLVETMRILRDE--LAYQQLMEIAGVDYPDRAERFEVVYCLLSVT 89

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
            N R+RV +   E + VPS+ G++P A W EREV+DMYG+ FEG+ DLRRILTDYGF GH
Sbjct: 90  KNHRIRVHVGTDEVQPVPSVTGLWPVAGWLEREVFDMYGVLFEGNADLRRILTDYGFRGH 149

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           P RKDFP+TG+VEL Y +  K+VVY PV+L Q+ R ++F+SPWEG + +   ++  +
Sbjct: 150 PQRKDFPLTGYVELRYSEAHKRVVYEPVKLAQDFRSFEFMSPWEGADYILPGDEKAE 206


>gi|11467145|ref|NP_054446.1| NADH dehydrogenase subunit 9 [Marchantia polymorpha]
 gi|786229|gb|AAC09443.1| ORF212 [Marchantia polymorpha]
          Length = 212

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYN 84
            S  E  L  +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS  YN
Sbjct: 40  TSKHENILYTNPNSLFQLLYFLKYHTNTRFKVLIDICGVDYPSRKRRFEVVYNLLSIDYN 99

Query: 85  RRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPL 144
            R+R+  +V E   + S+V I+P A W+ERE WDM+G++F  HPDLRRILTDYGFEGHPL
Sbjct: 100 TRIRILTSVDEITPICSVVSIFPSAGWWERETWDMFGVYFSNHPDLRRILTDYGFEGHPL 159

Query: 145 RKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           RKDFP++G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE ++
Sbjct: 160 RKDFPLSGYVEVRYDDSEKRVVSEPIEMTQEFRYFDFASPWEQMS 204


>gi|91079210|ref|XP_966588.1| PREDICTED: similar to AGAP006456-PA [Tribolium castaneum]
 gi|270004834|gb|EFA01282.1| hypothetical protein TcasGA2_TC002817 [Tribolium castaneum]
          Length = 257

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 121/184 (65%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +++D G Y        ++    + G EL L +    ++ +  FL+D  +  F NI D+ G
Sbjct: 53  QLKDFGKYCAECLPKYIQKVQITAGDELELLIVPEGVLPVLQFLKDHHNAQFANITDIAG 112

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D  SR  RF+V+Y+ LS ++N R+RVK    E   + S   IY GA+W+ERE+WDMYG+
Sbjct: 113 MDVPSREYRFEVIYNLLSLRFNSRIRVKTYTDELTPLDSACDIYKGANWYEREIWDMYGV 172

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+ K+VV  P+EL QE R ++  
Sbjct: 173 FFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLELAQEFRKFELS 232

Query: 183 SPWE 186
           +PWE
Sbjct: 233 APWE 236


>gi|195442360|ref|XP_002068926.1| GK18031 [Drosophila willistoni]
 gi|194165011|gb|EDW79912.1| GK18031 [Drosophila willistoni]
          Length = 266

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N++D+ G+
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGL 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R NRF+VVY+ LS ++N R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKNRFEVVYNLLSLRFNARIRVKTYTDELTPLDSACDVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|68468443|ref|XP_721781.1| potential mitochondrial Complex I, NUGM_30kd subunit [Candida
           albicans SC5314]
 gi|68468682|ref|XP_721660.1| potential mitochondrial Complex I, NUGM_30kd subunit [Candida
           albicans SC5314]
 gi|46443589|gb|EAL02870.1| potential mitochondrial Complex I, NUGM_30kd subunit [Candida
           albicans SC5314]
 gi|46443719|gb|EAL02999.1| potential mitochondrial Complex I, NUGM_30kd subunit [Candida
           albicans SC5314]
          Length = 279

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 126/190 (66%), Gaps = 3/190 (1%)

Query: 1   MVRKIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
            + ++   G YI+      V +F+V    EL++ V    ++    FL+++  C F  + D
Sbjct: 63  QIEELHKFGTYIMACLPKYVHQFSVWK-DELTIYVAPSAILPTMLFLKNNTACQFKQVSD 121

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +   D+ SR+NRFDVVY+ LS ++N R+RVK    E   VPSI  ++ GA+WFERE +D+
Sbjct: 122 VTAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETTPVPSITPLFNGANWFERETYDL 181

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G+FFEGHPDLRRILTDYGFEGHPLRKDFP TG+ E+ YD++ K+++Y P+EL Q  R++
Sbjct: 182 FGVFFEGHPDLRRILTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRIIYEPLELTQAWRNF 241

Query: 180 DFLSP-WEGV 188
              S  WE V
Sbjct: 242 TVGSSVWEPV 251


>gi|38638287|ref|NP_943683.1| NADH dehydrogenase subunit 9 [Chara vulgaris]
 gi|32966601|gb|AAP92184.1| NADH dehydrogenase subunit 9 [Chara vulgaris]
          Length = 188

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 116/160 (72%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
           S  E+ +  +  +L  +  FL++  +  F  +ID+CGVD+ SR +RF+VVY+ LS +YN 
Sbjct: 24  SKKEICIYTNPDNLFQMFFFLKNHTNTRFRVLIDICGVDYPSRKDRFEVVYNLLSIQYNS 83

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           RLRV   V E   + S+V I+P A W+EREVWDM+G++F  HPDLRRILTDYGFEGHPLR
Sbjct: 84  RLRVHTRVDEITPICSVVKIFPAAGWWEREVWDMFGVYFSNHPDLRRILTDYGFEGHPLR 143

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           KDFP++G+VE+ YDD  K+V+  P+E+ QE R +DF SPW
Sbjct: 144 KDFPLSGYVEVRYDDSEKRVISEPIEMTQEFRYFDFSSPW 183


>gi|321268760|gb|ADW79209.1| NADH dehydrogenase subunit 9 [Cyanophora paradoxa]
          Length = 198

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 118/165 (71%), Gaps = 2/165 (1%)

Query: 22  FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSP 81
           F +N   EL L V+  +L S   FL+   +  +  + D+  VDFL R  RF+VVY FLS 
Sbjct: 33  FIIN--NELILIVENNNLNSTLFFLKYHTYTQYKVLCDITAVDFLDRIERFEVVYQFLSV 90

Query: 82  KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
            Y  RLR+K+ + E + + SI  +YP A+W+ERE+WD++GIFF  HPDLRRILTDYGFEG
Sbjct: 91  SYASRLRIKVNLKETELINSISMLYPCANWYEREIWDLFGIFFMNHPDLRRILTDYGFEG 150

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPL+KDFP++G++E+ YDD VK+V+  PV++ QE R+++F SPWE
Sbjct: 151 HPLKKDFPLSGYLEVRYDDIVKQVICEPVDITQEFRNFNFSSPWE 195


>gi|297493930|gb|ADI40687.1| NADH dehydrogenase Fe-S protein 3, 30kDa [Miniopterus schreibersii]
          Length = 203

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 121/182 (66%), Gaps = 1/182 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+   EL + +    ++ + +FLRD  +  F ++ DL 
Sbjct: 22  KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGIIPVLTFLRDHTNAQFKSLADLT 81

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+W+ERE+WDM+G
Sbjct: 82  AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPLESTVSVYKAANWYEREIWDMFG 141

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PVEL QE R +D 
Sbjct: 142 VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL 201

Query: 182 LS 183
            S
Sbjct: 202 NS 203


>gi|71083584|ref|YP_266303.1| NADH dehydrogenase I subunit C [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91761995|ref|ZP_01263960.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|71062697|gb|AAZ21700.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717797|gb|EAS84447.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 202

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 128/194 (65%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           DL   I +  +  ++       +L +++D  DL+ +  F++ + +  F  +ID+  VD+ 
Sbjct: 6   DLEKKINSELTTKIKKTEIRHEQLYINIDNEDLIDVTLFIKSNENTKFRQLIDITVVDYP 65

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
             + RF VVY FLS ++N+R+ +   ++E + +PS+  IYP A+W EREV+DMYG+ F+ 
Sbjct: 66  ENAQRFKVVYLFLSHEFNQRIILSYLISENEVIPSLTPIYPAANWMEREVFDMYGVKFKD 125

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPD+RRILTDYGFEGHPLRKDFP+TG  E+ Y +  KKV+  PV+L Q +R++D+ SPWE
Sbjct: 126 HPDMRRILTDYGFEGHPLRKDFPLTGHTEVRYSEDQKKVISEPVKLEQNYRNFDYESPWE 185

Query: 187 GVNSLFAKEDSKDD 200
           G   +  + D ++D
Sbjct: 186 GTKYIKDQTDLEND 199


>gi|125977414|ref|XP_001352740.1| GA11380 [Drosophila pseudoobscura pseudoobscura]
 gi|54641490|gb|EAL30240.1| GA11380 [Drosophila pseudoobscura pseudoobscura]
          Length = 266

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N+ID+ G+
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLIDIAGM 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R +RF+V+Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKHRFEVIYNLLSLRYNARIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|56684557|gb|AAW21977.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494311|gb|ABF29491.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494315|gb|ABF29494.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494319|gb|ABF29497.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494323|gb|ABF29500.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494327|gb|ABF29503.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494331|gb|ABF29506.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494335|gb|ABF29509.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494339|gb|ABF29512.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494343|gb|ABF29515.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494347|gb|ABF29518.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
 gi|94494351|gb|ABF29521.1| NADH dehydrogenase subunit 9 [Plasmopara viticola]
          Length = 186

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 77/158 (48%), Positives = 116/158 (73%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +++    LV +  F ++  +  F  + ++C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELCINISTNKLVPILLFFKNHTNSQFKILSEICAVDYINKKKRFEIIYNLLSIRFNSRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           +VKI + E + V SI+ +Y  A+W ERE+WDM+GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 85  KVKITLNELQPVNSIIKVYKSANWCEREIWDMFGIFFLNHPDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           FP++GF+E+ Y++  K+VVY PV L Q++R ++F SPW
Sbjct: 145 FPLSGFLEVFYNELKKRVVYEPVNLAQQYRLFEFNSPW 182


>gi|195998265|ref|XP_002109001.1| hypothetical protein TRIADDRAFT_52564 [Trichoplax adhaerens]
 gi|190589777|gb|EDV29799.1| hypothetical protein TRIADDRAFT_52564 [Trichoplax adhaerens]
          Length = 269

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ D G Y+++     ++    ++G EL L V    L+    FLR+  +  F +++D+  
Sbjct: 60  RLTDYGRYLLDIIPKYLQGINLALGDELELLVYPEALIPTMIFLRNHTNAQFESLVDITA 119

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D   R  RF+++Y+ LS +YN R+RVK    E   + SI  I+PGA+WFEREVWDMYG+
Sbjct: 120 IDVPKREYRFELIYNLLSLRYNSRVRVKTYTDELTPIESITPIFPGANWFEREVWDMYGV 179

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           +F  HPDLRRILTDYGF+GHP RKDFP++G+ EL YDD++K++V  PVE  QE R +D  
Sbjct: 180 YFANHPDLRRILTDYGFDGHPQRKDFPLSGYTELRYDDELKRIVSEPVEFAQEFRKFDLE 239

Query: 183 SPWE 186
           +PWE
Sbjct: 240 TPWE 243


>gi|195169573|ref|XP_002025595.1| GL20750 [Drosophila persimilis]
 gi|194109088|gb|EDW31131.1| GL20750 [Drosophila persimilis]
          Length = 266

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N+ID+ G+
Sbjct: 60  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLIDIAGM 119

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R +RF+V+Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 120 DVPCRKHRFEVIYNLLSLRYNARIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 179

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 180 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 239

Query: 184 PWE 186
           PWE
Sbjct: 240 PWE 242


>gi|318037333|ref|NP_001188173.1| mitochondrial NADH dehydrogenase (ubiquinone) iron-sulfur protein 3
           [Ictalurus punctatus]
 gi|308323727|gb|ADO28999.1| mitochondrial NADH dehydrogenase (ubiquinone) iron-sulfur protein 3
           [Ictalurus punctatus]
          Length = 176

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 113/159 (71%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           ++ + +FLRD  +  F N+ DL  VD  +R NRF++VY+ LS ++N R+RVK    E   
Sbjct: 7   VLPVLTFLRDHSNAQFRNMTDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTP 66

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           V S V ++  A+W+EREVWDM+G+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ Y
Sbjct: 67  VDSAVPVHEAANWYEREVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRY 126

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           DD++K+VV  PVEL QE R +D  SPWE   +    +D+
Sbjct: 127 DDELKRVVAEPVELAQEFRKFDLNSPWEAFPAYREPKDA 165


>gi|2499321|sp|Q34011|NDUS3_BETWE RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 192

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVRLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|2828209|sp|P34944|NDUS3_MARPO RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 195

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYN 84
            S  E  L  +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS  YN
Sbjct: 23  TSKHENILYTNPNSLFQLLYFLKYHTNTRFKVLIDICGVDYPSRKRRFEVVYNLLSIDYN 82

Query: 85  RRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPL 144
            R+R+  +V E   + S+V I+P A W+ERE WDM+G++F  HPDLRRILTDYGFEGHPL
Sbjct: 83  TRIRILTSVDEITPICSVVSIFPSAGWWERETWDMFGVYFSNHPDLRRILTDYGFEGHPL 142

Query: 145 RKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           RKDFP++G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE ++
Sbjct: 143 RKDFPLSGYVEVRYDDSEKRVVSEPIEMTQEFRYFDFASPWEQMS 187


>gi|110816055|ref|YP_684387.1| NADH dehydrogenase subunit 9 [Oltmannsiellopsis viridis]
 gi|86450266|gb|ABC96345.1| NADH dehydrogenase subunit 9 [Oltmannsiellopsis viridis]
          Length = 188

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 117/178 (65%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           L  YI+ +    ++F V+    + L      LV+LC FL+ + +  +  ++D+CGVD+ S
Sbjct: 7   LASYILKTVPNLIKFCVSRRDSVVLYTTPDKLVALCKFLKYNVNTQYKVLVDVCGVDYPS 66

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R  RF++VY+FLS  YN R+ VK  V E   +PS+   +  A W+EREVWD+ G+F  GH
Sbjct: 67  RELRFEIVYNFLSVSYNSRICVKTCVDETTPIPSVTPTFSAAGWYEREVWDLLGVFISGH 126

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           PDLRRILTDYGFEGHPLRKDFP+TG+ E+ YD   K+V+  P +L Q  R ++F SPW
Sbjct: 127 PDLRRILTDYGFEGHPLRKDFPLTGYSEVRYDHNEKRVIKEPTQLSQNFRYFNFNSPW 184


>gi|156372565|ref|XP_001629107.1| predicted protein [Nematostella vectensis]
 gi|156216100|gb|EDO37044.1| predicted protein [Nematostella vectensis]
          Length = 193

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 122/183 (66%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFA-VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + + G+Y+ N     V+ A VN   EL + +  G +V + +FLRD  +  F ++ DL  +
Sbjct: 1   LSEFGEYVANILPKYVQQAQVNHCKELEILIAPGGIVPVLTFLRDHTNAEFKSMADLTAI 60

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D  SR  RF+++Y+ LS  YN R+RVK    E  ++ +   ++  A+W+EREVWDMYG+F
Sbjct: 61  DVPSRPYRFEIIYNLLSLTYNSRIRVKTYTDELTAIDTASEVHRIANWYEREVWDMYGVF 120

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP RKDFPV G+VE+ YDD++K++V  P+E+ QE+R +D   
Sbjct: 121 FSNHPDLRRILTDYGFEGHPFRKDFPVQGYVEVRYDDELKRLVCEPIEMAQEYRKFDISP 180

Query: 184 PWE 186
            WE
Sbjct: 181 TWE 183


>gi|150866762|ref|XP_001386464.2| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Scheffersomyces stipitis CBS 6054]
 gi|149388018|gb|ABN68435.2| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Scheffersomyces stipitis CBS 6054]
          Length = 281

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 122/189 (64%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI+      ++       EL++ V    L     FL++     F + +D+
Sbjct: 66  QIEELHKFGAYIMACMPKYIQQFSVWKDELTIYVAPSALRPTMVFLKNHTSAQFKSCVDV 125

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK    E  +VPS+V IY G +WFERE +D++
Sbjct: 126 TAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETSAVPSLVPIYQGVNWFERETYDLF 185

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFFEGHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+V+Y P+EL Q  R++ 
Sbjct: 186 GIFFEGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVIYEPLELTQAWRNFS 245

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 246 VGSSVWEQV 254


>gi|295311653|ref|YP_003587251.1| NADH dehydrogenase subunit 9 [Citrullus lanatus]
 gi|259156781|gb|ACV96643.1| NADH dehydrogenase subunit 9 [Citrullus lanatus]
          Length = 190

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 111/155 (71%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
           LD +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  LDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|194749201|ref|XP_001957028.1| GF10219 [Drosophila ananassae]
 gi|190624310|gb|EDV39834.1| GF10219 [Drosophila ananassae]
          Length = 261

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 57  LSDFGRYVAECLPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 116

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R +RF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 117 DVPCRKHRFEVVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 176

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 177 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 236

Query: 184 PWE 186
           PWE
Sbjct: 237 PWE 239


>gi|323398658|ref|YP_004222733.1| NADH dehydrogenase subunit 9 [Glaucocystis nostochinearum]
 gi|321401351|gb|ADW83105.1| NADH dehydrogenase subunit 9 [Glaucocystis nostochinearum]
          Length = 196

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 113/159 (71%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +  +   L  L  FL++  H  +  + D+ GVDFL    RF V Y FLS  +N R+
Sbjct: 33  NELIITTNSKYLFQLVYFLKNYSHAQYKLLSDIAGVDFLENKKRFLVSYQFLSILFNTRI 92

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           RVK  V+E +++ SIV ++P A+W+EREVWD+YG+FF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 93  RVKAYVSEFEAIESIVPLHPSANWYEREVWDLYGVFFINHPDLRRILTDYGFEGHPLRKD 152

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           FP++G+ E+ YDD +K+VV  P+E+ QE R++DF S W+
Sbjct: 153 FPLSGYTEVRYDDSLKQVVCEPLEITQEFRNFDFWSYWD 191


>gi|299830460|ref|YP_003734831.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
 gi|299830479|ref|YP_003734850.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
 gi|269810837|gb|ACZ43866.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
 gi|269810856|gb|ACZ43885.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
 gi|269812150|gb|ACZ44448.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
 gi|269812169|gb|ACZ44467.1| NADH dehydrogenase subunit 9 [Pythium ultimum]
          Length = 187

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 118/158 (74%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            ELS+++    +V +  FL++  +  F  + D+C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELSINIPFNKMVPIFFFLKNHTNTQFKVLSDICVVDYINKKKRFEIIYNLLSIRFNSRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           +VKI + E + V SI+ IY  A+W ERE WDM+GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 85  KVKILINELQPVDSIISIYKTANWCEREAWDMFGIFFINHPDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           FP++G++E++Y++  K+VVY P+ L Q++R ++F SPW
Sbjct: 145 FPLSGYLEVYYNELKKRVVYEPINLSQQYRLFEFNSPW 182


>gi|145932338|ref|YP_001165386.1| NADH dehydrogenase subunit 9 [Phytophthora sojae]
 gi|110169581|gb|ABG54047.1| NADH dehydrogenase subunit 9 [Phytophthora sojae]
          Length = 188

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 118/159 (74%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +++    L+ +  FL++  +C F  + ++C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELCINIPTNKLIPILFFLKNHTNCQFKLLSEICAVDYINKEKRFEIIYNLLSIRFNSRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           +VKI + E + V SI+ IY  A+W EREVWDM+GIFF  H DLRRILTDYGFEGHPLRKD
Sbjct: 85  KVKIMINELQPVDSIIHIYKAANWCEREVWDMFGIFFLNHNDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           FP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 145 FPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 183


>gi|56416678|ref|YP_153752.1| NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale str.
           St. Maries]
 gi|222475043|ref|YP_002563458.1| NADH-ubiquinone oxidoreductase subunit (nuoC1) [Anaplasma marginale
           str. Florida]
 gi|254994890|ref|ZP_05277080.1| NADH-ubiquinone oxidoreductase subunit (nuoC1) [Anaplasma marginale
           str. Mississippi]
 gi|255003023|ref|ZP_05277987.1| NADH-ubiquinone oxidoreductase subunit (nuoC1) [Anaplasma marginale
           str. Puerto Rico]
 gi|255004146|ref|ZP_05278947.1| NADH-ubiquinone oxidoreductase subunit (nuoC1) [Anaplasma marginale
           str. Virginia]
 gi|56387910|gb|AAV86497.1| NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale str.
           St. Maries]
 gi|222419179|gb|ACM49202.1| NADH-ubiquinone oxidoreductase subunit (nuoC1) [Anaplasma marginale
           str. Florida]
          Length = 187

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 116/165 (70%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           AV S G L   ++ GDL+   + LRDD    F  + D+  VD+ +R  RFDVVY  LS  
Sbjct: 21  AVRSDGVLECRLEAGDLLKCITTLRDDEKSKFKILTDIFAVDYQAREARFDVVYMLLSVA 80

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
           +N R+  K+ + EG +VPS+  ++  A WFEREV+DMYGI F+GHPDLRRILTDYGF GH
Sbjct: 81  FNARICCKVPLVEGHNVPSVTSVFGSAGWFEREVFDMYGIVFDGHPDLRRILTDYGFTGH 140

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           P+ KDFP+TG+ E+ YD + K+VVY+PV L Q+ R++D +SPW+G
Sbjct: 141 PMLKDFPLTGYDEVRYDLQKKQVVYQPVNLQQDFRNFDAISPWKG 185


>gi|296040731|gb|ADG85333.1| NADH dehydrogenase subunit 9 [Silene noctiflora]
          Length = 192

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/155 (54%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D     L  L  FLR   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTTPAFLFQLLCFLRLHTYTRFEVLIDICGVDYPSRQVRFEVVYNLLSTRYNSRIRVQS 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGLSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|255725898|ref|XP_002547875.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240133799|gb|EER33354.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 277

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 124/189 (65%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI++     ++       EL++ V    +  +  FLRD   C F +++D+
Sbjct: 62  QIEELHKFGTYIMSCLPKYIQQFSVWKDELTIYVAPSAIRPVMLFLRDHTSCQFKSVMDV 121

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK   +E   VPSI   + GA+W+ERE +D++
Sbjct: 122 TAADYPSRTNRFDVVYNMLSVRHNSRIRVKTYASETSPVPSITPFFNGANWYERETYDLF 181

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF GHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+V+Y P+EL Q  R++ 
Sbjct: 182 GVFFVGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVIYEPLELTQAWRNFT 241

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 242 VGSSVWEPV 250


>gi|312376047|gb|EFR23253.1| hypothetical protein AND_13232 [Anopheles darlingi]
          Length = 293

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 122/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ D G Y+       V +  + S  EL + +    +V +  FL+D  +  F N++D+ G
Sbjct: 88  ELSDFGKYVAECMPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHNSQFANLVDIAG 147

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D  SR+ RF+++Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+
Sbjct: 148 MDVPSRAFRFEIIYNILSLRYNSRIRVKTYTDELTPIDSCNEVFKAANWYEREIWDMYGV 207

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  
Sbjct: 208 FFANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLS 267

Query: 183 SPWE 186
           +PWE
Sbjct: 268 APWE 271


>gi|195012914|ref|XP_001983773.1| GH16082 [Drosophila grimshawi]
 gi|193897255|gb|EDV96121.1| GH16082 [Drosophila grimshawi]
          Length = 261

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ G+
Sbjct: 59  LSDFGRYVAECMPKYVQKVQLTSGDELEILIAPEGIVPVLQFLKDHHQAQFTNLVDIAGM 118

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R +RF+V+Y+ LS ++N R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 119 DVPCRQHRFEVIYNLLSLRFNARIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 178

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 179 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 238

Query: 184 PWE 186
           PWE
Sbjct: 239 PWE 241


>gi|58388728|ref|XP_316497.2| AGAP006456-PA [Anopheles gambiae str. PEST]
 gi|55239226|gb|EAA11886.2| AGAP006456-PA [Anopheles gambiae str. PEST]
          Length = 262

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (65%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ + G Y+       V +  + S  EL + +    +V +  FL+D  +  F N++D+ G
Sbjct: 57  ELSEFGKYVAECMPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHNAQFANLVDIAG 116

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D  SR  RF+++Y+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+
Sbjct: 117 MDVPSRPYRFEIIYNILSLRYNSRIRVKTYTDELTPIDSCNEVFKAANWYEREIWDMYGV 176

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  
Sbjct: 177 FFANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLS 236

Query: 183 SPWE 186
           +PWE
Sbjct: 237 APWE 240


>gi|322796534|gb|EFZ19008.1| hypothetical protein SINV_03420 [Solenopsis invicta]
          Length = 270

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 121/181 (66%), Gaps = 1/181 (0%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           + G YI +     ++    + G EL L +    ++ + +FL+D  +  FVN+ D+  +D 
Sbjct: 72  NFGRYINDCLPKYIQQVQMAAGDELELLIAPDGIIPILTFLKDHHNTQFVNLADITAIDV 131

Query: 66  LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
            SR  RF++VY+ LS +YN R+R+K    E   V S   ++  ADW+ERE+WDM+G+FF 
Sbjct: 132 PSRQYRFELVYNLLSLRYNSRIRIKTYTDELTPVDSAYSVFQVADWYEREIWDMFGVFFS 191

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
            HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD+ K++V  P+EL QE R ++  +PW
Sbjct: 192 NHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDDECKRIVIEPLELAQEFRKFELAAPW 251

Query: 186 E 186
           E
Sbjct: 252 E 252


>gi|226348820|gb|ACO50724.1| NADH dehydrogenase subunit 9 [Micromonas pusilla CCMP1545]
          Length = 180

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 103/136 (75%)

Query: 54  FVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFE 113
           F  ++D+  VD+ SR+ RFDVVYH LS +YN RLRVK  V E   V S+  +YP A+WFE
Sbjct: 43  FKVLVDVTAVDYPSRAKRFDVVYHLLSVQYNTRLRVKTMVDELTPVHSLTSLYPSANWFE 102

Query: 114 REVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELM 173
           REVWDM+GI F  HPDLRRILTDYGF+GHPLRKDFP++G+VE  YDD  K+VV  PVEL 
Sbjct: 103 REVWDMFGICFLHHPDLRRILTDYGFQGHPLRKDFPLSGYVEFRYDDSKKRVVAEPVELS 162

Query: 174 QEHRDYDFLSPWEGVN 189
           QE R +DF SPWE ++
Sbjct: 163 QEFRYFDFASPWELIS 178


>gi|94496480|ref|ZP_01303057.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingomonas sp. SKA58]
 gi|94424226|gb|EAT09250.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingomonas sp. SKA58]
          Length = 278

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 120/188 (63%), Gaps = 2/188 (1%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  I+ + D I       +   V+   ELS  V   +L +    LRD  H  +  ++++ 
Sbjct: 8   IATIDGIADEIAALLGSMLVETVDHADELSFTVVRAELANAMVTLRDMGH--YQQLMEIA 65

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  R+ RF+V YH LS   N R+RVK++  E   VP++  I+P A W EREV+DMYG
Sbjct: 66  GVDYPDRAERFEVCYHLLSVTRNHRIRVKVSTDENMPVPTVTHIWPVAGWLEREVFDMYG 125

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           + FEG+ DLRRILTDYGF GHP RKDFP+TG+VEL Y ++ K+VVY PV L Q+ R +DF
Sbjct: 126 VVFEGNTDLRRILTDYGFRGHPQRKDFPLTGYVELRYSEEDKRVVYEPVRLAQDFRSFDF 185

Query: 182 LSPWEGVN 189
           +SPWEG  
Sbjct: 186 MSPWEGAQ 193


>gi|221128571|ref|XP_002163056.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, (NADH-coenzyme Q reductase) [Hydra magnipapillata]
          Length = 268

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ + G ++ +S    V+ A  + G EL + +    ++ + +FLRD  +  F  ++D+  
Sbjct: 67  RLMEFGQFVSDSMPKFVQSAEVTEGDELQVLISPDGIIPILTFLRDHTNAQFKQLMDITA 126

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD+ S+  RF++VY+ LS +YN R+RVK    E   + S   ++  A+W ERE+WDMYG+
Sbjct: 127 VDWPSKPYRFEIVYNLLSVRYNTRIRVKTYTDELTPLDSASSLFHSANWAEREIWDMYGV 186

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           FF  HPDLRRILTDYGFEGHPLRKDFP++GF E+ YD ++K++V  PVEL QE R ++  
Sbjct: 187 FFSNHPDLRRILTDYGFEGHPLRKDFPLSGFYEIRYDSELKRLVQDPVELAQEFRKFELQ 246

Query: 183 SPWE 186
           SPWE
Sbjct: 247 SPWE 250


>gi|323435086|ref|YP_004222304.1| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
 gi|317905639|emb|CBJ14038.1| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
 gi|319439819|emb|CBJ17529.1| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
          Length = 192

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (69%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
              E   +  +V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  CADEVTRISLVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|9280612|gb|AAF86494.1|AF279447_1 NADH dehydrogenase subunit 9 [Lupinus luteus]
 gi|9280614|gb|AAF86495.1|AF279448_1 NADH dehydrogenase subunit 9 [Lupinus angustifolius]
          Length = 190

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/155 (53%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|255932309|ref|XP_002557711.1| Pc12g08820 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582330|emb|CAP80509.1| Pc12g08820 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 289

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 124/191 (64%), Gaps = 1/191 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +   G Y+++     ++       EL++      +V + SFL++     F  I D+
Sbjct: 75  MADSLHAYGQYVMSCLPKYIQQFTVWKDELTVYTAPAGVVPVMSFLKNHTAAEFTQISDI 134

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            GVDF +R  RF+VVY+ LS ++N R+RVK    E   VPS+ G++ GA W+EREV+DM+
Sbjct: 135 TGVDFPTRDQRFEVVYNLLSVRHNSRIRVKTYADEATPVPSVTGLFEGALWYEREVYDMF 194

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++
Sbjct: 195 GVFFSGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFE 254

Query: 181 FLS-PWEGVNS 190
             S  WE V +
Sbjct: 255 SGSTAWEPVGA 265


>gi|112253858|ref|YP_717114.1| NADH dehydrogenase subunit 9 [Brassica napus]
 gi|37591060|dbj|BAC98862.1| NADH dehydrogenase subunit 9 [Brassica napus]
 gi|80978902|gb|ABB54700.1| NADH dehydrogenase subunit 9 [Brassica oleracea var. botrytis]
          Length = 190

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/155 (53%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|195126120|ref|XP_002007522.1| GI12345 [Drosophila mojavensis]
 gi|193919131|gb|EDW17998.1| GI12345 [Drosophila mojavensis]
          Length = 267

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 118/183 (64%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + + G Y+       V +  + S  EL + +    +V +  FL+D     F N++D+ GV
Sbjct: 59  LSEFGRYVAECMPKYVQKVQLTSGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGV 118

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D   R  RF+VVY+ LS +YN R+RVK    E   + S   ++  A+W+ERE+WDMYG+F
Sbjct: 119 DVPCRKYRFEVVYNILSLRYNARIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVF 178

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 179 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 238

Query: 184 PWE 186
           PWE
Sbjct: 239 PWE 241


>gi|316996027|dbj|BAD83545.2| NADH dehydrogenase subunit 9 [Nicotiana tabacum]
          Length = 190

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/155 (53%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKQRFEVVYNLLSIRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|295311696|ref|YP_003587378.1| NADH dehydrogenase subunit 9 [Cucurbita pepo]
 gi|259156824|gb|ACV96685.1| NADH dehydrogenase subunit 9 [Cucurbita pepo]
          Length = 190

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
           LD +   L  L  FL+   +     +ID+CGVD+ SR  RF VVY+ LS +YN R+RV+ 
Sbjct: 31  LDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFAVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
              E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  RADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|146420605|ref|XP_001486257.1| hypothetical protein PGUG_01928 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146389672|gb|EDK37830.1| hypothetical protein PGUG_01928 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 282

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (65%), Gaps = 1/186 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++   G YI+      ++       EL L V    L     FL+      F +++D+   
Sbjct: 69  ELHKFGRYIMGCMPKYIQQFSVWKDELVLYVAPSALRPTMLFLKHHTPADFKSVMDVTAA 128

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+ SR+NRFDVVY+ LS ++N R+RVK   +E  +VPS+V ++ GA+WFERE +D++GIF
Sbjct: 129 DYPSRTNRFDVVYNLLSVRHNSRIRVKTYASETTAVPSVVPLFEGANWFERETYDLFGIF 188

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           FEGHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+VVY P+EL Q  R++   S
Sbjct: 189 FEGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEIRYDEEKKRVVYEPLELTQAFRNFSVGS 248

Query: 184 P-WEGV 188
             WE V
Sbjct: 249 SVWEPV 254


>gi|417393|sp|Q00673|NDUS3_CANMA RecName: Full=Probable NADH-ubiquinone oxidoreductase 30.4 kDa
           subunit, mitochondrial; AltName: Full=Alkane-inducible
           protein 1; AltName: Full=CI-31kD; AltName: Full=Complex
           I-30kD; Flags: Precursor
 gi|170908|gb|AAA34360.1| alkane-inducible protein [Candida maltosa]
 gi|740338|prf||2005210B alkaline-inducible peroxisomal protein
          Length = 276

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (65%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI++     ++       EL++ V    +  + S+L++   C F  ++D+
Sbjct: 62  QIEELHKFGTYIMSCLPKYIQQFSVWKDELTIYVAPSAIRPVMSYLKNHTSCQFKAVMDI 121

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK    E   VPS+  ++ GA+W+ERE +D++
Sbjct: 122 TAADYPSRTNRFDVVYNLLSDRHNSRIRVKTYANETSPVPSVTPLFNGANWYERETYDLF 181

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF GHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+V+Y P+EL Q  R++ 
Sbjct: 182 GVFFVGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVIYEPLELTQAWRNFT 241

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 242 VGSSVWEPV 250


>gi|9695380|ref|NP_037602.1| NADH dehydrogenase subunit 9 [Phytophthora infestans]
 gi|6692633|gb|AAF24776.1|U17009_8 NADH dehydrogenase subunit 9 [Phytophthora infestans]
 gi|58012138|gb|AAW62546.1| NADH dehydrogenase subunit 9 [Phytophthora infestans]
 gi|58201977|gb|AAW67032.1| NADH dehydrogenase subunit 9 [Phytophthora infestans]
 gi|58202024|gb|AAW67078.1| NADH dehydrogenase subunit 9 [Phytophthora infestans]
          Length = 188

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 74/159 (46%), Positives = 117/159 (73%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +++    L+ +  F ++  +  F  + ++C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELCINISSDKLIPILFFFKNHTNTQFKVLSEICAVDYINKEKRFEIIYNLLSIRFNSRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           ++KI + E + + SI+ IY  A+W EREVWDM+GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 85  KIKITINELQPINSIIKIYRAANWCEREVWDMFGIFFLNHPDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           FP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 145 FPLSGFLEVFYNELKKRVVYEPINLSQQYRVFEFNNPWD 183


>gi|269958903|ref|YP_003328692.1| NADH dehydrogenase subunit C [Anaplasma centrale str. Israel]
 gi|269848734|gb|ACZ49378.1| NADH dehydrogenase subunit C [Anaplasma centrale str. Israel]
          Length = 187

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 115/165 (69%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           AV   G L   ++ GDL+   + LRDD    F  + D+  VD+ +R  RFDVVY  LS  
Sbjct: 21  AVRDDGVLECRLEAGDLLKCITTLRDDEKSKFRILTDIFAVDYQAREARFDVVYMLLSVA 80

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
           +N R+  K+ + EG +VPS+  ++  A WFEREV+DMYGI F+GHPDLRRILTDYGF GH
Sbjct: 81  FNARICCKVPLVEGHNVPSVTSVFGAAGWFEREVFDMYGIVFDGHPDLRRILTDYGFTGH 140

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           P+ KDFP+TG+ E+ YD + K+VVY+PV L Q+ R++D +SPW+G
Sbjct: 141 PMLKDFPLTGYDEVRYDLQKKQVVYQPVNLQQDFRNFDAISPWKG 185


>gi|320148013|emb|CBJ20679.1| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
          Length = 206

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (69%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
              E   +  +V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  CADEVTRISLVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQELRYFDFASPWEQGN 188


>gi|41019517|sp|Q95748|NDUS3_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 190

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+V++ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVQVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|162279909|ref|NP_063974.2| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris]
 gi|37999950|sp|Q37787|NDUS3_BETVU RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
 gi|27753503|dbj|BAA07213.2| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris]
 gi|148491411|dbj|BAA99286.2| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris]
          Length = 192

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 83/158 (52%), Positives = 110/158 (69%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
              E   +  +V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  CADEVTRISLVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|38605724|sp|P80261|NDUS3_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27 kDa; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 190

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 110/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  F++   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFMKLHTYTRVQVLIDICGVDYPSRKQRFEVVYNLLSIRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+F   HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISSVVSLFPSAGWWEREVWDMFGVFSINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|332020270|gb|EGI60704.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Acromyrmex echinatior]
          Length = 263

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 124/186 (66%), Gaps = 1/186 (0%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           V ++ + G YI +     ++    + G EL L +    ++   +FL+D  +  FVN+ D+
Sbjct: 59  VDRLINFGRYINDCLPKYIQQVQLAAGDELELLITPDGIIPTFTFLKDHHNTQFVNLSDI 118

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             +D  SR  RF++VY+ LS +YN R+RVK    E   V S+  ++  A+W+ERE+WDM+
Sbjct: 119 TALDVPSRQCRFELVYNLLSLRYNSRIRVKTYTNELTPVDSLYSVFQAANWYEREIWDMF 178

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF  HPDLRRILTDYGF+GHPLRKDFP++G+VE+ YDD+ K++V  P+EL QE R ++
Sbjct: 179 GVFFSNHPDLRRILTDYGFQGHPLRKDFPLSGYVEVRYDDEHKRIVIEPLELTQEFRKFE 238

Query: 181 FLSPWE 186
             +PWE
Sbjct: 239 LAAPWE 244


>gi|326483818|gb|EGE07828.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Trichophyton
           equinum CBS 127.97]
          Length = 291

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 123/188 (65%), Gaps = 1/188 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+   G Y+++     ++       EL++ V    +V + +FLRD     +  + D+  V
Sbjct: 79  KLHTYGQYLISCLPKYIQQFSVWKDELTIYVPPAGVVPVMTFLRDHTAAEYTQVSDITAV 138

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA WFEREV+DM+G+F
Sbjct: 139 DFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVF 198

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FL 182
           F GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ K++V  P+EL Q  R+++   
Sbjct: 199 FTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGS 258

Query: 183 SPWEGVNS 190
           S WEG+  
Sbjct: 259 SAWEGIGQ 266


>gi|149184637|ref|ZP_01862955.1| NADH (or F420H2) dehydrogenase, subunit C [Erythrobacter sp. SD-21]
 gi|148831957|gb|EDL50390.1| NADH (or F420H2) dehydrogenase, subunit C [Erythrobacter sp. SD-21]
          Length = 306

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 118/182 (64%), Gaps = 10/182 (5%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LGD++V+             GEL L V    +      LRDD    +  ++++ GVD+ S
Sbjct: 24  LGDHLVSVH--------EEHGELLLAVHRASIEDALRILRDD--HGYQQLMEIAGVDYPS 73

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R+ RF+VVY  LS   N R+ VK   +E   VP++  ++P A W EREV+DMYG+ F+G+
Sbjct: 74  RAERFEVVYMLLSLTKNSRIMVKCTASEDTPVPTVTTLWPNAGWLEREVFDMYGVLFDGN 133

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
            DLRRILTDYGFEGHP RKDFP+TG+VEL Y +  K+VVY PVEL Q+ R +DF+SPWEG
Sbjct: 134 TDLRRILTDYGFEGHPFRKDFPLTGYVELRYSEDEKRVVYEPVELAQDLRQFDFMSPWEG 193

Query: 188 VN 189
            +
Sbjct: 194 AD 195


>gi|254572834|ref|XP_002493526.1| hypothetical protein [Pichia pastoris GS115]
 gi|238033325|emb|CAY71347.1| Hypothetical protein PAS_chr4_0120 [Pichia pastoris GS115]
 gi|308152246|emb|CBI83542.1| NUGM (30 kDa) subunit of mitochondrial NADH:ubiquinone
           oxidoreductase (complex I) [Pichia pastoris]
 gi|328354650|emb|CCA41047.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Pichia pastoris CBS
           7435]
          Length = 289

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 122/189 (64%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G YI+      V+       EL + V    L  + +FL+D     F   +D+
Sbjct: 73  QIEELHKFGRYIMGCLPKFVQQFSVWKDELVIYVAPSALTQVATFLKDHTSAQFKACMDV 132

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ +R+NRFDVVY+ LS ++N R+R+K   +E   VPS+V ++ GA+WFERE +D++
Sbjct: 133 TAADYPTRTNRFDVVYNLLSVRHNSRIRIKTYASEVSPVPSVVPLFQGANWFERETYDLF 192

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFFEGHPDLRRI+TDYGF+GHPLRKDFP TG+ E+ YD + ++VVY P+EL Q  R++ 
Sbjct: 193 GIFFEGHPDLRRIMTDYGFQGHPLRKDFPTTGYTEVRYDAEKRRVVYEPLELTQAWRNFT 252

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 253 VGSSVWEQV 261


>gi|149245542|ref|XP_001527248.1| NADH-ubiquinone oxidoreductase subunit 9 [Lodderomyces elongisporus
           NRRL YB-4239]
 gi|146449642|gb|EDK43898.1| NADH-ubiquinone oxidoreductase subunit 9 [Lodderomyces elongisporus
           NRRL YB-4239]
          Length = 304

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/189 (43%), Positives = 123/189 (65%), Gaps = 1/189 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
            + ++   G Y+++     ++       EL++ V    +  +  FL++     F + +D+
Sbjct: 87  QIEELHKFGTYLMSCLPKYIQQFSVWKDELTIYVAPSAIQIVSLFLKNHTSAQFKSCMDV 146

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
              D+ SR+NRFDVVY+ LS ++N R+RVK    E  +VPS+  IY GA+W+ERE +D++
Sbjct: 147 TAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETSAVPSVTSIYHGANWYERETYDLF 206

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF GHPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+VVY P+EL Q  R++ 
Sbjct: 207 GVFFTGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVVYEPLELTQAWRNFT 266

Query: 181 FLSP-WEGV 188
             S  WE V
Sbjct: 267 VGSSVWEQV 275


>gi|326474911|gb|EGD98920.1| NADH-ubiquinone oxidoreductase 304 kDa subunit [Trichophyton
           tonsurans CBS 112818]
          Length = 308

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 123/188 (65%), Gaps = 1/188 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+   G Y+++     ++       EL++ V    +V + +FLRD     +  + D+  V
Sbjct: 79  KLHTYGQYLISCLPKYIQQFSVWKDELTIYVPPAGVVPVMTFLRDHTAAEYTQVSDITAV 138

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA WFEREV+DM+G+F
Sbjct: 139 DFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVF 198

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FL 182
           F GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ K++V  P+EL Q  R+++   
Sbjct: 199 FTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGS 258

Query: 183 SPWEGVNS 190
           S WEG+  
Sbjct: 259 SAWEGIGQ 266


>gi|148259934|ref|YP_001234061.1| NADH (or F420H2) dehydrogenase, subunit C [Acidiphilium cryptum
           JF-5]
 gi|326403112|ref|YP_004283193.1| NADH-quinone oxidoreductase subunit C [Acidiphilium multivorum
           AIU301]
 gi|146401615|gb|ABQ30142.1| NADH dehydrogenase subunit C [Acidiphilium cryptum JF-5]
 gi|325049973|dbj|BAJ80311.1| NADH-quinone oxidoreductase subunit C [Acidiphilium multivorum
           AIU301]
          Length = 213

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 115/169 (68%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E  + VD   L ++   LRD+P   F   +D+CGVD+  R+ RFDVVY+ LS   N RLR
Sbjct: 38  ERIIAVDRAALAAVMRTLRDNPQFAFEQCMDVCGVDWPERAERFDVVYNLLSVTRNDRLR 97

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           V +   E   VPS+  I+PG  W+EREV+D++G+ F+G  D RRILTD GFEGHP+RKDF
Sbjct: 98  VIVTTDETAPVPSVSDIWPGVTWWEREVFDLFGVSFDGLVDHRRILTDNGFEGHPMRKDF 157

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           P+TG VEL YD++ K+VVY  V L QE R++DFLSPWE + +L   E +
Sbjct: 158 PLTGHVELRYDEEQKRVVYDKVALTQEFRNFDFLSPWEAMTTLPGDEKA 206


>gi|315055913|ref|XP_003177331.1| NADH dehydrogenase iron-sulfur protein 3 [Arthroderma gypseum CBS
           118893]
 gi|311339177|gb|EFQ98379.1| NADH dehydrogenase iron-sulfur protein 3 [Arthroderma gypseum CBS
           118893]
          Length = 291

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+   G Y+++     ++       EL++ V    +V + +FLRD     +  + D+  V
Sbjct: 79  KLHTYGQYLISCLPKYIQQFSVWKDELTIYVPPAGVVPVMTFLRDHTAAEYTQVSDITAV 138

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA WFEREV+DM+G+F
Sbjct: 139 DFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVF 198

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FL 182
           F GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ K++V  P+EL Q  R+++   
Sbjct: 199 FTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGS 258

Query: 183 SPWEGV 188
           S WEG+
Sbjct: 259 SAWEGI 264


>gi|329114680|ref|ZP_08243439.1| NADH-quinone oxidoreductase subunit C [Acetobacter pomorum DM001]
 gi|326696160|gb|EGE47842.1| NADH-quinone oxidoreductase subunit C [Acetobacter pomorum DM001]
          Length = 219

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 120/181 (66%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHF 78
           SV +A    GEL + ++   L+     LRD P   F  ++DLCGVDF  R  RFDVVY+ 
Sbjct: 30  SVSYAAVEKGELVVRIERDHLLHFLELLRDHPSYRFEQLMDLCGVDFPERPQRFDVVYNL 89

Query: 79  LSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           LS  +N R+RV +   E   VPS+  ++P A W+ERE +D++G+ F   PD+RRILTD G
Sbjct: 90  LSVTHNHRIRVIVQTDEIMPVPSVHHLWPCATWWERECYDLFGVVFSNQPDMRRILTDNG 149

Query: 139 FEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSK 198
           FEGHPLRKDFP+TG+ ++ YD + ++VV  PV L Q+ RD+DF+SPWEG+ +L   E + 
Sbjct: 150 FEGHPLRKDFPLTGYEQVRYDVERRQVVKEPVSLTQDFRDFDFVSPWEGMLTLPGDEKAH 209

Query: 199 D 199
           +
Sbjct: 210 E 210


>gi|332185776|ref|ZP_08387523.1| NADH-ubiquinone oxidoreductase chain C [Sphingomonas sp. S17]
 gi|332014134|gb|EGI56192.1| NADH-ubiquinone oxidoreductase chain C [Sphingomonas sp. S17]
          Length = 265

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/166 (51%), Positives = 113/166 (68%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPK 82
           A   VGE++L VD  +LV     LRD     +  ++++ GVD+  R  RF+VVY  LS  
Sbjct: 16  AREHVGEVALVVDRVNLVPAMIALRDTKGLEYQQLMEIAGVDYPERDERFEVVYCLLSLT 75

Query: 83  YNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
            N RL V +   E K VPS+ G++P A W EREV+D+YG+ F G+ DLRRILTDYGF GH
Sbjct: 76  RNHRLHVHVCTDEDKPVPSVTGLWPVAGWLEREVYDLYGVLFSGNSDLRRILTDYGFRGH 135

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           PLRKDFP+TG+ EL Y ++ K+VVY PV+L Q+ R++DF SPWEG 
Sbjct: 136 PLRKDFPLTGYTELRYSEEEKRVVYEPVKLAQDFRNFDFQSPWEGA 181


>gi|258542720|ref|YP_003188153.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633798|dbj|BAH99773.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636857|dbj|BAI02826.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639910|dbj|BAI05872.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642966|dbj|BAI08921.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646021|dbj|BAI11969.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649074|dbj|BAI15015.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652061|dbj|BAI17995.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655118|dbj|BAI21045.1| NADH-quinone oxidoreductase chain C [Acetobacter pasteurianus IFO
           3283-12]
          Length = 219

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 121/181 (66%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHF 78
           +V +A    GEL + ++   L+     LRD P   F  ++DLCGVDF  R  RF+VVY+ 
Sbjct: 30  AVSYAAVEKGELVVRIERDHLLHFFELLRDHPSYRFEQLMDLCGVDFPERPQRFEVVYNL 89

Query: 79  LSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           LS  +N R+RV +   E   VPS+  ++P A W+ERE +D++G+ F G PD+RRILTD G
Sbjct: 90  LSVTHNHRIRVIVQTDEVTPVPSVHHLWPCATWWERECYDLFGVVFSGQPDMRRILTDNG 149

Query: 139 FEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSK 198
           FEGHPLRKDFP+TG+ ++ YD + ++VV  PV L Q+ RD+DF+SPWEG+ +L   E + 
Sbjct: 150 FEGHPLRKDFPLTGYEQVRYDVERRQVVKEPVSLTQDFRDFDFVSPWEGMLTLPGDEKAH 209

Query: 199 D 199
           +
Sbjct: 210 E 210


>gi|145932432|ref|YP_001165343.1| NADH dehydrogenase subunit 9 [Phytophthora ramorum]
 gi|110169630|gb|ABG54095.1| NADH dehydrogenase subunit 9 [Phytophthora ramorum]
 gi|188037994|gb|ACD46612.1| NADH dehydrogenase subunit 9 [Phytophthora ramorum]
          Length = 188

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 116/159 (72%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            EL +++    L+ +  F ++     F  + ++C VD++++  RF+++Y+ LS ++N RL
Sbjct: 25  NELCINISRNKLIPVLFFFKNHTTSQFKVLSEICAVDYINKKKRFEIIYNLLSIRFNTRL 84

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           ++KI V E + V SI+ IY  A+W EREVWDM+GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 85  KIKITVNELQPVDSIIPIYKAANWCEREVWDMFGIFFLNHPDLRRILTDYGFEGHPLRKD 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           FP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 145 FPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 183


>gi|327306826|ref|XP_003238104.1| NADH-ubiquinone oxidoreductase subunit [Trichophyton rubrum CBS
           118892]
 gi|326458360|gb|EGD83813.1| NADH-ubiquinone oxidoreductase subunit [Trichophyton rubrum CBS
           118892]
          Length = 291

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 123/188 (65%), Gaps = 1/188 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+   G Y+++     ++       EL++ +    +V + +FLRD     +  + D+  V
Sbjct: 79  KLHTYGQYLISCLPKYIQQFSVWKDELTIYIPPAGVVPVMTFLRDHTAAEYTQVSDITAV 138

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA WFEREV+DM+G+F
Sbjct: 139 DFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVF 198

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FL 182
           F GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ K++V  P+EL Q  R+++   
Sbjct: 199 FTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGS 258

Query: 183 SPWEGVNS 190
           S WEG+  
Sbjct: 259 SAWEGIGQ 266


>gi|294011309|ref|YP_003544769.1| NADH dehydrogenase I chain C [Sphingobium japonicum UT26S]
 gi|292674639|dbj|BAI96157.1| NADH dehydrogenase I chain C [Sphingobium japonicum UT26S]
          Length = 297

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 120/188 (63%), Gaps = 2/188 (1%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  I+ +   I       +   V+   ELS  V    L      LRD     +  ++++ 
Sbjct: 8   IATIDGIAQEIAGLLGSMLVETVDHADELSFTVVREKLADAMVLLRD--KAQYQQLMEIA 65

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  R  RF+V YH LS   N R+RVK++  E + VP++  I+P A W EREV+DMYG
Sbjct: 66  GVDYPERPERFEVCYHLLSVTRNHRVRVKVSTDEDRPVPTVTHIWPVAGWLEREVFDMYG 125

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           + FEG+ DLRRILTDYGF+GHP RKDFP+TG+VE+ Y ++ K+VVY+PV+L Q+ R++DF
Sbjct: 126 VIFEGNADLRRILTDYGFKGHPQRKDFPLTGYVEMWYSEEDKRVVYKPVKLAQDFRNFDF 185

Query: 182 LSPWEGVN 189
           +SPWEG  
Sbjct: 186 MSPWEGAQ 193


>gi|70991843|ref|XP_750770.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus fumigatus Af293]
 gi|66848403|gb|EAL88732.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus fumigatus Af293]
 gi|159124332|gb|EDP49450.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus fumigatus A1163]
          Length = 334

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 124/191 (64%), Gaps = 4/191 (2%)

Query: 4   KIEDL---GDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           K E L   G Y+++     V+       EL++ V    ++ + SFL+      F  I D+
Sbjct: 70  KTESLHKYGQYVMSCLPKYVQQFSVWKDELTIYVPPTGIIPVMSFLKYHTAAEFTQISDI 129

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VDF +R  RF+VVY+ LS +YN R+RVK    E   VPS+ G+Y GA W+EREV+D++
Sbjct: 130 TAVDFPTRDQRFEVVYNLLSIRYNSRIRVKTYADEASPVPSVTGLYEGALWYEREVYDLF 189

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++
Sbjct: 190 GVFFSGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFE 249

Query: 181 -FLSPWEGVNS 190
              + WE V S
Sbjct: 250 GGTTAWEPVGS 260


>gi|324514811|gb|ADY45996.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 [Ascaris
           suum]
          Length = 260

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 121/186 (65%), Gaps = 5/186 (2%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           ++ + G Y       F   V+FA     EL L +    +V + +FL+ +    F N+  +
Sbjct: 45  RLANFGRYAAECLPKFVQRVQFAGGD--ELELLIHPSGVVPVMAFLKGNHSAQFTNLTFI 102

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVD  +R  RF+VVY  LS ++N R+RV+    E   + SI  ++ GA+W+EREV+D+Y
Sbjct: 103 CGVDVPTRKYRFEVVYALLSTRFNARIRVRTYTDEIAPIESITSVFKGANWYEREVYDLY 162

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G++F  HPDLRRILTDYGFEGHPLRKDFP++G+ E+ YD ++K++VY P EL QE R +D
Sbjct: 163 GVWFNNHPDLRRILTDYGFEGHPLRKDFPLSGYNEVRYDPELKRIVYEPTELAQEFRKFD 222

Query: 181 FLSPWE 186
             +PWE
Sbjct: 223 LETPWE 228


>gi|307293268|ref|ZP_07573114.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingobium
           chlorophenolicum L-1]
 gi|306881334|gb|EFN12550.1| NADH (or F420H2) dehydrogenase, subunit C [Sphingobium
           chlorophenolicum L-1]
          Length = 258

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 119/188 (63%), Gaps = 2/188 (1%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +  I+ +   I       +   V+   ELS  V    L    + LRD     +  ++++ 
Sbjct: 8   IATIDGIAQEIAGLLGSMLVETVDHADELSFTVVREKLADALAALRD--KAQYQQLMEIA 65

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           GVD+  R  RF+V YH LS   N R+RVK++  E + VP++  ++P A W EREV+DMYG
Sbjct: 66  GVDYPERPERFEVCYHLLSVTRNHRIRVKVSTDEDRPVPTVTHLWPVAGWLEREVFDMYG 125

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           + FEG+ DLRRILTDYGF+GHP RKDFP+TG+VEL Y ++ K+VVY PV+L Q+ R +DF
Sbjct: 126 VIFEGNADLRRILTDYGFKGHPQRKDFPLTGYVELRYSEEDKRVVYEPVKLAQDFRSFDF 185

Query: 182 LSPWEGVN 189
           +SPWEG  
Sbjct: 186 MSPWEGAQ 193


>gi|9280616|gb|AAF86496.1|AF279449_1 NADH dehydrogenase subunit 9 [Lupinus angustifolius]
          Length = 190

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 109/155 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 31  FDTNTDYLFQLLCFLKLHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQT 90

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +  +V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 91  SADEVTRISPVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 150

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 151 GYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|115400439|ref|XP_001215808.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Aspergillus terreus NIH2624]
 gi|114191474|gb|EAU33174.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Aspergillus terreus NIH2624]
          Length = 688

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/161 (49%), Positives = 113/161 (70%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL + V    ++ + SFL+      +  I D+  VDF +R  RF+VVY+ LS +YN R+R
Sbjct: 54  ELVIYVPPTGVIPVMSFLKYHTAAEYTQISDITAVDFPTRDQRFEVVYNLLSVRYNSRIR 113

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E + VPS+ G++ GA W+EREV+DM+G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 114 VKTYADEARPVPSVTGLFEGALWYEREVYDMFGVFFSGHPDLRRIMTDYGFDGHPLRKDF 173

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ EL YD++ K++V  P+EL Q  R+++   + WE V
Sbjct: 174 PLTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTAAWEPV 214


>gi|194033258|ref|YP_002000595.1| NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group]
 gi|60498753|dbj|BAC19900.2| NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group]
          Length = 190

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (72%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   
Sbjct: 38  LFPLLCFLKWHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTR 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 98  ISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 158 DDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|289739713|gb|ADD18604.1| NADH-ubiquinone oxidoreductase NDUFS3/30kDa subunit [Glossina
           morsitans morsitans]
          Length = 260

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 118/183 (64%), Gaps = 1/183 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + D G Y+       V+    + G EL + +    +V +  FL+D     F N+ D+ G+
Sbjct: 57  LSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFSNLTDIAGM 116

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D  +R  RF+V+Y+ LS +YN R+RVK    E   + S   +Y  A+W+ERE++DMYG+F
Sbjct: 117 DVPNRKYRFEVIYNILSLRYNSRIRVKTYTDELTPLDSCFEVYKAANWYEREIYDMYGVF 176

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGFEGHP R+DFP++G+VEL YDD+ K+VV  P+EL QE R +D  +
Sbjct: 177 FANHPDLRRILTDYGFEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSA 236

Query: 184 PWE 186
           PWE
Sbjct: 237 PWE 239


>gi|57337517|emb|CAI23792.1| NADH dehydrogenase, subunit 9 [Zea mays]
          Length = 190

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (72%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   
Sbjct: 38  LFPLLCFLKWHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTR 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 98  ISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 158 DDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|296823464|ref|XP_002850449.1| NADH-ubiquinone oxidoreductase kDa subunit [Arthroderma otae CBS
           113480]
 gi|238838003|gb|EEQ27665.1| NADH-ubiquinone oxidoreductase kDa subunit [Arthroderma otae CBS
           113480]
          Length = 291

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 123/188 (65%), Gaps = 1/188 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+   G Y+++     ++       EL++ V    +V + +FLRD     +  + D+  V
Sbjct: 79  KLHTYGQYLISCLPRYIQQFSVWKDELTIYVPPAGVVPVMTFLRDHTAAEYTQVSDITAV 138

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA WFEREV+DM+G+F
Sbjct: 139 DFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVF 198

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FL 182
           F GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ K++V  P+EL Q  R+++   
Sbjct: 199 FVGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGS 258

Query: 183 SPWEGVNS 190
           S WEGV  
Sbjct: 259 SAWEGVGQ 266


>gi|119469919|ref|XP_001257997.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Neosartorya fischeri NRRL 181]
 gi|119406149|gb|EAW16100.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Neosartorya fischeri NRRL 181]
          Length = 285

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     V+       EL++ V    ++ + SFL+      F  I D+  VD
Sbjct: 74  LHKYGQYVMSCLPKYVQQFSVWKDELTIYVPPTGIIPVMSFLKYHTAAEFTQISDITAVD 133

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS +YN R+RVK    E   VPS+  +Y GA W+EREV+DM+G+FF
Sbjct: 134 FPTRDQRFEVVYNLLSVRYNSRIRVKTYADEASPVPSVTSLYEGALWYEREVYDMFGVFF 193

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++   +
Sbjct: 194 SGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTA 253

Query: 184 PWEGVNS 190
            WE V S
Sbjct: 254 AWEPVGS 260


>gi|150421605|sp|Q35322|NDUS3_ORYSJ RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit;
           AltName: Full=Complex I-27kD; Short=CI-27kD; AltName:
           Full=NADH dehydrogenase subunit 9
          Length = 190

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (72%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   
Sbjct: 38  LFPLLCFLKWHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTR 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 98  ISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 158 DDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|87200315|ref|YP_497572.1| NADH (or F420H2) dehydrogenase, subunit C [Novosphingobium
           aromaticivorans DSM 12444]
 gi|123488913|sp|Q2G5Y5|NUOC_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|87135996|gb|ABD26738.1| NADH dehydrogenase subunit C [Novosphingobium aromaticivorans DSM
           12444]
          Length = 309

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 118/180 (65%), Gaps = 2/180 (1%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           D +V +    V  +    GE+ L V    +      LRDD    +  ++D+ GVD+  R+
Sbjct: 18  DTLVAALGDMVAASREEHGEILLTVVRDRVEDALRLLRDDHE--YQQLMDIAGVDYPQRA 75

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            RFDV Y  LS   N R+ VK++  E   VP++  ++P A W+EREV+DM+G+ F G+PD
Sbjct: 76  ERFDVCYCLLSVTKNHRVIVKVSTDEATPVPTVTTLWPNAGWYEREVYDMFGVLFAGNPD 135

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           LRRILTDYGF+GHP RKDFP+TG+VEL Y ++ K+VVY PV+L Q+ R +DF+SPWEG +
Sbjct: 136 LRRILTDYGFQGHPFRKDFPLTGYVELRYSEEDKRVVYEPVQLAQDLRQFDFMSPWEGAD 195


>gi|22550347|ref|NP_689378.1| NADH dehydrogenase subunit 9 [Chaetosphaeridium globosum]
 gi|22417013|gb|AAM96612.1|AF494279_17 NADH dehydrogenase subunit 9 [Chaetosphaeridium globosum]
          Length = 187

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 113/168 (67%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           ++ A  S  E  L +D   +V L  FL+   +  F   +D+  VD+ SR  RF++VY+ L
Sbjct: 19  IKKAQISKNESILYIDSDYIVPLLYFLKHHTNARFQICVDITAVDYPSRKQRFEIVYNLL 78

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
           S +YN R+R+  +V E   V S+  I+  A WFEREVWDM+G++F  HPDLRRILTDYGF
Sbjct: 79  SVQYNSRIRIHTSVDEITPVNSVTAIFASAGWFEREVWDMFGVYFSNHPDLRRILTDYGF 138

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           EGHPLRKDFP++G+VE+ YDD  K+V+  P+E+ QE R +DF S W+ 
Sbjct: 139 EGHPLRKDFPLSGYVEVRYDDSEKRVISEPIEMAQEFRYFDFASTWKS 186


>gi|242773027|ref|XP_002478155.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Talaromyces stipitatus ATCC 10500]
 gi|218721774|gb|EED21192.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Talaromyces stipitatus ATCC 10500]
          Length = 285

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 122/183 (66%), Gaps = 1/183 (0%)

Query: 9   GDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR 68
           G YI++     V+       EL++ V    LV + +FL+      F  I D+  VD+ +R
Sbjct: 79  GQYIMSCLPKYVQQFSVWKDELTIFVPPSGLVPVMTFLKYHTAAEFTQISDITAVDYPTR 138

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHP 128
             RF+VVY+ LS ++N R+RVK    E + VPS+  +Y GA W+EREV+DM+G+FF GHP
Sbjct: 139 DQRFEVVYNLLSVRHNSRIRVKTYCDEAQPVPSMTSLYDGALWYEREVYDMFGVFFSGHP 198

Query: 129 DLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEG 187
           DLRR+LTDYGF+GHPLRKDFP+TG+ E+ YD++ K++VY P+EL Q  R+++   S WE 
Sbjct: 199 DLRRMLTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVYEPLELTQAFRNFEGGTSSWEQ 258

Query: 188 VNS 190
           V S
Sbjct: 259 VGS 261


>gi|48099278|ref|XP_394885.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Apis mellifera]
          Length = 261

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 129/205 (62%), Gaps = 4/205 (1%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           +  I+DLG YI       V+      G EL + V    ++    FL+   +  + ++ D+
Sbjct: 53  LETIKDLGLYIAACLPKYVQKTQIVAGDELEILVCPEGIIPTLKFLKLHQNTQYTSLSDI 112

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             +D  SR  RF+++Y+ LS  +N+R+RVK    E   VPS   I+  A+W+ERE+WDM+
Sbjct: 113 TAMDVPSRQYRFEIIYNLLSITFNKRIRVKTYTDELTPVPSAEPIFDAANWYEREIWDMF 172

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GI F GH DLRRILTDYGFEGHPLRKDFP++GFVE+ YDD++K+VV  P+EL QE R ++
Sbjct: 173 GILFMGHTDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDDELKRVVCEPLELAQEFRKFE 232

Query: 181 FLSPWE---GVNSLFAKEDSKDDMS 202
             +PWE      S+   ++SK+D +
Sbjct: 233 LSAPWEQFPNFRSIPPSDESKEDST 257


>gi|67043755|gb|AAY63976.1| NADH dehydrogenase [Lysiphlebus testaceipes]
          Length = 267

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 121/184 (65%), Gaps = 1/184 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +++D G Y+       V+    + G EL + +    +    +FLRD  +  +  ++D+  
Sbjct: 58  QLKDFGHYVAECLPKYVQKVQIAAGDELEVCIAPEGIRPTMAFLRDHHNAQYSILVDITA 117

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  S+  RF+++Y  LS +YN R+RVK    E   V S+V ++  A+W+EREVWDMYGI
Sbjct: 118 VDVPSKPFRFELIYCLLSLRYNTRIRVKSYTDELTPVDSVVPVFKSANWYEREVWDMYGI 177

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
            F  HPD+RRILTDYGFEGHPLRKDFP++GFVE+ YDD+VK++V  P+EL QE R ++  
Sbjct: 178 LFSDHPDMRRILTDYGFEGHPLRKDFPLSGFVEVRYDDEVKRIVAEPLELAQEFRRFELS 237

Query: 183 SPWE 186
           +PWE
Sbjct: 238 APWE 241


>gi|296283831|ref|ZP_06861829.1| NADH (or F420H2) dehydrogenase, subunit C [Citromicrobium
           bathyomarinum JL354]
          Length = 283

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 117/185 (63%), Gaps = 2/185 (1%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I+ L D +  +    +  A    GEL L V    L      LRDD    +  ++++ GVD
Sbjct: 14  IDGLKDTLSGALGEMLVEAKEEHGELLLSVQRDRLEDALRLLRDD--HGYQQLMEIAGVD 71

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RF+VVY  LS   N R+ VK+  +E   VP+   ++P A W EREV+D+YG+ F
Sbjct: 72  YPGRPERFEVVYMLLSLTKNSRIMVKVTASETTPVPTATTLWPNAGWLEREVFDLYGVVF 131

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
            G+ DLRRILTDYGFEGHP RKDFP+TG+VEL Y ++ ++VVY PVEL Q+ R +DF+SP
Sbjct: 132 AGNMDLRRILTDYGFEGHPFRKDFPLTGYVELRYSEEEQRVVYEPVELAQDLRQFDFMSP 191

Query: 185 WEGVN 189
           WEG +
Sbjct: 192 WEGAD 196


>gi|67522543|ref|XP_659332.1| hypothetical protein AN1728.2 [Aspergillus nidulans FGSC A4]
 gi|40744858|gb|EAA64014.1| hypothetical protein AN1728.2 [Aspergillus nidulans FGSC A4]
          Length = 836

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 78/163 (47%), Positives = 112/163 (68%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL + V    ++   +FL+      F  + D+  VD+ ++  RF+VVY+ LS +YN R+R
Sbjct: 103 ELCIYVPPSGIIPTFTFLKYHTSAEFTTVSDITAVDYPTKDQRFEVVYNLLSVRYNSRIR 162

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI G+Y GA W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 163 VKTYADEASPVPSITGLYEGALWYEREVYDLFGVFFTGHPDLRRIMTDYGFDGHPLRKDF 222

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ EL YD++ K++V  P+EL Q  R+++   + WE V +
Sbjct: 223 PMTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTTAWEPVGA 265


>gi|209916088|gb|ACI95883.1| NADH dehydrogenase subunit 9 [Isoetes engelmannii]
 gi|217331584|gb|ACK38310.1| NADH dehydrogenase subunit 9 [Isoetes engelmannii]
 gi|241912114|gb|ACS71777.1| NADH dehydrogenase subunit 9 [Isoetes engelmannii]
 gi|314908356|gb|ADT62125.1| NADH dehydrogenase subunit 9 [Isoetes engelmannii]
          Length = 185

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (71%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS   N R+R+  +  E   
Sbjct: 35  LFQLLWFLKYHTNTRFQVLIDICGVDYPSRKERFEVVYNLLSVDCNTRVRISTSYDEITP 94

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+V I+P A W+EREVWDM+G+FF  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 95  ICSVVSIFPSAGWWEREVWDMFGVFFSNHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRY 154

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           DD  K+VV  P+E+ QE R +D  SPWE ++
Sbjct: 155 DDSEKRVVSEPIEMTQEFRYFDLASPWEQMS 185


>gi|320580130|gb|EFW94353.1| hypothetical protein HPODL_3853 [Pichia angusta DL-1]
          Length = 2655

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 76/153 (49%), Positives = 107/153 (69%), Gaps = 1/153 (0%)

Query: 39   LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
            LV + +FL++     F   +++   D+ SR NRFDVVY  LS ++N R+R+K   +E   
Sbjct: 2481 LVPVATFLKNHTSSQFTACMNITAADYPSRKNRFDVVYDLLSVRFNSRIRIKTFASEMTP 2540

Query: 99   VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
            +PS+V +Y GA+W ERE +D++G+FFE HPDLRRI+TDYGFEGHPLRKDFP TG+ E+ Y
Sbjct: 2541 IPSLVPLYEGANWLERETYDLFGVFFENHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRY 2600

Query: 159  DDKVKKVVYRPVELMQEHRDYDFLSP-WEGVNS 190
            D + ++VVY P+EL Q  R++   S  WE V +
Sbjct: 2601 DSEKRRVVYEPLELTQAWRNFTVGSSVWEQVGA 2633


>gi|302657857|ref|XP_003020640.1| hypothetical protein TRV_05262 [Trichophyton verrucosum HKI 0517]
 gi|291184495|gb|EFE40022.1| hypothetical protein TRV_05262 [Trichophyton verrucosum HKI 0517]
          Length = 207

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 81/163 (49%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ V    +V + +FLRD     +  + D+  VDF +R  RF+VVY+ LS ++N R+R
Sbjct: 7   ELTIYVPPAGVVPVMTFLRDHTAAEYTQVSDITAVDFPTREYRFEVVYNLLSVRHNSRIR 66

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA WFEREV+DM+G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 67  VKTYADEATPVPSITSLYDGALWFEREVYDMFGVFFTGHPDLRRIMTDYGFDGHPLRKDF 126

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P++G+ E+ YD++ K++V  P+EL Q  R+++   S WEG+  
Sbjct: 127 PLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGSSAWEGIGQ 169


>gi|170574739|ref|XP_001892941.1| NADH-ubiquinone oxidoreductase 30 kDa subunit, mitochondrial
           precursor [Brugia malayi]
 gi|158601253|gb|EDP38212.1| NADH-ubiquinone oxidoreductase 30 kDa subunit, mitochondrial
           precursor, putative [Brugia malayi]
          Length = 267

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 118/186 (63%), Gaps = 5/186 (2%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           K+   G Y       F   V+FA     EL L +    +  + +FL+ +    F NI+ +
Sbjct: 53  KLAKFGRYCAECLPKFVQKVQFAAGD--ELELLIHPSGVTPVIAFLKGNHAAQFTNIVFI 110

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G+D  SR  RF+V+Y FLS ++N R+RV+    E   + SI  I+ GA+W+EREV+DMY
Sbjct: 111 TGMDVPSRKFRFEVIYAFLSIRFNARIRVRTYTDEIAPLESITPIFKGANWYEREVYDMY 170

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G++F  HPDLRRILTDYGFEGHP RKDFP++G+VEL YD ++ + VY P EL QE R +D
Sbjct: 171 GVWFNNHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDSELBRCVYEPTELAQEFRKFD 230

Query: 181 FLSPWE 186
             +PWE
Sbjct: 231 LKTPWE 236


>gi|327195244|ref|YP_004339026.1| NADH dehydrogenase subunit 9 [Coccomyxa sp. C-169]
 gi|325070740|gb|ADY75468.1| NADH dehydrogenase subunit 9 [Coccomyxa sp. C-169]
          Length = 189

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 88/170 (51%), Positives = 113/170 (66%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           V+   +S  E  L V    LVS   FLRD  +     +ID+  +D  SRS+RF VVY  L
Sbjct: 17  VQHLQSSQEEAVLFVYPQHLVSFLLFLRDYTNTQCKQLIDITAIDNPSRSSRFQVVYQLL 76

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
           S +YN R+RVK  + E   + S  G++  A W+EREVWDM+GIFF  HPDLRRILTDYGF
Sbjct: 77  SVQYNARIRVKSCIDEVTPISSATGVFSCAAWWEREVWDMFGIFFYDHPDLRRILTDYGF 136

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           +GHPLRKDFP+TG+VE+ YDD  K+V+   VE+ QE R +DF +PWE + 
Sbjct: 137 QGHPLRKDFPLTGYVEVRYDDSEKRVITEAVEISQEFRYFDFSTPWETLK 186


>gi|311247861|ref|XP_003122850.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial-like isoform 2 [Sus scrofa]
          Length = 234

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/137 (56%), Positives = 100/137 (72%)

Query: 51  HCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGAD 110
              F ++ DL  VD  +R NRF++VY+ LS ++N R+RVK    E   + S V +Y  A+
Sbjct: 75  QVQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVTVYKAAN 134

Query: 111 WFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           W+ERE+WDM+G+FF  HPDLRRILTDYGFEGHP RKDFP++G+VEL YDD+VK+VV  PV
Sbjct: 135 WYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPV 194

Query: 171 ELMQEHRDYDFLSPWEG 187
           EL QE R +D  SPWE 
Sbjct: 195 ELAQEFRKFDLNSPWEA 211


>gi|85374164|ref|YP_458226.1| NADH dehydrogenase I, C subunit [Erythrobacter litoralis HTCC2594]
 gi|122544411|sp|Q2NA62|NUOC_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|84787247|gb|ABC63429.1| NADH dehydrogenase I, C subunit [Erythrobacter litoralis HTCC2594]
          Length = 250

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 124/197 (62%), Gaps = 11/197 (5%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++ LGDY+  S            GE+ + V+   +  +   LRDD    +  ++++ GVD
Sbjct: 21  VKALGDYVAASH--------EKYGEIIITVERDAIEDVLRTLRDD--HDYQQLMEIAGVD 70

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           +  R  RF+VVY  LS   N R+ VK++  E   VP++  ++P A W EREV+D+YG+ F
Sbjct: 71  YPERPERFEVVYMLLSLTKNHRVMVKVSTDEKTPVPTVTTLWPNAGWLEREVFDLYGVLF 130

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           +G+ DLRRILTDYGFEGHP RKDFP+TG+ EL Y ++ ++VVY PVEL Q+ R +DFLSP
Sbjct: 131 DGNTDLRRILTDYGFEGHPFRKDFPLTGYTELRYSEEEQRVVYEPVELAQDLRTFDFLSP 190

Query: 185 WEGVNSLFAKEDSKDDM 201
           WEG+       D K DM
Sbjct: 191 WEGMTPPLPG-DEKADM 206


>gi|238501634|ref|XP_002382051.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus flavus NRRL3357]
 gi|220692288|gb|EED48635.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus flavus NRRL3357]
          Length = 352

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     V+       EL + V    +V L SFL+      F  I D+  VD
Sbjct: 74  LHQYGQYVMSCLPKYVQQFTVWKDELVIYVPPSGVVPLMSFLKYHTAAEFTQISDITAVD 133

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F ++  RF+VVY+ LS ++N R+RVK    E   VPS+ G++ GA W+EREV+DM+G+FF
Sbjct: 134 FPTKDQRFEVVYNLLSVRHNSRIRVKTYADEATPVPSVTGLFEGALWYEREVYDMFGVFF 193

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++   +
Sbjct: 194 TGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTA 253

Query: 184 PWEGVNS 190
            WE V +
Sbjct: 254 AWEPVGT 260


>gi|169769188|ref|XP_001819064.1| NADH-ubiquinone oxidoreductase subunit [Aspergillus oryzae RIB40]
 gi|83766922|dbj|BAE57062.1| unnamed protein product [Aspergillus oryzae]
          Length = 284

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     V+       EL + V    +V L SFL+      F  I D+  VD
Sbjct: 74  LHQYGQYVMSCLPKYVQQFTVWKDELVIYVPPSGVVPLMSFLKYHTAAEFTQISDITAVD 133

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F ++  RF+VVY+ LS ++N R+RVK    E   VPS+ G++ GA W+EREV+DM+G+FF
Sbjct: 134 FPTKDQRFEVVYNLLSVRHNSRIRVKTYADEATPVPSVTGLFEGALWYEREVYDMFGVFF 193

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++   +
Sbjct: 194 TGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTA 253

Query: 184 PWEGVNS 190
            WE V +
Sbjct: 254 AWEPVGT 260


>gi|262186746|ref|YP_003276005.1| NADH dehydrogenase subunit 9 [Pleurozia purpurea]
 gi|237780743|gb|ACR19389.1| NADH dehydrogenase subunit 9 [Pleurozia purpurea]
          Length = 212

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 111/165 (67%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYN 84
            S  E  L  +   L  L  F +   +  F  +ID+ GVD  SR  RF+VVY+ LS  YN
Sbjct: 40  TSKHENILYTNPNSLFQLLYFPKYHTNTRFKVLIDIRGVDHPSRKRRFEVVYNLLSIDYN 99

Query: 85  RRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPL 144
            R+R+   V E   + S+VGI+P A W+ERE WDM+G++F  HPDLRRILTDYGFEGHPL
Sbjct: 100 TRIRILTGVDEITPICSVVGIFPSAGWWERETWDMFGVYFSNHPDLRRILTDYGFEGHPL 159

Query: 145 RKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           RKDFP++G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE ++
Sbjct: 160 RKDFPLSGYVEVRYDDSEKRVVSEPIEMTQEFRYFDFASPWEQMS 204


>gi|317032320|ref|XP_003188817.1| NADH-ubiquinone oxidoreductase subunit [Aspergillus niger CBS
           513.88]
 gi|317032322|ref|XP_001394604.2| NADH-ubiquinone oxidoreductase subunit [Aspergillus niger CBS
           513.88]
          Length = 287

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G YI++     V+       EL + V    L+   +FL+      +  I D+ GVD
Sbjct: 77  LHKYGQYIMSCLPKHVQQFSVWKDELCIYVPPSGLIPTMTFLKYHTAAEYTQISDITGVD 136

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS +YN R+RVK    E   VPS+ G++ GA W+EREV+DM+G+FF
Sbjct: 137 FPTRDQRFEVVYNMLSVRYNSRIRVKTYADEASPVPSVTGLFEGALWYEREVYDMFGVFF 196

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL Y ++ K++V  P+EL Q  R+++   +
Sbjct: 197 TGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYCEEKKRIVIEPLELTQAFRNFEGGTA 256

Query: 184 PWEGVNS 190
            WE V++
Sbjct: 257 AWEPVSA 263


>gi|295673804|ref|XP_002797448.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb01]
 gi|226282820|gb|EEH38386.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb01]
          Length = 288

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 117/171 (68%), Gaps = 1/171 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ V    ++ + +FL+      +  + D+  VDF +R  RF+VVY+ LS ++N R+R
Sbjct: 101 ELTIYVPPSGIIPVFTFLKQHTAAEYTQVSDITAVDFPTRDQRFEVVYNLLSVRHNSRIR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI G+Y GA W+EREV+DM+G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSITGLYDGALWYEREVYDMFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNSLFAKEDSK 198
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE +     K+ S+
Sbjct: 221 PLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGTSAWEQIGEGIDKKPSE 271


>gi|85708752|ref|ZP_01039818.1| NADH dehydrogenase subunit C [Erythrobacter sp. NAP1]
 gi|85690286|gb|EAQ30289.1| NADH dehydrogenase subunit C [Erythrobacter sp. NAP1]
          Length = 259

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           D +  S S  +  A    GE+ L      +  +   LRDD    +  ++++ G D+  R 
Sbjct: 18  DALSESVSVWLDRAEEQHGEIILTAKRESIAEVLRILRDD--HAYQQMMEIAGADYPDRD 75

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            RF+VVY  LS   N R+ VK +  E   VPS+  ++P A W EREV+D+YG+ FEG+ D
Sbjct: 76  ERFEVVYMLLSLTKNHRIMVKCSTDETTPVPSVTSLWPNAGWLEREVFDLYGVVFEGNSD 135

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           LRRILTDYGFEGHP RKDFP+TG+ EL Y +  K+VVY PVEL Q+ R +DFLSPWEG +
Sbjct: 136 LRRILTDYGFEGHPFRKDFPMTGYTELRYSEDEKRVVYEPVELPQDMRTFDFLSPWEGSD 195

Query: 190 SLFAKEDSKD 199
            +   ++  D
Sbjct: 196 YVLPGDEKAD 205


>gi|225681275|gb|EEH19559.1| NADH-ubiquinone oxidoreductase 27 kDa subunit [Paracoccidioides
           brasiliensis Pb03]
          Length = 288

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 125/195 (64%), Gaps = 1/195 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     ++       EL++ V    ++ + +FL+      +  + D+  VD
Sbjct: 77  LHKYGQYLISCLPKYIQQFSVWKDELTIYVPPSGIIPVFTFLKQHTAAEYTQVSDITAVD 136

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS ++N R+RVK    E   VPSI G+Y GA W+EREV+DM+G+FF
Sbjct: 137 FPTRDQRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITGLYDGALWYEREVYDMFGVFF 196

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+EL Q  R+++   S
Sbjct: 197 VGHPDLRRIMTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGTS 256

Query: 184 PWEGVNSLFAKEDSK 198
            WE +     K+ S+
Sbjct: 257 AWEQIGEGIDKKPSE 271


>gi|134079294|emb|CAK96923.1| unnamed protein product [Aspergillus niger]
          Length = 280

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G YI++     V+       EL + V    L+   +FL+      +  I D+ GVD
Sbjct: 70  LHKYGQYIMSCLPKHVQQFSVWKDELCIYVPPSGLIPTMTFLKYHTAAEYTQISDITGVD 129

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS +YN R+RVK    E   VPS+ G++ GA W+EREV+DM+G+FF
Sbjct: 130 FPTRDQRFEVVYNMLSVRYNSRIRVKTYADEASPVPSVTGLFEGALWYEREVYDMFGVFF 189

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL Y ++ K++V  P+EL Q  R+++   +
Sbjct: 190 TGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYCEEKKRIVIEPLELTQAFRNFEGGTA 249

Query: 184 PWEGVNS 190
            WE V++
Sbjct: 250 AWEPVSA 256


>gi|212531471|ref|XP_002145892.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Penicillium marneffei ATCC 18224]
 gi|210071256|gb|EEA25345.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Penicillium marneffei ATCC 18224]
          Length = 285

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (66%), Gaps = 1/183 (0%)

Query: 9   GDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR 68
           G YI++     V+       EL++ V    L+ + +FL+      +  I D+  VD+ +R
Sbjct: 79  GQYIMSCLPKYVQQFSVWKDELTVYVPPSGLIPVMTFLKYHTAAEYTQISDITAVDYPTR 138

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHP 128
             RF+VVY+ LS ++N R+RVK    E + VPS+  ++ GA W+EREV+DM+G+FF GHP
Sbjct: 139 DQRFEVVYNMLSVRHNSRIRVKTYCDEAQPVPSVTSLFDGALWYEREVYDMFGVFFTGHP 198

Query: 129 DLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEG 187
           DLRR+LTDYGF+GHPLRKDFP+TG+ E+ YD++ K++VY P+EL Q  R+++   S WE 
Sbjct: 199 DLRRMLTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVYEPLELTQAFRNFEGGTSSWEQ 258

Query: 188 VNS 190
           V S
Sbjct: 259 VGS 261


>gi|46134189|ref|XP_389410.1| hypothetical protein FG09234.1 [Gibberella zeae PH-1]
          Length = 290

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    +  + SFL+ +    F  +  +   D+ +R NRF++VY+ LS ++N R+R
Sbjct: 103 ELTIYISPSGVYPVFSFLKYNTAAEFTQVSTITAADYPTRENRFEIVYNLLSVRHNSRIR 162

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI G++ GA+W+EREV+D+YG+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 163 VKTYADEASPVPSITGLFDGANWYEREVYDLYGVFFAGHPDLRRIMTDYGFEGHPLRKDF 222

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V +
Sbjct: 223 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEPVGA 265


>gi|226292012|gb|EEH47432.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb18]
          Length = 288

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 125/195 (64%), Gaps = 1/195 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     ++       EL++ V    ++ + +FL+      +  + D+  VD
Sbjct: 77  LHKYGQYLISCLPKYIQQFSVWKDELTIYVPPSGIIPVFTFLKQHTAAEYTQVSDITAVD 136

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS ++N R+RVK    E   VPSI G+Y GA W+EREV+DM+G+FF
Sbjct: 137 FPTRDQRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITGLYDGALWYEREVYDMFGVFF 196

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+EL Q  R+++   S
Sbjct: 197 VGHPDLRRIMTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGTS 256

Query: 184 PWEGVNSLFAKEDSK 198
            WE +     K+ S+
Sbjct: 257 AWEQIGEGIDKKPSE 271


>gi|212531473|ref|XP_002145893.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Penicillium marneffei ATCC 18224]
 gi|210071257|gb|EEA25346.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Penicillium marneffei ATCC 18224]
          Length = 306

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 123/187 (65%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G YI++     V+       EL++ V    L+ + +FL+      +  I D+  VD
Sbjct: 75  MHKYGQYIMSCLPKYVQQFSVWKDELTVYVPPSGLIPVMTFLKYHTAAEYTQISDITAVD 134

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + +R  RF+VVY+ LS ++N R+RVK    E + VPS+  ++ GA W+EREV+DM+G+FF
Sbjct: 135 YPTRDQRFEVVYNMLSVRHNSRIRVKTYCDEAQPVPSVTSLFDGALWYEREVYDMFGVFF 194

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRR+LTDYGF+GHPLRKDFP+TG+ E+ YD++ K++VY P+EL Q  R+++   S
Sbjct: 195 TGHPDLRRMLTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVYEPLELTQAFRNFEGGTS 254

Query: 184 PWEGVNS 190
            WE V S
Sbjct: 255 SWEQVGS 261


>gi|302895891|ref|XP_003046826.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727753|gb|EEU41113.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 290

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    +  + SFL+ +    F  +  +   D+ +R NRF++VY+ LS ++N R+R
Sbjct: 103 ELTIYISPSGVYPVFSFLKYNTAAEFTQVSTVTAADYPTRENRFEIVYNLLSVRHNSRIR 162

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI G++ GA+W+EREV+D+YG+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 163 VKTYADEASPVPSITGLFDGANWYEREVYDLYGVFFAGHPDLRRIMTDYGFEGHPLRKDF 222

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V +
Sbjct: 223 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEPVGA 265


>gi|320588831|gb|EFX01299.1| NADH-ubiquinone oxidoreductase subunit precursor [Grosmannia
           clavigera kw1407]
          Length = 296

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + +FL+ +    F  I D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 109 ELTIYIPPSGVIPVFTFLKYNTSAEFTQISDITAVDFPTRDQRFEIVYNLLSVRHNSRIR 168

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+DM+G+FF  HPDLRRI+TDYGFEGHPLRKDF
Sbjct: 169 VKTYADEASPVPSVTSLYDGANWYEREVYDMFGVFFVDHPDLRRIMTDYGFEGHPLRKDF 228

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           PVTG+ EL YD++ K++V  P+EL Q  R+++   S WE V +
Sbjct: 229 PVTGYTELRYDEEKKRIVTEPLELTQAFRNFEGGSSSWEQVGA 271


>gi|50409157|ref|XP_456843.1| DEHA2A11814p [Debaryomyces hansenii CBS767]
 gi|49652507|emb|CAG84818.1| DEHA2A11814p [Debaryomyces hansenii]
          Length = 284

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 119/186 (63%), Gaps = 1/186 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++   G YI+      ++       EL + V    L     FL++     F  ++D+   
Sbjct: 71  ELHKFGKYIMGCLPKFIQQFSVWKDELVIYVAPSALRPTMMFLKNHTAAQFKAVMDVTAA 130

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           D+ SR+NRFDVVY+ LS ++N R+RVK   +E   VPSIV ++ G +WFERE +D++GIF
Sbjct: 131 DYPSRTNRFDVVYNMLSVRHNSRIRVKTYASEVSPVPSIVPLFQGTNWFERETYDLFGIF 190

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           FE HPDLRRI+TDYGFEGHPLRKDFP TG+ E+ YD++ K+VVY P+EL Q  R++   S
Sbjct: 191 FEDHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVVYEPLELSQAFRNFAVGS 250

Query: 184 P-WEGV 188
             WE V
Sbjct: 251 SVWEPV 256


>gi|260818990|ref|XP_002604665.1| hypothetical protein BRAFLDRAFT_167919 [Branchiostoma floridae]
 gi|229289993|gb|EEN60676.1| hypothetical protein BRAFLDRAFT_167919 [Branchiostoma floridae]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 118/187 (63%), Gaps = 1/187 (0%)

Query: 1   MVRKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M  ++   G+Y+       V+   V S  EL + +    +V + SFL+D  +  F ++ D
Sbjct: 9   MRNQLTVFGEYVAECLPKYVQTVQVTSQNELEVLISPEGVVPVLSFLKDHHNAQFKSLAD 68

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           +  VD  ++  RF++VY  +S  YN R+RV+    E   + S   ++  ADW+ERE WDM
Sbjct: 69  IACVDMPTKPYRFELVYMLMSLTYNSRIRVRTYTDEITPIESCYSVFKAADWYEREAWDM 128

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG++F  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YD+++K++V  PVEL QE R +
Sbjct: 129 YGVYFSNHPDLRRILTDYGFEGHPFRKDFPLSGYVEIRYDNELKRIVQEPVELAQEFRKF 188

Query: 180 DFLSPWE 186
           D  S WE
Sbjct: 189 DLSSTWE 195


>gi|11466593|ref|NP_066483.1| NADH dehydrogenase subunit 9 [Rhodomonas salina]
 gi|10444180|gb|AAG17754.1|AF288090_30 NADH dehydrogenase subunit 9 [Rhodomonas salina]
          Length = 188

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           ++ +++  S    +     S+  L + +    L  + SFL+++  CCF  ++D+  +DFL
Sbjct: 8   NIFEFLEYSLHNYILIVKKSINGLVVKIVKSKLKEILSFLKNNEFCCFKMLLDIYAIDFL 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R+NRF + Y   S KYN  L ++ ++ E  SV SI  +Y   +W EREVWDM GIFF+ 
Sbjct: 68  QRANRFVLNYLLRSLKYNYFLTLQFSLNENSSVDSITYLYKNGNWVEREVWDMNGIFFDN 127

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPDLRRILTDYGFEG PLRKDFP++GF E+ YDD  K+++   +EL QE R ++F SPW+
Sbjct: 128 HPDLRRILTDYGFEGFPLRKDFPISGFKEIRYDDSQKRIISEQIELAQEFRLFNFESPWK 187


>gi|71990788|ref|NP_491881.2| NADH Ubiquinone Oxidoreductase family member (nuo-2)
           [Caenorhabditis elegans]
 gi|51988139|gb|AAB52474.2| Nadh ubiquinone oxidoreductase protein 2, isoform a, confirmed by
           transcript evidence [Caenorhabditis elegans]
          Length = 445

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 117/186 (62%), Gaps = 5/186 (2%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           ++ + G Y       F   V+FA     EL L +    +V + SFL+ +    F N+  +
Sbjct: 231 RLANFGKYAAECLPKFVQKVQFAAGD--ELELLIHPSGVVPVLSFLKGNHSAQFTNLTFI 288

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G+D  +R NR +V+Y   S ++N R+RV+    E   + S   ++ GADWFEREV+DMY
Sbjct: 289 TGMDVPTRKNRLEVIYSLYSVRFNARVRVRTYTDEIAPIDSATPVFKGADWFEREVYDMY 348

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G++F  HPDLRRILTDYGFEGHP RKD+P++G+ E+ YD ++K+VVY P EL QE R +D
Sbjct: 349 GVWFNNHPDLRRILTDYGFEGHPFRKDYPLSGYNEVRYDPELKRVVYEPSELAQEFRKFD 408

Query: 181 FLSPWE 186
             +PWE
Sbjct: 409 LNTPWE 414


>gi|268568132|ref|XP_002640168.1| C. briggsae CBR-NUO-2 protein [Caenorhabditis briggsae]
 gi|187029272|emb|CAP31615.1| CBR-NUO-2 protein [Caenorhabditis briggsae AF16]
          Length = 399

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 118/186 (63%), Gaps = 5/186 (2%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           ++ + G Y       F   V+FA     EL L +    +V + SFL+ +    F N+  +
Sbjct: 186 RLANFGKYAAECLPKFVQKVQFAAGD--ELELLIHPSGVVPVLSFLKGNHSAQFTNLTFI 243

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G+D  +R NR +V+Y   S ++N R+RV+    E   + S+  ++ GADW+EREV+DMY
Sbjct: 244 TGMDVPTRKNRLEVIYALYSVRFNARVRVRTYTDEIAPIDSVTPVFKGADWYEREVYDMY 303

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G++F  HPDLRRILTDYGFEGHP RKD+P++G+ E+ YD ++K+VVY P E+ QE R +D
Sbjct: 304 GVWFNNHPDLRRILTDYGFEGHPFRKDYPLSGYNEVRYDPELKRVVYEPSEMAQEFRKFD 363

Query: 181 FLSPWE 186
             SPWE
Sbjct: 364 LNSPWE 369


>gi|218679173|ref|ZP_03527070.1| NADH dehydrogenase subunit C [Rhizobium etli CIAT 894]
          Length = 120

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 91/117 (77%)

Query: 81  PKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
           PK N R+RVK+A  E   VPS   ++PGADWFERE WDMYG+ F GHPDLRRILTDYGFE
Sbjct: 1   PKQNLRIRVKVATDEDTPVPSACAVHPGADWFERETWDMYGVLFTGHPDLRRILTDYGFE 60

Query: 141 GHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           GHPLRKDFP TGFVE+ YDD  K+VVY PVEL QE R++DF+SPWEG + +   ++ 
Sbjct: 61  GHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFDFMSPWEGTDYVLPGDEK 117


>gi|299507926|emb|CBN88264.1| NADH dehydrogenase subunit 9 [Asplenium nidus]
          Length = 226

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (71%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FLR   +  F  +ID+CGVD+ S+  RF VVY+ LS +YN R+R++I V E   
Sbjct: 38  LFQLPWFLRCHTNTRFGILIDICGVDYPSQKRRFGVVYNLLSIQYNSRIRIRIGVDEITP 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           V S++ I+P A W+EREVWDM+G+ F  H DLRRILTDYGFEGHPLRKDFP++G+ E+ Y
Sbjct: 98  VSSVISIFPSAGWWEREVWDMFGLIFSHHHDLRRILTDYGFEGHPLRKDFPLSGYAEVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  PVE+ QE R +D  SPW+
Sbjct: 158 DDSEKRVVSEPVEMTQEFRYFDLASPWQ 185


>gi|32563621|ref|NP_871796.1| NADH Ubiquinone Oxidoreductase family member (nuo-2)
           [Caenorhabditis elegans]
 gi|27670051|gb|AAO21397.1| Nadh ubiquinone oxidoreductase protein 2, isoform b, confirmed by
           transcript evidence [Caenorhabditis elegans]
          Length = 268

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 117/186 (62%), Gaps = 5/186 (2%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           ++ + G Y       F   V+FA     EL L +    +V + SFL+ +    F N+  +
Sbjct: 54  RLANFGKYAAECLPKFVQKVQFAAGD--ELELLIHPSGVVPVLSFLKGNHSAQFTNLTFI 111

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G+D  +R NR +V+Y   S ++N R+RV+    E   + S   ++ GADWFEREV+DMY
Sbjct: 112 TGMDVPTRKNRLEVIYSLYSVRFNARVRVRTYTDEIAPIDSATPVFKGADWFEREVYDMY 171

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G++F  HPDLRRILTDYGFEGHP RKD+P++G+ E+ YD ++K+VVY P EL QE R +D
Sbjct: 172 GVWFNNHPDLRRILTDYGFEGHPFRKDYPLSGYNEVRYDPELKRVVYEPSELAQEFRKFD 231

Query: 181 FLSPWE 186
             +PWE
Sbjct: 232 LNTPWE 237


>gi|258575169|ref|XP_002541766.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Uncinocarpus
           reesii 1704]
 gi|237902032|gb|EEP76433.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Uncinocarpus
           reesii 1704]
          Length = 288

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 123/189 (65%), Gaps = 1/189 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +++   G Y+++     ++       EL++ +    ++ + SFL+D     +  + D+  
Sbjct: 75  KELHTYGQYLMSCLPKYIQQFSVWKDELTIYIPPAGVIPVISFLKDHTAAEYKQVSDITA 134

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VDF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA W+EREV+D++G+
Sbjct: 135 VDFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGAVWYEREVYDLFGV 194

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-F 181
           FF GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+EL Q  R+++  
Sbjct: 195 FFVGHPDLRRIMTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGG 254

Query: 182 LSPWEGVNS 190
            S WE V  
Sbjct: 255 TSAWEQVGQ 263


>gi|259487070|tpe|CBF85447.1| TPA: NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           [Precursor] (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 290

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 119/187 (63%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G YI+      V+       EL + V    ++   +FL+      F  + D+  VD
Sbjct: 79  LHQYGQYIMACLPKHVQQFSVWKDELCIYVPPSGIIPTFTFLKYHTSAEFTTVSDITAVD 138

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + ++  RF+VVY+ LS +YN R+RVK    E   VPSI G+Y GA W+EREV+D++G+FF
Sbjct: 139 YPTKDQRFEVVYNLLSVRYNSRIRVKTYADEASPVPSITGLYEGALWYEREVYDLFGVFF 198

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++ K++V  P+EL Q  R+++   +
Sbjct: 199 TGHPDLRRIMTDYGFDGHPLRKDFPMTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTT 258

Query: 184 PWEGVNS 190
            WE V +
Sbjct: 259 AWEPVGA 265


>gi|330813984|ref|YP_004358223.1| NADH-ubiquinone oxidoreductase chain C [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487079|gb|AEA81484.1| NADH-ubiquinone oxidoreductase chain C [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 117/168 (69%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRV 89
           L L+ D  +++     L+  P   F  +ID+ GVD+  +S RF+V+Y FLS + N R+ +
Sbjct: 30  LILNCDVDNIIHNIDILKRSPEFKFRQLIDILGVDYPQQSKRFEVIYLFLSHENNFRISL 89

Query: 90  KIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           KI + + + VP++  I+P A+W EREV+DMYGI F  HPDLRRILTDY FEG+PLRKDFP
Sbjct: 90  KIKIGDEEIVPTLTDIFPSANWQEREVFDMYGIRFADHPDLRRILTDYEFEGYPLRKDFP 149

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDS 197
           +TG+ E+ Y  + +KV+Y PV+L Q++RD++F SPWEG   +  ++D 
Sbjct: 150 LTGYKEVRYSAEHQKVIYEPVKLAQDYRDFNFESPWEGSEYIKKEQDK 197


>gi|58257421|gb|AAW69332.1| NADH-ubiquinone oxidoreductase-like protein [Magnaporthe grisea]
          Length = 291

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 114/161 (70%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + +FL+ +    F  + D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 104 ELTIYICPSGVIPVFNFLKYNTSAEFTTVSDITAVDFPTRDQRFEIVYNLLSVRHNARIR 163

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  IY GA+W+EREV+DM+G+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 164 VKTYADEASPVPSICSIYDGANWYEREVYDMFGVFFVGHPDLRRIMTDYGFEGHPLRKDF 223

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V
Sbjct: 224 PLTGYTEVRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEQV 264


>gi|119193969|ref|XP_001247588.1| hypothetical protein CIMG_01359 [Coccidioides immitis RS]
 gi|303311651|ref|XP_003065837.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|111606571|gb|ABH10650.1| NADH-ubiquinone oxidoreductase subunit [Coccidioides posadasii]
 gi|240105499|gb|EER23692.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320039733|gb|EFW21667.1| NADH-ubiquinone oxidoreductase 30 kDa subunit [Coccidioides
           posadasii str. Silveira]
          Length = 287

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 124/189 (65%), Gaps = 1/189 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +++   G+Y+++     ++       EL++ +    ++ + SFL+D     +  + D+  
Sbjct: 75  KELHTYGEYLMSCLPKYIQQFSVWKDELTIYIPPTGVIPVISFLKDHTAAEYKQVSDITA 134

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VDF +R  RF+VVY+ LS ++N R+RVK    E   VPSI  +Y GA W+EREV+D++G+
Sbjct: 135 VDFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGAVWYEREVYDLFGV 194

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-F 181
           FF GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+EL Q  R+++  
Sbjct: 195 FFVGHPDLRRIMTDYGFDGHPLRKDFPLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGG 254

Query: 182 LSPWEGVNS 190
            S WE +  
Sbjct: 255 TSAWEQIGQ 263


>gi|34765759|gb|AAQ82457.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Armillariella
           tabescens]
          Length = 270

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 106/161 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL+L      ++ + +FLRD   C F +++D+ G D+  R  RF+VVYH LS K   R+R
Sbjct: 86  ELTLYTAPSGIIPVLTFLRDHAQCQFKSVVDISGADYPDREKRFEVVYHLLSVKQAGRIR 145

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    EG  VPS V  + GADW+ERE WD++GI F  HPDLRRILTDYGFEG    K  
Sbjct: 146 VKTYAGEGDHVPSAVKSFRGADWYEREAWDLFGISFSDHPDLRRILTDYGFEGTLYAKTS 205

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P+TG+ EL  D++ K+VVY P++L Q  R+++ LSPWE V 
Sbjct: 206 PLTGYTELRCDEERKRVVYEPLQLTQAFRNFESLSPWEQVG 246


>gi|73666916|ref|YP_302932.1| NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia canis str.
           Jake]
 gi|72394057|gb|AAZ68334.1| NADH dehydrogenase subunit C [Ehrlichia canis str. Jake]
          Length = 192

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 114/174 (65%)

Query: 17  SGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVY 76
           S +V+  +     L L+ +  D+ S   FLR+D  C F  +ID+  +D+ SR  RF+VVY
Sbjct: 18  SINVKCTIKDSINLELNSNVNDIYSHILFLRNDTKCKFHILIDIFAIDYPSRPARFEVVY 77

Query: 77  HFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTD 136
             LS   N R+  K+ + E +S+PSI  ++  A WFEREV+DMYGI F  +PDLRRILTD
Sbjct: 78  SLLSIINNIRIFCKVPLQENESIPSITNLFSAAGWFEREVFDMYGIIFANNPDLRRILTD 137

Query: 137 YGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           YGF GHP+ KDFP+TG+ E+ YD   K+V Y  V L Q+ R +DFLSPW+ V++
Sbjct: 138 YGFSGHPMLKDFPLTGYKEVRYDILKKEVTYEAVNLQQDFRSFDFLSPWKEVSN 191


>gi|150406474|ref|YP_001315138.1| NADH dehydrogenase subunit 9 [Chlorokybus atmophyticus]
 gi|126507711|gb|ABO15108.1| NADH dehydrogenase subunit 9 [Chlorokybus atmophyticus]
          Length = 227

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            E+ +  D   +V    FLRD        ++D+CGVD+ SR +RF+VVY+ L+ +YN R+
Sbjct: 58  NEMIIYTDPEYIVPFLFFLRDHMGTQVKILLDICGVDYPSRKDRFEVVYNLLTIQYNSRI 117

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           R+K  V E   V S+V ++  A W+EREVWD++GIFF  HPDLRRILTDYGFEGHPLRKD
Sbjct: 118 RIKTCVDEITPVSSVVSVFNSAAWWEREVWDLFGIFFSNHPDLRRILTDYGFEGHPLRKD 177

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSL 191
           FP++G+VE+ YDD  K+VV   +E+ QE R +DF SPWE ++ +
Sbjct: 178 FPLSGYVEVRYDDAEKRVVSESIEMAQEFRYFDFSSPWEDIDKM 221


>gi|11497471|ref|NP_042261.1| NADH dehydrogenase (ubiquinone), subunit 9 [Prototheca wickerhamii]
 gi|6647673|sp|Q37622|NDUS3_PROWI RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
 gi|467862|gb|AAD12649.1| NADH dehydrogenase (ubiquinone), subunit 9 [Prototheca wickerhamii]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 114/175 (65%), Gaps = 2/175 (1%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           +++ V+   E +  V    L     FLRD     +   ID+   D+ SR++RF+ VY+ L
Sbjct: 17  IQYHVSHRNETTFYVYPEYLKPFLYFLRDHMSTQYKVCIDITAADYPSRASRFECVYNLL 76

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
           S +YN R+R+K  V E  ++ S+  +Y  A W+EREVWDM+G+FF  HPDLRRILTDYGF
Sbjct: 77  SVEYNSRIRIKTCVDEITTLESVTPVYSSAAWWEREVWDMFGVFFHNHPDLRRILTDYGF 136

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV--NSLF 192
           +GHPLRKDFP++G+VE+ YDD  K+V    VE  QE R +DF SPWE V  NSL 
Sbjct: 137 QGHPLRKDFPLSGYVEVRYDDSEKRVCIESVEYSQEFRYFDFESPWEQVDKNSLL 191


>gi|326387460|ref|ZP_08209069.1| NADH dehydrogenase, subunit C [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208116|gb|EGD58924.1| NADH dehydrogenase, subunit C [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 117/180 (65%), Gaps = 10/180 (5%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LGD IV S            GE+ L V   ++ ++   LRD     F  ++D+ GVD+ S
Sbjct: 25  LGDVIVAS--------KEEHGEIVLTVKRDEIENVLRTLRDKEQ--FQQLMDIAGVDYPS 74

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R+ RF+VVY  LS   N RL VK++  E   VP++  ++P A W+ERE +D+YG+ F G+
Sbjct: 75  RAERFEVVYCLLSVTRNLRLIVKVSTDEATPVPTVTTLWPNAGWYEREAYDLYGVLFAGN 134

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
            DLRRILTDYGF+GHP RKDFP+TG+VEL Y ++ ++VVY PV L Q+ R +D+ SPWEG
Sbjct: 135 TDLRRILTDYGFQGHPFRKDFPLTGYVELRYSEEDQRVVYEPVRLAQDLRQFDYQSPWEG 194


>gi|1020087|dbj|BAA07214.1| NADH dehydrogenase subunit 9 [Beta trigyna]
          Length = 192

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 108/157 (68%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++ +
Sbjct: 32  DTNTDYPFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|313227735|emb|CBY22884.1| unnamed protein product [Oikopleura dioica]
          Length = 289

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 116/185 (62%), Gaps = 2/185 (1%)

Query: 4   KIEDLGDYIVNSFSGSVRF-AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           K+ + G YI       V+   V    EL + +    +  + SFL+D     F ++ D+  
Sbjct: 72  KLANFGAYIAQVLPKYVQLVQVTDQNELEICIHPAGIRPVHSFLKDHSLARFESMSDMTA 131

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG-IYPGADWFEREVWDMYG 121
           VD  +R NRF++VY  LS  +N R+R+K    E   V S+   ++P  +W+ERE WDMYG
Sbjct: 132 VDVPNRQNRFEMVYCLLSTHFNARIRIKSYTNELNPVDSLAADLFPSCNWYERECWDMYG 191

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           ++F GHPDLRRILTDYGF+GHP RKDFP+TG+ E+ YDD + +VV  P+EL QE+R +D 
Sbjct: 192 VYFNGHPDLRRILTDYGFQGHPQRKDFPLTGYYEVRYDDDLMRVVQEPLELAQEYRKFDL 251

Query: 182 LSPWE 186
            +PWE
Sbjct: 252 KNPWE 256


>gi|156060183|ref|XP_001596014.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Sclerotinia sclerotiorum 1980]
 gi|154699638|gb|EDN99376.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 292

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL + +    ++ + SFL+ +    F  + D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 105 ELVIYISPSGVIPVFSFLKYNTAAEFTQVSDITAVDFPTRDQRFEIVYNLLSVRHNSRIR 164

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   VPSI  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 165 IKTYADEASPVPSICSLYDGANWYEREVYDLFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 224

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   + WE V S
Sbjct: 225 PLTGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGTAAWEQVGS 267


>gi|54606793|dbj|BAD66816.1| NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 107/157 (68%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+  
Sbjct: 32  DTNTDYPFKLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTC 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|121699646|ref|XP_001268091.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus clavatus NRRL 1]
 gi|119396233|gb|EAW06665.1| NADH-ubiquinone oxidoreductase 304 kDa subunit precursor
           [Aspergillus clavatus NRRL 1]
          Length = 286

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 120/185 (64%), Gaps = 1/185 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     V+       EL++ V    ++ + +FL+      +  I D+  VD
Sbjct: 75  LHKYGQYVMSCLPKYVQQFSVWKDELTIYVPPSGIIPVMTFLKYHTAAEYTQISDITAVD 134

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           F +R  RF+VVY+ LS +YN R+RVK    E   VPS+ G++ GA W+EREV+DM+G+FF
Sbjct: 135 FPTRDQRFEVVYNMLSVRYNSRIRVKTYADEASPVPSVTGLFEGALWYEREVYDMFGVFF 194

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS- 183
             HPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+EL Q  R+++  + 
Sbjct: 195 SNHPDLRRIMTDYGFDGHPLRKDFPLTGYTEVRYDEEKKRIVIEPLELTQAFRNFEGGTV 254

Query: 184 PWEGV 188
            WE V
Sbjct: 255 AWEPV 259


>gi|302499495|ref|XP_003011743.1| hypothetical protein ARB_01971 [Arthroderma benhamiae CBS 112371]
 gi|291175296|gb|EFE31103.1| hypothetical protein ARB_01971 [Arthroderma benhamiae CBS 112371]
          Length = 174

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/149 (51%), Positives = 106/149 (71%), Gaps = 1/149 (0%)

Query: 43  CSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSI 102
            +FLRD     +  + D+  VDF +R  RF+VVY+ LS ++N R+RVK    E   VPSI
Sbjct: 1   MTFLRDHTAAEYTQVSDITAVDFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSI 60

Query: 103 VGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKV 162
             +Y GA WFEREV+DM+G+FF GHPDLRRI+TDYGF+GHPLRKDFP++G+ E+ YD++ 
Sbjct: 61  TSLYDGALWFEREVYDMFGVFFTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEK 120

Query: 163 KKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           K++V  P+EL Q  R+++   S WEG+  
Sbjct: 121 KRIVVEPLELTQAFRNFEGGSSAWEGIGQ 149


>gi|171682350|ref|XP_001906118.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941134|emb|CAP66784.1| unnamed protein product [Podospora anserina S mat+]
          Length = 286

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + SFL+ +    F  + D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 100 ELTIYICPSGVIPVFSFLKYNTSAEFTMVSDITAVDFPTRDQRFEIVYNLLSIRHNSRIR 159

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+DM+G+FF  HPDLRRI+TDYGFEGHPLRKDF
Sbjct: 160 VKTYADEASPVPSLTPLYDGANWYEREVYDMFGVFFVNHPDLRRIMTDYGFEGHPLRKDF 219

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V S
Sbjct: 220 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEQVGS 262


>gi|302407618|ref|XP_003001644.1| NADH dehydrogenase iron-sulfur protein [Verticillium albo-atrum
           VaMs.102]
 gi|261359365|gb|EEY21793.1| NADH dehydrogenase iron-sulfur protein [Verticillium albo-atrum
           VaMs.102]
          Length = 284

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 113/161 (70%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + SFL+ +    F  +  +  VD+ +R  RF+++Y+ LS +YN R+R
Sbjct: 100 ELTIYIPPSGVIPVISFLKYNTSAEFTQVSTVTAVDYPTRDQRFEIIYNLLSVRYNSRIR 159

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI G++ GA+W+ERE +D++GIFF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 160 VKTYADEVSPVPSITGLFDGANWYEREAYDLFGIFFVGHPDLRRIMTDYGFEGHPLRKDF 219

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ +D++ K++V  P+EL Q  R+++   S WE +
Sbjct: 220 PLTGYTEIRFDEEKKRIVTEPLELTQAFRNFEGGTSAWEQI 260


>gi|224143075|ref|XP_002335983.1| predicted protein [Populus trichocarpa]
 gi|222837161|gb|EEE75540.1| predicted protein [Populus trichocarpa]
          Length = 190

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/154 (51%), Positives = 107/154 (69%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +     +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNSDYLFQLLCFLKFHTYTRVQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRIFPVVSLFPSAGRWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|1020088|dbj|BAA07215.1| NADH dehydrogenase subunit 9 [Beta webbiana]
          Length = 192

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 108/157 (68%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++ +
Sbjct: 32  DTNTDYPFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G
Sbjct: 92  ADEVTRISPVVRLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|332375566|gb|AEE62924.1| unknown [Dendroctonus ponderosae]
          Length = 253

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 5/185 (2%)

Query: 5   IEDLGDYI---VNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++ G Y+   +  F   V+F  N   EL + V    L+    FL+D  +     ++++C
Sbjct: 48  LKEFGAYVNECLPKFVQKVQF--NHCKELEIMVAPDGLLPTMQFLKDHHNSQMECLMEVC 105

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            +D   R  RF+++Y+ LS +Y  R+RVK    E   + S+ GIY  ADW EREVWD++G
Sbjct: 106 AIDVPGRVFRFELIYNLLSLRYKSRIRVKTYTDEVTPIDSVTGIYKSADWPEREVWDLHG 165

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           +FF  HPDLRRILTDYGF+GHPLRKDFP++G+ E  YDD+ K+VV  PVE  QE R +D 
Sbjct: 166 VFFANHPDLRRILTDYGFDGHPLRKDFPLSGYYESRYDDEKKRVVLEPVEFAQEFRQFDL 225

Query: 182 LSPWE 186
            SPWE
Sbjct: 226 SSPWE 230


>gi|15054572|gb|AAK82657.1|AF276428_1 NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
          Length = 206

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 80/149 (53%), Positives = 105/149 (70%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+    E   + 
Sbjct: 40  QLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTCADEVTRIS 99

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD
Sbjct: 100 PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDD 159

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
             K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 160 PEKRVVSEPIEMTQELRYFDFASPWEQGN 188


>gi|39951381|ref|XP_363407.1| hypothetical protein MGG_01333 [Magnaporthe oryzae 70-15]
 gi|145020847|gb|EDK04976.1| hypothetical protein MGG_01333 [Magnaporthe oryzae 70-15]
          Length = 291

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 113/161 (70%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + +FL+ +    F  + D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 104 ELTIYICPSGVIPVFNFLKYNTSAEFTTVSDITAVDFPTRDQRFEIVYNLLSVRHNARIR 163

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  IY GA+W+EREV+DM+G+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 164 VKTYADEASPVPSICSIYDGANWYEREVYDMFGVFFVGHPDLRRIMTDYGFEGHPLRKDF 223

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ Y ++ K++V  P+EL Q  R+++   S WE V
Sbjct: 224 PLTGYTEVRYHEEKKRIVTEPLELTQAFRNFEGGSSAWEQV 264


>gi|742345|prf||2009372A NADH dehydrogenase:SUBUNIT=9
          Length = 192

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 107/157 (68%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+R++  
Sbjct: 32  DTNTDYPFQLLCFLKLHTYTRFQVLIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRLQTC 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE  N
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRN 188


>gi|322710830|gb|EFZ02404.1| NADH-ubiquinone oxidoreductase-like protein [Metarhizium anisopliae
           ARSEF 23]
          Length = 281

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 112/161 (69%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + +FL+ +    F  +  +   DF +R  RF+VVY+ LS ++N R+R
Sbjct: 95  ELTIYISPSGVIPVFTFLKYNTSAEFTQMSTITACDFPTRDKRFEVVYNLLSVRHNSRIR 154

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 155 VKTYADEASPVPSVTSLYDGANWYEREVYDLFGVFFAGHPDLRRIMTDYGFEGHPLRKDF 214

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V
Sbjct: 215 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEMV 255


>gi|85086366|ref|XP_957689.1| NADH:ubiquinone oxidoreductase 30.4kD subunit [Neurospora crassa
           OR74A]
 gi|67477363|sp|P23710|NDUS3_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 30.4 kDa subunit,
           mitochondrial; AltName: Full=CI-31kD; AltName:
           Full=Complex I-30kD; Flags: Precursor
 gi|28918783|gb|EAA28453.1| NADH:ubiquinone oxidoreductase 30.4kD subunit [Neurospora crassa
           OR74A]
          Length = 283

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 115/163 (70%), Gaps = 1/163 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + SFL+ +    +  + D+  VDF ++  RF+VVY+ LS ++N R+R
Sbjct: 97  ELTIYISPAGVIPVFSFLKYNTAAEYTQVSDITAVDFPTKDQRFEVVYNLLSVRHNSRIR 156

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 157 VKTYADEVSPVPSITPLYDGANWYEREVYDLFGVFFTGHPDLRRIMTDYGFDGHPLRKDF 216

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
           P+TG+ E+ YD++ K++V  P+E+ Q  R+++   S WE V +
Sbjct: 217 PMTGYTEIRYDEEKKRIVTEPLEMTQAFRNFEGGSSAWEQVGA 259


>gi|84508576|ref|YP_448624.1| NADH dehydrogenase subunit 9 [Fucus vesiculosus]
 gi|39653299|gb|AAR29318.1| NADH dehydrogenase subunit 9 [Fucus vesiculosus]
          Length = 191

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/157 (47%), Positives = 107/157 (68%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ ++V    L++   FL    +  +  +  + GVD+  R  RF++VY  L+ + N R+R
Sbjct: 27  EIVINVSKKYLLATLMFLHHHSNSNYQLLTSISGVDYPERDERFEIVYDLLNIRSNSRIR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   +PS+V IYP A+W+ERE+WD++G+FF GHPDLRR+LTDYGFEGHPLRKDF
Sbjct: 87  IKTQTDEINPLPSVVSIYPSANWWEREIWDLFGVFFSGHPDLRRLLTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           P++G+ EL YD+  + VV  P+EL QE R +DF  PW
Sbjct: 147 PLSGYFELRYDEDQRVVVCEPIELTQEFRTFDFHIPW 183


>gi|68171627|ref|ZP_00544994.1| NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88658220|ref|YP_507586.1| NADH dehydrogenase I, C subunit [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67998948|gb|EAM85632.1| NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599677|gb|ABD45146.1| NADH dehydrogenase I, C subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 192

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 115/182 (63%), Gaps = 2/182 (1%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I+++  YI  S +  V   +     L L  D  ++ +  SFLR D  C F  ++D+  +D
Sbjct: 8   IDNISTYINTSIN--VECVIKDNITLELHSDVQNIYNHISFLRTDTKCKFHILVDIFAID 65

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + +R  RF+V+Y  LS   N R+  K+ + E +S+PSI  I+  A WFEREV+DMYGI F
Sbjct: 66  YPTRLARFEVIYSLLSIINNIRVSCKVPLQENESIPSITNIFSAAGWFEREVFDMYGIIF 125

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
             +PDLRRILTDYGF GHP+ KDFP+TG+ E+ YD   K+V Y  V L Q+ R +DFLSP
Sbjct: 126 ANNPDLRRILTDYGFSGHPMLKDFPLTGYKEVRYDISKKEVAYENVNLQQDFRSFDFLSP 185

Query: 185 WE 186
           W+
Sbjct: 186 WK 187


>gi|58584501|ref|YP_198074.1| NADH:ubiquinone oxidoreductase chain C [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75507999|sp|Q5GT42|NUOC_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|58418817|gb|AAW70832.1| NADH:ubiquinone oxidoreductase chain C [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 190

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 111/155 (71%), Gaps = 3/155 (1%)

Query: 45  FLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG 104
           FLRDD  C F  ++D+ GVD+  R  RF+++Y+ LS  +N R+ +K+ + E    PS+V 
Sbjct: 39  FLRDDEKCRFELLVDIFGVDYPDREKRFELIYNLLSIVHNIRVHIKLQLYEDDMPPSVVR 98

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           I+  A WFEREV+DMYGI F  HPDLRRILTDYGF+GHP+ KDFP+TG+ E+ YD + KK
Sbjct: 99  IFNTASWFEREVFDMYGIEFSNHPDLRRILTDYGFKGHPMLKDFPLTGYEEVRYDIEAKK 158

Query: 165 VVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKD 199
           VVY P++L Q+ R +D LSPWEG     AK ++K+
Sbjct: 159 VVYNPIDLPQDFRMFDSLSPWEGET---AKANTKE 190


>gi|323649874|ref|YP_004237248.1| NADH dehydrogenase subunit 9 [Ricinus communis]
 gi|322394254|gb|ADW96011.1| NADH dehydrogenase subunit 9 [Ricinus communis]
          Length = 190

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNSDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A W+EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGWWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|322698841|gb|EFY90608.1| NADH-ubiquinone oxidoreductase-like protein [Metarhizium acridum
           CQMa 102]
          Length = 282

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 112/161 (69%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++ + +FL+ +    F  +  +   DF +R  RF+VVY+ LS ++N R+R
Sbjct: 95  ELTIYISPSGVIPVFTFLKYNTSAEFTQMSTITACDFPTRDKRFEVVYNLLSVRHNSRIR 154

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGFEGHPLRKDF
Sbjct: 155 VKTYADEASPVPSVTSLYDGANWYEREVYDLFGVFFAGHPDLRRIMTDYGFEGHPLRKDF 214

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V
Sbjct: 215 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEMV 255


>gi|256088184|ref|XP_002580233.1| NADH-ubiquinone oxidoreductase [Schistosoma mansoni]
 gi|238665758|emb|CAZ36472.1| NADH-ubiquinone oxidoreductase mitochondrial precursor, putative
           [Schistosoma mansoni]
          Length = 270

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 121/200 (60%), Gaps = 2/200 (1%)

Query: 2   VRKIEDLGDYIVNSFSGSV-RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           + ++   G Y+       V +  +    EL + +    ++ + SFL+   +  F+N+ D+
Sbjct: 50  IERLSSFGVYVGECLPKFVQKVQIGHTKELEICIHPDGIIPVLSFLKCHHNAQFLNLSDI 109

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
             VD  SR  RF +VY+ LS +YN R+RV     E   + S   I+  ++W+EREVWDMY
Sbjct: 110 TAVDIPSRKYRFQIVYNLLSLRYNSRIRVLTYTDELTPIDSSCSIFQASNWYEREVWDMY 169

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           G+FF  HPDLRRILTDYGF GHP R+DFP++G+ E+ YDD+  +VV  PVEL QE R ++
Sbjct: 170 GVFFHDHPDLRRILTDYGFIGHPQRRDFPLSGYTEMRYDDQYYRVVIEPVELAQEFRRFE 229

Query: 181 FLSPWEGVNSLFAKEDSKDD 200
           F SPWE   + F    S+D+
Sbjct: 230 FNSPWEAFPA-FRDSSSQDE 248


>gi|310799531|gb|EFQ34424.1| NADH dehydrogenase [Glomerella graminicola M1.001]
          Length = 286

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 113/161 (70%), Gaps = 1/161 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ V    ++ + +FL+ +    F  I D+  VD+ +R  RF+V+Y+ LS ++N R+R
Sbjct: 99  ELTIYVSPSGIIPIMTFLKYNTSAEFTQISDITAVDYPTRDQRFEVIYNLLSVRHNSRIR 158

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  ++ GA+W+EREV+D++G+FF  HPDLRRI+TDYGFEGHPLRKDF
Sbjct: 159 VKTYADEASPVPSVTPLFDGANWYEREVYDLFGVFFTDHPDLRRIMTDYGFEGHPLRKDF 218

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGV 188
           P+TG+ E+ YD++ K++V  P+EL Q  R+++   S WE V
Sbjct: 219 PLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEQV 259


>gi|255590759|ref|XP_002535359.1| NADH-ubiquinone oxidoreductase mitochondrial precursor, putative
           [Ricinus communis]
 gi|223523367|gb|EEF27025.1| NADH-ubiquinone oxidoreductase mitochondrial precursor, putative
           [Ricinus communis]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 11  DTNSDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 70

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A W+EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 71  ADEVTRISPVVSLFPSAGWWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 130

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 131 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 164


>gi|186920123|ref|YP_001874777.1| NADH dehydrogenase subunit 9 [Hemiselmis andersenii]
 gi|186461069|gb|ACC78231.1| NADH dehydrogenase subunit 9 [Hemiselmis andersenii]
          Length = 186

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 115/177 (64%), Gaps = 4/177 (2%)

Query: 13  VNSFSGSVRFAVNSV----GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR 68
           +NS    ++++V  +    GE+ ++V+   L  + +FL+   +C +  ++D+  +D    
Sbjct: 6   LNSLYKILKYSVICIYYNFGEVVIEVEYNKLKKVIAFLKGHENCLYKLLVDIVVIDCPEN 65

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHP 128
             RF +VY   S KYN R++V   V E   V SI  +Y  A W ERE WDMYGI+FEGHP
Sbjct: 66  PLRFKIVYLLCSVKYNLRIKVVTRVDEITPVSSITDLYKNAGWMEREGWDMYGIYFEGHP 125

Query: 129 DLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           DLRRILTDYGFEG+PLRKDFP++G+ E+ YDD  K+V++ P+E+ QE R Y F SPW
Sbjct: 126 DLRRILTDYGFEGYPLRKDFPLSGYKEVRYDDSQKRVIFEPLEMSQEFRIYQFTSPW 182


>gi|325303432|tpg|DAA34135.1| TPA_exp: NADH-ubiquinone oxidoreductase NDUFS3 30 kDa subunit
           [Amblyomma variegatum]
          Length = 217

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/159 (49%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           K+ED G Y+       V+    + G EL + +    +V + SFL+D  +  + NI+D+CG
Sbjct: 59  KLEDFGRYVAECLPKYVQKVQITPGDELEVMIAPEGIVPVLSFLKDHQNAQYTNIVDICG 118

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           VD  +R  RF+VVYH LS  +N R+RVK    E   + S   ++ GA+W+EREVWDMYG+
Sbjct: 119 VDVPTRQYRFEVVYHLLSVHFNSRIRVKTYTDELTPLDSATAVFKGANWYEREVWDMYGV 178

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDK 161
           FF  HPDLRRILTDYGFEGHP RKDFP++G+VE+ YDD+
Sbjct: 179 FFGNHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDE 217


>gi|99034973|ref|ZP_01314776.1| hypothetical protein Wendoof_01000399 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 190

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 105/143 (73%)

Query: 45  FLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG 104
           FLRDD  C F  ++D+ GVD+ +R  RF+++Y+ LS  +N R+ +K+ + E    PS+  
Sbjct: 39  FLRDDKKCRFELLVDIFGVDYPNREKRFELIYNLLSIVHNIRVHIKLQLCESDMPPSVAK 98

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           I+  A WFEREV+DMYGI F  HPDLRRILTDYGF+GHP+ KDFP+TG+ E+ YD + KK
Sbjct: 99  IFSTALWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEEVRYDIETKK 158

Query: 165 VVYRPVELMQEHRDYDFLSPWEG 187
           VVY P++L Q+ R +D LSPWEG
Sbjct: 159 VVYNPIDLPQDFRMFDSLSPWEG 181


>gi|42520926|ref|NP_966841.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225631315|ref|ZP_03787990.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|42410667|gb|AAS14775.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225590990|gb|EEH12197.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 190

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 105/143 (73%)

Query: 45  FLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG 104
           FLRDD  C F  ++D+ GVD+ +R  RF+++Y+ LS  +N R+ +K+ + E    PS+  
Sbjct: 39  FLRDDEKCRFELLVDIFGVDYPNREKRFELIYNLLSIVHNIRVHIKLQLCESDMPPSVAK 98

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           I+  A WFEREV+DMYGI F  HPDLRRILTDYGF+GHP+ KDFP+TG+ E+ YD + KK
Sbjct: 99  IFSTALWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEEVRYDIETKK 158

Query: 165 VVYRPVELMQEHRDYDFLSPWEG 187
           VVY P++L Q+ R +D LSPWEG
Sbjct: 159 VVYNPIDLPQDFRMFDSLSPWEG 181


>gi|58698297|ref|ZP_00373214.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630973|ref|YP_002727764.1| NADH dehydrogenase I, C subunit [Wolbachia sp. wRi]
 gi|58535170|gb|EAL59252.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592954|gb|ACN95973.1| NADH dehydrogenase I, C subunit [Wolbachia sp. wRi]
          Length = 190

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 105/143 (73%)

Query: 45  FLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG 104
           FLRDD  C F  ++D+ GVD+ +R  RF+++Y+ LS  +N R+ +K+ + E    PS+  
Sbjct: 39  FLRDDEKCRFELLVDIFGVDYPNREKRFELIYNLLSIVHNIRVHIKLQLCESDMPPSVAK 98

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           I+  A WFEREV+DMYGI F  HPDLRRILTDYGF+GHP+ KDFP+TG+ E+ YD + KK
Sbjct: 99  IFSTALWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEEVRYDIETKK 158

Query: 165 VVYRPVELMQEHRDYDFLSPWEG 187
           VVY P++L Q+ R +D LSPWEG
Sbjct: 159 VVYNPIDLPQDFRMFDSLSPWEG 181


>gi|15150743|ref|NP_150409.1| NADH dehydrogenase subunit 9 [Pylaiella littoralis]
 gi|15147749|emb|CAC50850.1| NADH dehydrogenase subunit 9 [Pylaiella littoralis]
          Length = 190

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L+   +FL    +  F  +  + GVDF  R  RF+VVY  L+ + N RLR
Sbjct: 27  EIVISVSKNHLLGTLTFLHHHSNGNFQMLTSISGVDFPEREERFEVVYDLLNVRSNSRLR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           V+    E   +PSI  ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  VRTHTDEINPLPSITSLFPSANWWEREIWDLFGVFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           P++G+ EL YD+  K VV   +EL QE R +DF  PW
Sbjct: 147 PLSGYFELRYDEDQKVVVCESIELSQEFRTFDFHMPW 183


>gi|254796792|ref|YP_003081629.1| NADH-quinone oxidoreductase chain c 1 [Neorickettsia risticii str.
           Illinois]
 gi|254590039|gb|ACT69401.1| NADH-quinone oxidoreductase chain c 1 [Neorickettsia risticii str.
           Illinois]
          Length = 186

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 121/185 (65%), Gaps = 4/185 (2%)

Query: 17  SGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVY 76
           +  V   +N+  + +++     LV L S+L     C F  +ID+ G+D+L R  R +VVY
Sbjct: 5   TSKVDALINAPEKCTVNSSLESLVELISYLS---SCGFEQLIDIFGIDYLEREKRIEVVY 61

Query: 77  HFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
             L+ K NRR  VK++V    + VP+  G++  A+WFEREV+DMYG+ FEGHPDLRRILT
Sbjct: 62  LLLNLKRNRRCCVKVSVDPASEKVPTCCGVFSVANWFEREVYDMYGVVFEGHPDLRRILT 121

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKE 195
           DYGFEG P+ KDFP+TG+ E+ YD + K+VVY  V+L Q++R +D L+PW+G+       
Sbjct: 122 DYGFEGFPMLKDFPLTGYKEVRYDLESKEVVYEKVDLSQDYRSFDSLTPWKGIGHPSGAF 181

Query: 196 DSKDD 200
           D K +
Sbjct: 182 DGKKE 186


>gi|110225715|ref|YP_665720.1| NADH dehydrogenase subunit 9 [Mesostigma viride]
 gi|17222586|gb|AAL36759.1|AF353999_39 NADH dehydrogenase subunit 9 [Mesostigma viride]
          Length = 190

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 28  GELSLDVDCGDLV-SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRR 86
           GE S+ V    ++ S   FLRD        +ID+ GVD+ SR  RF++VY  LS  Y +R
Sbjct: 29  GEWSITVSNETVIDSFFHFLRDTEFAECEMLIDIAGVDYPSRLKRFEIVYQLLSIHYGQR 88

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +RVK+ V E   VPS+  IYP A +FEREVWDMYG+FF  HPDLRRILTDYGFEG+PLRK
Sbjct: 89  IRVKVKVDELSPVPSVTNIYPSAGYFEREVWDMYGVFFSHHPDLRRILTDYGFEGYPLRK 148

Query: 147 DFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           DFP++G+ E+ YD    +V+  P+E+ QE R  +  +PW
Sbjct: 149 DFPLSGYFEVRYDLSKTRVIVEPLEMSQEFRYLETRNPW 187


>gi|319738243|emb|CBJ18019.1| NADH dehydrogenase subunit 9 [Ectocarpus siliculosus]
          Length = 190

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 108/161 (67%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L++  +FL    +  F  +  + GVD+  R  RF++VY  L+ + N R+R
Sbjct: 27  EIVISVAKKHLLATLTFLHHHSNGNFQMLTSISGVDYPEREERFEIVYDLLNVRCNSRIR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   +PS+V ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  IKTHTDEVNPLPSVVSLFPSANWWEREIWDLFGVFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G++EL YD+  + VV  P+EL QE R ++F  PW   N
Sbjct: 147 PLSGYLELRYDEDQRVVVCEPIELSQEFRSFNFHIPWSQNN 187


>gi|80978900|gb|ABB54699.1| NADH dehydrogenase subunit 9 [Brassica oleracea var. botrytis]
          Length = 190

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSFINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|224020983|ref|YP_002608216.1| NADH dehydrogenase subunit 9 [Carica papaya]
 gi|170522395|gb|ACB20505.1| NADH dehydrogenase subunit 9 [Carica papaya]
          Length = 190

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGLSFINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|167585973|ref|ZP_02378361.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ubonensis
           Bu]
          Length = 200

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 114/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     +VGEL+L V   D + + + LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAVGELTLVVKASDYLEVATTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+ +  +      RF  V H LS   N RLRV++   +     VPS+V I+  A+W+
Sbjct: 61  CGLDYQTYGDGAYDGPRFAAVSHLLSVTNNWRLRVRVFAPDDDLPIVPSVVDIWTSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|154274616|ref|XP_001538159.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Ajellomyces capsulatus NAm1]
 gi|150414599|gb|EDN09961.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial
           precursor [Ajellomyces capsulatus NAm1]
          Length = 280

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 112/171 (65%), Gaps = 1/171 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++   +FL+      +  ++D+  VDF  R  RF+VVY+ LS ++N R+R
Sbjct: 101 ELTIYIPPSGVIPTFTFLKQHTAAEYTQVVDITAVDFPGRDQRFEVVYNLLSVRHNSRIR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA W+EREV+D++G+FF  HPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSITCLYDGALWYEREVYDLFGVFFVDHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNSLFAKEDSK 198
           P+TG+ E+ YD++ K++V  P+E+ Q  RD+    S WE +     K  S+
Sbjct: 221 PLTGYTEIRYDEEKKRIVVEPLEMTQAFRDFQGGSSAWEQIGDGIDKTPSE 271


>gi|296419098|ref|XP_002839156.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635162|emb|CAZ83347.1| unnamed protein product [Tuber melanosporum]
          Length = 277

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  ++       +  + D+  VD+ +R NRF+VVY+ LS ++N R+RVK    E   VPS
Sbjct: 104 LTIYIAPSAILPYTQVSDITAVDYPTRINRFEVVYNLLSIRHNSRIRVKTYADEASPVPS 163

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDK 161
           I G+Y GA+W+EREV+D++G+ F GHPDLRRI+TDYGF+GHPLRKDFP+TG+ EL YD++
Sbjct: 164 ITGLYDGANWYEREVYDLFGVLFVGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEE 223

Query: 162 VKKVVYRPVELMQEHRDYDFLSP-WEGVNSLFAKEDSKD 199
            K++V  P+E+ Q  R++   S  WE V S   K+D  D
Sbjct: 224 KKRIVVEPLEMTQAFRNFQGGSSVWEQVGS--GKDDKPD 260


>gi|9280608|gb|AAF86492.1|AF279445_1 NADH dehydrogenase subunit 9 [Lupinus angustifolius]
 gi|9280610|gb|AAF86493.1|AF279446_1 NADH dehydrogenase subunit 9 [Lupinus luteus]
          Length = 190

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|225557350|gb|EEH05636.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus G186AR]
          Length = 288

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 112/171 (65%), Gaps = 1/171 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++   +FL+      +  ++D+  VDF  R  RF+VVY+ LS ++N R+R
Sbjct: 101 ELTIYIPPSGVIPTFTFLKQHTAAEYTQVVDITAVDFPGRDQRFEVVYNLLSVRHNSRIR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA W+EREV+D++G+FF  HPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSITCLYDGALWYEREVYDLFGVFFVDHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNSLFAKEDSK 198
           P+TG+ E+ YD++ K++V  P+E+ Q  RD+    S WE +     K  S+
Sbjct: 221 PLTGYTEIRYDEEKKRIVVEPLEMTQAFRDFQGGSSAWEQIGDGIDKTPSE 271


>gi|13449296|ref|NP_085479.1| NADH dehydrogenase subunit 9 [Arabidopsis thaliana]
 gi|6851007|emb|CAA69753.3| NADH dehydrogenase subunit 9 [Arabidopsis thaliana]
          Length = 190

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSFINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +V++ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVQVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|240277991|gb|EER41498.1| NADH-ubiquinone oxidoreductase subunit [Ajellomyces capsulatus
           H143]
 gi|325096052|gb|EGC49362.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus H88]
          Length = 288

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 112/171 (65%), Gaps = 1/171 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++   +FL+      +  ++D+  VDF  R  RF+VVY+ LS ++N R+R
Sbjct: 101 ELTIYIPPSGVIPTFTFLKQHTAAEYTQVVDITAVDFPGRDQRFEVVYNLLSVRHNSRIR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA W+EREV+D++G+FF  HPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSITCLYDGALWYEREVYDLFGVFFVDHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNSLFAKEDSK 198
           P+TG+ E+ YD++ K++V  P+E+ Q  RD+    S WE +     K  S+
Sbjct: 221 PLTGYTEIRYDEEKKRIVVEPLEMTQAFRDFQGGSSAWEQIGDGIDKTPSE 271


>gi|9280604|gb|AAF86490.1|AF279443_1 NADH dehydrogenase subunit 9 [Lupinus mutabilis]
          Length = 190

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|167562179|ref|ZP_02355095.1| NADH dehydrogenase subunit C [Burkholderia oklahomensis EO147]
 gi|167569424|ref|ZP_02362298.1| NADH dehydrogenase subunit C [Burkholderia oklahomensis C6786]
          Length = 200

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 113/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V   V +VGEL+L V  GD + +   LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLVEAVGELTLVVKAGDYLEVAKALRDDRTLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS   N RLRV++         VPSIV ++  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVLHLLSIANNWRLRVRVFAPNDDLPIVPSIVDVWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|296136704|ref|YP_003643946.1| NADH (or F420H2) dehydrogenase, subunit C [Thiomonas intermedia
           K12]
 gi|295796826|gb|ADG31616.1| NADH (or F420H2) dehydrogenase, subunit C [Thiomonas intermedia
           K12]
          Length = 209

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 112/181 (61%), Gaps = 9/181 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +    +     SVGEL+LDV       +C  LRDD    F  +IDL
Sbjct: 1   MTSKLEQLDTALRAALGERIVALQASVGELTLDVAPAHYRDVCLALRDDAELHFEQLIDL 60

Query: 61  CGVDFLSRSN-------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADW 111
           CGVD+    N       RF VV H LS K+NRRLRV++  A+     V SI  I+  A+W
Sbjct: 61  CGVDYAQYGNAVRDEAGRFMVVLHLLSLKHNRRLRVRVRCADDDLPLVASINDIWNSANW 120

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           FERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD   K+V+Y+PV 
Sbjct: 121 FEREAFDLYGIIFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPDSKRVIYQPVT 180

Query: 172 L 172
           +
Sbjct: 181 I 181


>gi|312221820|emb|CBY01760.1| similar to NADH-ubiquinone oxidoreductase 30.4 kDa subunit
           [Leptosphaeria maculans]
          Length = 289

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 116/173 (67%), Gaps = 4/173 (2%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++   +FL+      +  I D+  VD+ ++  RF+VVY+ LS ++N RLR
Sbjct: 101 ELTIYIPPSGVIPTFTFLKYHTAAEYTQITDITAVDYPTKDQRFEVVYNMLSIRHNSRLR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSLCDLYDGANWYEREVYDLFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLSPWEGVNSLFAKEDSKDD 200
           P+TG+ E+ YD++ K++V  P+E+ Q  R++    S WE V      +D+K D
Sbjct: 221 PMTGYTEIRYDEEKKRIVQEPLEMTQAFRNFRGGSSAWEQVGP---GDDAKPD 270


>gi|57014008|ref|YP_173479.1| NADH dehydrogenase subunit 9 [Nicotiana tabacum]
          Length = 190

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDYPSRKQRFEVVYNLLSIRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|323149051|ref|YP_004222820.1| NADH dehydrogenase subunit 9 [Vigna radiata]
 gi|308206757|gb|ADO19894.1| NADH dehydrogenase subunit 9 [Vigna radiata]
          Length = 190

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 103/154 (66%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D     L  L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTKTDYLFQLLCFLKLHTYTRVQVSIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|153799814|gb|ABS50638.1| NADH dehydrogenase subunit 9 [Arabidopsis thaliana]
 gi|153799816|gb|ABS50639.1| NADH dehydrogenase subunit 9 [Arabidopsis thaliana]
          Length = 176

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/153 (50%), Positives = 103/153 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 24  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 83

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 84  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSFINHPDLRRISTDYGFEGHPLRKDLPLSG 143

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           +VE+ YDD  K+VV  P+E+ QE R +DF SPW
Sbjct: 144 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPW 176


>gi|161524206|ref|YP_001579218.1| NADH dehydrogenase subunit C [Burkholderia multivorans ATCC 17616]
 gi|189351037|ref|YP_001946665.1| NADH dehydrogenase subunit C [Burkholderia multivorans ATCC 17616]
 gi|221199658|ref|ZP_03572702.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD2M]
 gi|221205442|ref|ZP_03578457.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD2]
 gi|221211737|ref|ZP_03584716.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD1]
 gi|218534254|sp|A9AFY9|NUOC_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|160341635|gb|ABX14721.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia multivorans
           ATCC 17616]
 gi|189335059|dbj|BAG44129.1| NADH dehydrogenase I chain C [Burkholderia multivorans ATCC 17616]
 gi|221169098|gb|EEE01566.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD1]
 gi|221174280|gb|EEE06712.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD2]
 gi|221180943|gb|EEE13346.1| NADH dehydrogenase I, C subunit [Burkholderia multivorans CGD2M]
          Length = 200

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 114/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + + + LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLDVATTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS   N RLR+++   +     VPS+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVTHLLSVTNNWRLRLRVFAPDDDLPIVPSLVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|169606670|ref|XP_001796755.1| hypothetical protein SNOG_06383 [Phaeosphaeria nodorum SN15]
 gi|160707055|gb|EAT86214.2| hypothetical protein SNOG_06383 [Phaeosphaeria nodorum SN15]
          Length = 282

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 111/162 (68%), Gaps = 1/162 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ +    ++   +FL+      +  I D+  VD+ ++  RF+VVY+ LS ++N RLR
Sbjct: 101 ELTIYIPPAGVIPTFTFLKYHTAAEYTQISDITAVDYPTKDQRFEVVYNMLSIRHNSRLR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSLCDLYDGANWYEREVYDLFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLSPWEGVN 189
           P+TG+ E+ YD++ K++V  P+E+ Q  R++    S WE V 
Sbjct: 221 PMTGYTEIRYDEEKKRIVVEPLEMTQAFRNFRGGSSAWEQVG 262


>gi|296160631|ref|ZP_06843446.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp. Ch1-1]
 gi|295889157|gb|EFG68960.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp. Ch1-1]
          Length = 200

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 118/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G ++    ++GEL++ V  GD +++ + LRDD    F   +DL
Sbjct: 1   MASKLETLKANLEAAFGGLLQSTTEAIGELTIVVKAGDYLNVATRLRDDRSLGFEQCVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++     E   +PS+V I+   +W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDEVPILPSVVEIWSSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|157827451|ref|YP_001496515.1| NADH dehydrogenase subunit C [Rickettsia bellii OSU 85-389]
 gi|157802755|gb|ABV79478.1| NADH dehydrogenase subunit C [Rickettsia bellii OSU 85-389]
          Length = 196

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRV 89
           L+  V+   L+     L++     F  + DL G DF  ++ RF+VVY+ LS K N+RL +
Sbjct: 27  LAYKVEPNFLLPFLKALKESEELRFTVLTDLFGSDFPEKAKRFEVVYNLLSLKLNKRLII 86

Query: 90  KIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           K  V+E +S+PS + I+  A W+EREV+DM+GI F+G+ D RRILTDY FEGHPLRKDFP
Sbjct: 87  KTYVSEHESIPSAMSIFNAACWYEREVYDMFGINFDGNDDKRRILTDYEFEGHPLRKDFP 146

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           +TG+ ++ YD++ KKV Y PV L  E+R++DF SPW
Sbjct: 147 LTGYTQVKYDEQTKKVAYEPVNLDIEYREFDFSSPW 182


>gi|9280606|gb|AAF86491.1|AF279444_1 NADH dehydrogenase subunit 9 [Lupinus albus]
          Length = 190

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (68%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   
Sbjct: 38  LFQLLCFLKLHTYTRVQVSIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTR 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G+VE+ Y
Sbjct: 98  ISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSGYVEVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 158 DDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|332285015|ref|YP_004416926.1| NADH dehydrogenase I chain C [Pusillimonas sp. T7-7]
 gi|330428968|gb|AEC20302.1| NADH dehydrogenase I chain C [Pusillimonas sp. T7-7]
          Length = 203

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 119/185 (64%), Gaps = 19/185 (10%)

Query: 4   KIEDLGDYIVNSF--SGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           ++E L   +  +F  S +++ A+N   EL+L+V   + V LC+ LRDD    F   IDLC
Sbjct: 3   RLETLHTNLQAAFGESATLKLALN---ELTLEVPAKNWVDLCTALRDDAKLGFDTCIDLC 59

Query: 62  GVDFLS------------RSNRFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYP 107
           G+D+ +               RF VV H LS K+N RLRV++ V   E   +PS+V ++P
Sbjct: 60  GMDYSAWGAPTYPAAASMHPQRFAVVLHLLSVKHNWRLRVRVYVPNDEFPVIPSLVNVWP 119

Query: 108 GADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVY 167
             +WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+VVY
Sbjct: 120 AVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGNVEMRYDTEQKRVVY 179

Query: 168 RPVEL 172
           +PV +
Sbjct: 180 QPVTI 184


>gi|330938088|ref|XP_003305677.1| hypothetical protein PTT_18588 [Pyrenophora teres f. teres 0-1]
 gi|311317183|gb|EFQ86217.1| hypothetical protein PTT_18588 [Pyrenophora teres f. teres 0-1]
          Length = 288

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 111/162 (68%), Gaps = 1/162 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ V    ++   +FL+      +  I D+  VD+ ++  RF+VVY+ LS ++N RLR
Sbjct: 101 ELTIYVPPSGIIPTFTFLKYHTAAEYTQISDITAVDYPTKDQRFEVVYNMLSIRHNSRLR 160

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 161 VKTYADEATPVPSLCDLYDGANWYEREVYDLFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 220

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLSPWEGVN 189
           P+TG+ E+ YD++ K++V  P+E+ Q  R++    S WE V 
Sbjct: 221 PMTGYTEIRYDEEKKRIVVEPLEMTQAFRNFRGGSSAWEQVG 262


>gi|505273|emb|CAA56168.1| NADH dehydrogenase [Solanum tuberosum]
          Length = 190

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 104/154 (67%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  F++   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFMKLHTYTRVQVSIDICGVDYPSRKQRFEVVYNLLSIRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|189190938|ref|XP_001931808.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973414|gb|EDU40913.1| NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 288

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 119/186 (63%), Gaps = 1/186 (0%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +   G Y+++     V+       EL++ V    ++   +FL+      +  I D+  VD
Sbjct: 77  LHKYGQYLMSCLPKYVQQFSVWKDELTIYVPPSGIIPTFTFLKYHTAAEYTQISDITAVD 136

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           + ++  RF+VVY+ LS ++N RLRVK    E   VPS+  +Y GA+W+EREV+D++G+FF
Sbjct: 137 YPTKDQRFEVVYNMLSIRHNSRLRVKTYADEATPVPSLCDLYDGANWYEREVYDLFGVFF 196

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLS 183
            GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+ YD++ K++V  P+E+ Q  R++    S
Sbjct: 197 VGHPDLRRIMTDYGFDGHPLRKDFPMTGYTEIRYDEEKKRIVVEPLEMTQAFRNFRGGSS 256

Query: 184 PWEGVN 189
            WE V 
Sbjct: 257 AWEQVG 262


>gi|84508616|ref|YP_448663.1| NADH dehydrogenase subunit 9 [Desmarestia viridis]
 gi|45925648|gb|AAS79049.1| NADH dehydrogenase subunit 9 [Desmarestia viridis]
          Length = 191

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 106/161 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L++  +FL    +  F  +  + GVD+  R  RF+VVY  L+ + N RLR
Sbjct: 27  EIVISVPKKYLLATLTFLHHHSNGNFQMLTSISGVDYPDREERFEVVYDLLNVRANCRLR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   +PS+V ++P A+W+ERE+WD++GIFF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  VKTCTDEINPLPSVVSLFPSANWWEREIWDLFGIFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G+ EL YD+  + VV   +EL QE R ++F  PW   N
Sbjct: 147 PLSGYFELRYDEDQRVVVCEAIELSQEFRSFNFHIPWSQNN 187


>gi|91782614|ref|YP_557820.1| NADH dehydrogenase subunit C [Burkholderia xenovorans LB400]
 gi|122970576|sp|Q142H1|NUOC_BURXL RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|91686568|gb|ABE29768.1| NADH dehydrogenase subunit C [Burkholderia xenovorans LB400]
          Length = 200

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 118/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G ++    ++GEL++ V  GD +++ + LRDD    F   +DL
Sbjct: 1   MASKLETLKANLEAAFGGLLQSTTEAIGELTIVVKAGDYLNVATRLRDDRSLGFEQCVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++     E   +PS+V I+   +W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDEVPILPSVVEIWNSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|186476762|ref|YP_001858232.1| NADH dehydrogenase subunit C [Burkholderia phymatum STM815]
 gi|218534257|sp|B2JDM6|NUOC_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|184193221|gb|ACC71186.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia phymatum
           STM815]
          Length = 200

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 114/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     S+GEL++ V   D + + + LRDD    F  +IDL
Sbjct: 1   MASKLETLKANLEAAFGGRLTSITESIGELTIVVKADDFLEVATRLRDDAKLHFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CG+D+ +         RF  V H LS   N RLRV++   +     +PS+V I+  A+W+
Sbjct: 61  CGIDYQTYGEGAYDGPRFAAVLHLLSITNNWRLRVRVFAPDDDVPLIPSVVEIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|268164098|ref|YP_003288875.1| NADH dehydrogenase subunit 9 [Saccharina coriacea]
 gi|262318408|dbj|BAI48727.1| NADH dehydrogenase subunit 9 [Saccharina coriacea]
          Length = 190

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 106/161 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L++  +FL    +  F  +  + GVD+  R  RF+VVY  L+ + N RLR
Sbjct: 27  EIVISVSKKYLLATLTFLHHHSNGNFQMLTSISGVDYPEREERFEVVYDLLNVRSNCRLR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   +PS+V ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  IKTHTDEINPLPSVVSLFPSANWWEREIWDLFGVFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G+ EL YD+  + VV   +EL QE R ++F  PW   N
Sbjct: 147 PLSGYFELRYDEDQRVVVCEAIELSQEFRSFNFHVPWSQNN 187


>gi|308474977|ref|XP_003099708.1| CRE-NUO-2 protein [Caenorhabditis remanei]
 gi|308266363|gb|EFP10316.1| CRE-NUO-2 protein [Caenorhabditis remanei]
          Length = 284

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 119/201 (59%), Gaps = 20/201 (9%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLR--------DDP-- 50
           ++ + G Y       F   V+FA     EL L +    +V + SFL+         +P  
Sbjct: 54  RLANFGKYAAECLPKFVQKVQFAAGD--ELELLIHPSGVVPVLSFLKVSFIDIILTEPIN 111

Query: 51  -----HCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGI 105
                   F N+  + G+D  +R NR +V+Y   S ++N R+RV+    E   + S+  +
Sbjct: 112 FQGNHSAQFTNLTFITGMDVPTRKNRLEVIYALYSVRFNARVRVRTYTDEIAPIDSVTPV 171

Query: 106 YPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKV 165
           + GADW+EREV+DMYG++F  HPDLRRILTDYGFEGHP RKD+P++G+ E+ YD ++K+V
Sbjct: 172 FKGADWYEREVYDMYGVWFNNHPDLRRILTDYGFEGHPFRKDYPLSGYNEVRYDPELKRV 231

Query: 166 VYRPVELMQEHRDYDFLSPWE 186
           VY P EL QE R +D  +PWE
Sbjct: 232 VYEPSELAQEFRKFDLNTPWE 252


>gi|268053554|ref|YP_003288913.1| NADH dehydrogenase subunit 9 [Saccharina japonica]
 gi|268053593|ref|YP_003288951.1| NADH dehydrogenase subunit 9 [Saccharina religiosa]
 gi|268053632|ref|YP_003288989.1| NADH dehydrogenase subunit 9 [Saccharina ochotensis]
 gi|268053671|ref|YP_003289066.1| NADH dehydrogenase subunit 9 [Saccharina diabolica]
 gi|268053710|ref|YP_003289117.1| NADH dehydrogenase subunit 9 [Saccharina longipedalis]
 gi|268164059|ref|YP_003288824.1| NADH dehydrogenase subunit 9 [Saccharina angustata]
 gi|262318174|dbj|BAI48499.1| NADH dehydrogenase subunit 9 [Saccharina japonica]
 gi|262318213|dbj|BAI48537.1| NADH dehydrogenase subunit 9 [Saccharina religiosa]
 gi|262318252|dbj|BAI48575.1| NADH dehydrogenase subunit 9 [Saccharina ochotensis]
 gi|262318291|dbj|BAI48613.1| NADH dehydrogenase subunit 9 [Saccharina diabolica]
 gi|262318330|dbj|BAI48651.1| NADH dehydrogenase subunit 9 [Saccharina longipedalis]
 gi|262318369|dbj|BAI48689.1| NADH dehydrogenase subunit 9 [Saccharina angustata]
          Length = 190

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 106/161 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L++  +FL    +  F  +  + GVD+  R  RF++VY  L+ + N RLR
Sbjct: 27  EIVISVSKKYLLATLTFLHHHSNGNFQMLTSISGVDYPEREERFEIVYDLLNVRSNCRLR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   +PS+V ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  IKTHTDEINPLPSVVSLFPSANWWEREIWDLFGVFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G+ EL YD+  + VV   +EL QE R ++F  PW   N
Sbjct: 147 PLSGYFELRYDEDQRVVVCEAIELSQEFRSFNFHVPWSQNN 187


>gi|53718849|ref|YP_107835.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei K96243]
 gi|53725817|ref|YP_103432.1| NADH dehydrogenase subunit C [Burkholderia mallei ATCC 23344]
 gi|67642190|ref|ZP_00440950.1| NADH-quinone oxidoreductase chain c (nadh dehydrogenasei, chain c)
           (ndh-1, chain c) [Burkholderia mallei GB8 horse 4]
 gi|76809661|ref|YP_332846.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 1710b]
 gi|121600967|ref|YP_992471.1| NADH dehydrogenase subunit C [Burkholderia mallei SAVP1]
 gi|124384508|ref|YP_001026726.1| NADH dehydrogenase subunit C [Burkholderia mallei NCTC 10229]
 gi|126440556|ref|YP_001058340.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 668]
 gi|126451055|ref|YP_001079989.1| NADH dehydrogenase subunit C [Burkholderia mallei NCTC 10247]
 gi|126454408|ref|YP_001065579.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 1106a]
 gi|134283898|ref|ZP_01770594.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 305]
 gi|167000366|ref|ZP_02266184.1| NADH dehydrogenase I, C subunit [Burkholderia mallei PRL-20]
 gi|167718845|ref|ZP_02402081.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei DM98]
 gi|167737854|ref|ZP_02410628.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 14]
 gi|167815038|ref|ZP_02446718.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 91]
 gi|167823454|ref|ZP_02454925.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 9]
 gi|167845006|ref|ZP_02470514.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei B7210]
 gi|167893547|ref|ZP_02480949.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 7894]
 gi|167901993|ref|ZP_02489198.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei NCTC 13177]
 gi|167910229|ref|ZP_02497320.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei 112]
 gi|167918262|ref|ZP_02505353.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei BCC215]
 gi|217420241|ref|ZP_03451747.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 576]
 gi|226195449|ref|ZP_03791038.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|237811584|ref|YP_002896035.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei MSHR346]
 gi|242316909|ref|ZP_04815925.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 1106b]
 gi|254175567|ref|ZP_04882227.1| NADH dehydrogenase I, C subunit [Burkholderia mallei ATCC 10399]
 gi|254181185|ref|ZP_04887782.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           1655]
 gi|254190548|ref|ZP_04897055.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195095|ref|ZP_04901524.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           S13]
 gi|254202108|ref|ZP_04908471.1| NADH dehydrogenase I, C subunit [Burkholderia mallei FMH]
 gi|254207438|ref|ZP_04913788.1| NADH dehydrogenase I, C subunit [Burkholderia mallei JHU]
 gi|254262053|ref|ZP_04953107.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           1710a]
 gi|254298535|ref|ZP_04965987.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           406e]
 gi|254359860|ref|ZP_04976130.1| NADH dehydrogenase I, C subunit [Burkholderia mallei 2002721280]
 gi|81380047|sp|Q63VN1|NUOC_BURPS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|81604653|sp|Q62IN7|NUOC_BURMA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|123599739|sp|Q3JUA7|NUOC_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534255|sp|A3MIA3|NUOC_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534268|sp|A3NTA8|NUOC_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534271|sp|A1V2L8|NUOC_BURMS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534280|sp|A2S457|NUOC_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534296|sp|A3N7L9|NUOC_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|52209263|emb|CAH35208.1| NADH dehydrogenase I chain C [Burkholderia pseudomallei K96243]
 gi|52429240|gb|AAU49833.1| NADH dehydrogenase I, C subunit [Burkholderia mallei ATCC 23344]
 gi|76579114|gb|ABA48589.1| NADH dehydrogenase I chain C [Burkholderia pseudomallei 1710b]
 gi|121229777|gb|ABM52295.1| NADH dehydrogenase I, C subunit [Burkholderia mallei SAVP1]
 gi|124292528|gb|ABN01797.1| NADH dehydrogenase I, C subunit [Burkholderia mallei NCTC 10229]
 gi|126220049|gb|ABN83555.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 668]
 gi|126228050|gb|ABN91590.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 1106a]
 gi|126243925|gb|ABO07018.1| NADH dehydrogenase I, C subunit [Burkholderia mallei NCTC 10247]
 gi|134244687|gb|EBA44785.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 305]
 gi|147746355|gb|EDK53432.1| NADH dehydrogenase I, C subunit [Burkholderia mallei FMH]
 gi|147751332|gb|EDK58399.1| NADH dehydrogenase I, C subunit [Burkholderia mallei JHU]
 gi|148029100|gb|EDK87005.1| NADH dehydrogenase I, C subunit [Burkholderia mallei 2002721280]
 gi|157808081|gb|EDO85251.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           406e]
 gi|157938223|gb|EDO93893.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696611|gb|EDP86581.1| NADH dehydrogenase I, C subunit [Burkholderia mallei ATCC 10399]
 gi|169651843|gb|EDS84536.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           S13]
 gi|184211723|gb|EDU08766.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           1655]
 gi|217397545|gb|EEC37561.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 576]
 gi|225932651|gb|EEH28649.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|237503483|gb|ACQ95801.1| NADH dehydrogenase subunit C [Burkholderia pseudomallei MSHR346]
 gi|238523286|gb|EEP86725.1| NADH-quinone oxidoreductase chain c (nadh dehydrogenasei, chain c)
           (ndh-1, chain c) [Burkholderia mallei GB8 horse 4]
 gi|242140148|gb|EES26550.1| NADH dehydrogenase I, C subunit [Burkholderia pseudomallei 1106b]
 gi|243063700|gb|EES45886.1| NADH dehydrogenase I, C subunit [Burkholderia mallei PRL-20]
 gi|254220742|gb|EET10126.1| NADH-quinone oxidoreductase, C subunit [Burkholderia pseudomallei
           1710a]
          Length = 200

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 113/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +        V +VGEL+L V   D + +   LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARAVSLVEAVGELTLVVKASDYLEVAKQLRDDRSLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS   N RLRV++  ++     VPS+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVLHLLSVANNWRLRVRVFASDDDLPIVPSVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPQEKRVVYQPVTI 180


>gi|21450013|ref|NP_659275.1| NADH dehydrogenase subunit 9 [Laminaria digitata]
 gi|21425338|emb|CAC87971.1| NADH dehydrogenase subunit 9 [Laminaria digitata]
          Length = 190

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 106/161 (65%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L++  +FL    +  F  +  + GVD+  R  RF++VY  L+ + N RLR
Sbjct: 27  EIVISVSKKYLLATLTFLHHHSNGNFQMLTSISGVDYPEREERFEIVYDLLNIRSNCRLR 86

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   +PS+V ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 87  IKTHTDEINPLPSVVSLFPSANWWEREIWDLFGVFFSNHPDLRRILTDYGFEGHPLRKDF 146

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P++G+ EL YD+  + VV   +EL QE R ++F  PW   N
Sbjct: 147 PLSGYFELRYDEDQRVVVCEAIELSQEFRSFNFHVPWSQNN 187


>gi|261205336|ref|XP_002627405.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239592464|gb|EEQ75045.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239611381|gb|EEQ88368.1| NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Ajellomyces
           dermatitidis ER-3]
 gi|327348610|gb|EGE77467.1| NADH-ubiquinone oxidoreductase 27 kDa subunit [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 287

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 111/171 (64%), Gaps = 1/171 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL++ V    ++    FL+      +  ++D+  VDF SR  RF+VVY+ LS ++N R+R
Sbjct: 100 ELTIYVPPSGIIPTFVFLKQHTAAEYTQVVDITAVDFPSRDQRFEVVYNLLSVRHNSRIR 159

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   VPSI  +Y GA W+EREV+D++G+FF  HPDLRRI+TDYGF+GHPLRKDF
Sbjct: 160 VKTYADEATPVPSITCLYDGALWYEREVYDLFGVFFVDHPDLRRIMTDYGFDGHPLRKDF 219

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF-LSPWEGVNSLFAKEDSK 198
           P+TG+ E+ Y ++ K++V  P+E+ Q  RD+    S WE V     K  S+
Sbjct: 220 PLTGYTEIRYCEEKKRIVVEPLEMTQAFRDFRAGSSAWEQVGEGIDKTPSE 270


>gi|148284881|ref|YP_001248971.1| NADH dehydrogenase I chain C [Orientia tsutsugamushi str. Boryong]
 gi|146740320|emb|CAM80724.1| NADH dehydrogenase I chain C [Orientia tsutsugamushi str. Boryong]
          Length = 195

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 121/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFS-GSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++L + + + F+  S+    N    +   ++   L+ +   L++D    F  + D+   
Sbjct: 6   LKELKELVESQFAISSISAKFNITNHVEAIINKEQLIEVLKLLKNDKELKFTILTDVFAA 65

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF  R+ RF++VY+ LS   N RL VKI + + + + S   ++  A+W+ERE++D++GI 
Sbjct: 66  DFPDRNKRFEIVYNLLSIIKNIRLIVKINLNDNELIQSATPVFSNANWYEREIYDLFGIK 125

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HP L+RILTDYGF GHPLRKDF ++G+ ++ YDDK++KVVY PV+L QE+R+++F S
Sbjct: 126 FANHPHLKRILTDYGFVGHPLRKDFALSGYSQVKYDDKLEKVVYEPVKLDQEYRNFNFSS 185

Query: 184 PWEGVNS 190
           PW+G  S
Sbjct: 186 PWQGPKS 192


>gi|29841214|gb|AAP06227.1| SJCHGC06115 protein [Schistosoma japonicum]
 gi|226478696|emb|CAX72843.1| putative NADH dehydrogenase (ubiquinone) Fe-S protein 3
           [Schistosoma japonicum]
 gi|257205792|emb|CAX82547.1| putative NADH dehydrogenase (ubiquinone) Fe-S protein 3
           [Schistosoma japonicum]
 gi|257206566|emb|CAX82911.1| putative NADH dehydrogenase (ubiquinone) Fe-S protein 3
           [Schistosoma japonicum]
          Length = 259

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 108/166 (65%)

Query: 21  RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLS 80
           +  +    EL + +    ++ + SFL+   +  F+N+ D+  VD  SR  RF +VY+ LS
Sbjct: 60  KVQMGHTKELEICIHPDGIIPVLSFLKYHHNAQFLNLSDITAVDIPSRKYRFQIVYNLLS 119

Query: 81  PKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
            +YN R+RV     E   V S   ++  ++W+EREVWDMYG+FF  HPDLRRILTDYGF 
Sbjct: 120 LRYNSRIRVLTYTDELTPVDSSCSVFQASNWYEREVWDMYGVFFYDHPDLRRILTDYGFV 179

Query: 141 GHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           GHP RKDFP++G+ E+ +D++  +VV  PVEL QE R ++F SPWE
Sbjct: 180 GHPQRKDFPLSGYTEMRFDEEYCRVVIEPVELAQEFRRFEFNSPWE 225


>gi|91205211|ref|YP_537566.1| NADH dehydrogenase subunit C [Rickettsia bellii RML369-C]
 gi|122425873|sp|Q1RJI7|NUOC_RICBR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|91068755|gb|ABE04477.1| NADH dehydrogenase I chain C [Rickettsia bellii RML369-C]
          Length = 196

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 107/156 (68%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRV 89
           L+  V+   L+     L++     F  + DL G DF  ++ RF+VVY+ LS K N+RL +
Sbjct: 27  LAYKVEPNFLLPFLKALKESEELRFTVLTDLFGSDFPEKAKRFEVVYNLLSLKLNKRLII 86

Query: 90  KIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           K  V+E +S+PS + I+    W+EREV+DM+GI F+G+ D RRILTDY FEGHPLRKDFP
Sbjct: 87  KTYVSEHESIPSAMSIFNATCWYEREVYDMFGINFDGNDDKRRILTDYEFEGHPLRKDFP 146

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           +TG+ ++ YD++ KKV Y PV L  E+R++DF SPW
Sbjct: 147 LTGYTQVKYDEQTKKVAYEPVNLDIEYREFDFSSPW 182


>gi|242023154|ref|XP_002432001.1| NADH-ubiquinone oxidoreductase 30 kDa subunit, putative [Pediculus
           humanus corporis]
 gi|212517352|gb|EEB19263.1| NADH-ubiquinone oxidoreductase 30 kDa subunit, putative [Pediculus
           humanus corporis]
          Length = 222

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 4   KIEDLGDYIVNSFSGSVRF-AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           K    G Y+       V+   + S GEL + +    ++ +  FL+D  +C F +++D+ G
Sbjct: 37  KTTHFGKYVSECLPKYVQMIQMTSQGELEILIAPEGVLPVMQFLKDHHNCQFESLVDIAG 96

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +D   R  RF+++Y+ LS +YN R+RVK    E   + S+  +Y  ADW+EREVWDMYG+
Sbjct: 97  MDVPGREYRFEIIYNLLSLRYNSRVRVKTYTDELTPIDSVYEVYRAADWYEREVWDMYGV 156

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVV 166
           +F+ HPDLRRILTDYGFEGHP R+DFP++G+VE+ YDD+V++VV
Sbjct: 157 YFKNHPDLRRILTDYGFEGHPQRRDFPLSGYVEVRYDDEVQRVV 200


>gi|289619332|emb|CBI53615.1| unnamed protein product [Sordaria macrospora]
          Length = 266

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/155 (47%), Positives = 107/155 (69%), Gaps = 1/155 (0%)

Query: 37  GDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEG 96
           G L        D+    +  + D+  VDF ++  RF+VVY+ LS ++N R+RVK  V E 
Sbjct: 88  GCLPKYIQQFSDNTAAEYTQVSDITAVDFPTKDQRFEVVYNLLSVRHNSRIRVKTYVDEV 147

Query: 97  KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
             VPSI  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDFP+TG+ E+
Sbjct: 148 SPVPSITPLYNGANWYEREVYDLFGVFFTGHPDLRRIMTDYGFDGHPLRKDFPMTGYTEI 207

Query: 157 HYDDKVKKVVYRPVELMQEHRDYD-FLSPWEGVNS 190
            +D++ K++V  P+E+ Q  R+++   S WE V S
Sbjct: 208 RWDEEKKRIVTEPLEMTQAFRNFEGGSSAWEQVGS 242


>gi|190571253|ref|YP_001975611.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018651|ref|ZP_03334459.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357525|emb|CAQ54962.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995602|gb|EEB56242.1| NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 191

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%)

Query: 37  GDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEG 96
            D+ +   FLRDD  C    ++D+ GVD+  R  RF+++Y+ LS  +N R+ +K+ + EG
Sbjct: 31  NDIENHLLFLRDDEKCRLELLVDVFGVDYPDREKRFELIYNLLSVVHNIRVHIKLQLCEG 90

Query: 97  KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
               S+  I+  A WFEREV+DMYGI F  HPDLRRILTDYGF+GHP+ KDFP+TG+ E+
Sbjct: 91  DIPLSVAKIFNAASWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEEV 150

Query: 157 HYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
            YD + KKVVY P++L Q+ R +D LSPWE
Sbjct: 151 RYDIEAKKVVYNPIDLPQDFRMFDSLSPWE 180


>gi|1507657|dbj|BAA11532.1| subunit 9 of NADH dehydrogenase [Arabidopsis thaliana]
          Length = 190

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 103/154 (66%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+ F  HPDL RI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSFINHPDLPRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +V++ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 152 YVQVRYDDPEKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|67458957|ref|YP_246581.1| NADH dehydrogenase subunit C [Rickettsia felis URRWXCal2]
 gi|75536605|sp|Q4UM07|NUOC_RICFE RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|67004490|gb|AAY61416.1| NADH dehydrogenase I chain C [Rickettsia felis URRWXCal2]
          Length = 207

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 115/172 (66%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRV 89
           L+  V+   L+     L++     F  + DL G DF  R  RF+V+Y+ LS K N+RL +
Sbjct: 27  LAYQVEPNFLLPFLKALKESEELRFTVLTDLFGTDFPERDKRFEVIYNLLSLKLNKRLII 86

Query: 90  KIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           K+ ++E +++PS + I+  + W+EREV+DMYG+ F+G+ D RRILTDY FEGHPLRKDFP
Sbjct: 87  KVYISEKETIPSAMNIFNASCWYEREVYDMYGVNFDGNDDKRRILTDYEFEGHPLRKDFP 146

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAKEDSKDDM 201
           +TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W   + +   ++   D+
Sbjct: 147 LTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSYVLPGDEKATDV 198


>gi|189183820|ref|YP_001937605.1| NADH dehydrogenase I chain C [Orientia tsutsugamushi str. Ikeda]
 gi|189180591|dbj|BAG40371.1| NADH dehydrogenase I chain C [Orientia tsutsugamushi str. Ikeda]
          Length = 196

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 120/187 (64%), Gaps = 1/187 (0%)

Query: 5   IEDLGDYIVNSFS-GSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++L + + + F+  S+    N    +   +    L+ +   L++D    F  + D+   
Sbjct: 6   LKELKELVESQFAISSISAKFNITNHVEAIIHKEQLIEVLKLLKNDKELKFTILTDIFAA 65

Query: 64  DFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           DF  R+ RF++VY+ LS   N RL VKI + + + + S   ++  A+W+ERE++D++GI 
Sbjct: 66  DFPDRNKRFEIVYNLLSIIKNIRLIVKINLNDNELIQSATPVFSNANWYEREIYDLFGIK 125

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HP L+RILTDYGF GHPLRKDF ++G+ ++ YDDK++KVVY PV+L QE+R+++F S
Sbjct: 126 FANHPHLKRILTDYGFVGHPLRKDFALSGYSQVKYDDKLEKVVYEPVKLDQEYRNFNFSS 185

Query: 184 PWEGVNS 190
           PW+G  S
Sbjct: 186 PWQGPKS 192


>gi|84508538|ref|YP_448702.1| NADH dehydrogenase subunit 9 [Dictyota dichotoma]
 gi|45925706|gb|AAS79087.1| NADH dehydrogenase subunit 9 [Dictyota dichotoma]
          Length = 192

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/159 (49%), Positives = 105/159 (66%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E+ + V    L+ +  FL    +  F  +  + GVD+  R NRF++VY  LS  YN R+R
Sbjct: 31  EMVISVSKEHLLVVLIFLHHHTNGGFQLLTCVSGVDYPERENRFEIVYELLSLGYNCRIR 90

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           VK    E   V S V ++P A+W+ERE+WD++G+FF  HPDLRRILTDYGFEGHPLRKDF
Sbjct: 91  VKTYTNEVNPVFSCVSLFPCANWWEREIWDLFGVFFFTHPDLRRILTDYGFEGHPLRKDF 150

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           P++GFVEL YD+  + VV  P+EL QE R + F +PW  
Sbjct: 151 PLSGFVELRYDEDQRVVVCEPIELSQEFRMFSFSTPWSN 189


>gi|262277299|ref|ZP_06055092.1| NADH-quinone oxidoreductase subunit c (nadhdehydrogenase i subunit
           c) (ndh-1 subunit c) [alpha proteobacterium HIMB114]
 gi|262224402|gb|EEY74861.1| NADH-quinone oxidoreductase subunit c (nadhdehydrogenase i subunit
           c) (ndh-1 subunit c) [alpha proteobacterium HIMB114]
          Length = 199

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 116/183 (63%), Gaps = 2/183 (1%)

Query: 17  SGSVRFAVNSVGELSLDVDCG--DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDV 74
           S + RFA       +L   C    L+     L+      F  ++D+  VD+ +R  RF++
Sbjct: 14  SPNFRFAKIEFQNDNLVCHCNADQLIDNVVQLKRHSDLKFRQLVDILAVDYPNREKRFEI 73

Query: 75  VYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
           +Y FLS + N R+ +KI + + + + ++  ++P A+W EREV+DM GI F  HPDLRRIL
Sbjct: 74  IYLFLSHENNLRISIKIDLEDQQKIQTLTNVFPSANWLEREVFDMNGIEFSDHPDLRRIL 133

Query: 135 TDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAK 194
           TDY FEG PLRKDFP+TG+ E+ YD + KKVVY PV+L Q +RD+DF SPW+G + +  +
Sbjct: 134 TDYNFEGFPLRKDFPLTGYKEVRYDPETKKVVYGPVKLQQAYRDFDFKSPWQGPDYIKKQ 193

Query: 195 EDS 197
           ++ 
Sbjct: 194 QEK 196


>gi|170696397|ref|ZP_02887526.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia graminis
           C4D1M]
 gi|170138725|gb|EDT06924.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia graminis
           C4D1M]
          Length = 200

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     ++GEL++ V   D +++ + LRDD    F  ++DL
Sbjct: 1   MASKLETLKANLEAAFGGLLLSTTEAIGELTIVVKASDYLNVATRLRDDRSLGFEQMMDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++         +PS+V I+  A+W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPNDDMPILPSVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|167836051|ref|ZP_02462934.1| NADH dehydrogenase subunit C [Burkholderia thailandensis MSMB43]
          Length = 200

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +        V +VGEL+L V   D + +   LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARAVSLVEAVGELTLVVKASDYLEVAKQLRDDRSLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+ +  +      RF  V H LS   N RLRV++   +     VPS+V I+  A+W+
Sbjct: 61  CGIDYQTYGDGAYDGPRFAAVLHLLSVANNWRLRVRVFAPDDDLPIVPSVVDIWSSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|289065165|ref|YP_003434217.1| NADH dehydrogenase subunit 9 [Chattonella marina]
 gi|288871877|dbj|BAI70564.1| NADH dehydrogenase subunit 9 [Chattonella marina]
          Length = 186

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 108/161 (67%), Gaps = 1/161 (0%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            E+ + V    L+    FL+      +  +  + GVD+     RF++VY  L+  YN RL
Sbjct: 26  NEVIISVPSKYLLESIYFLKFHTQSQYKILTSISGVDYPQYQQRFEIVYDLLTLVYNNRL 85

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           RVK  V E   +PSI+ ++P ++W+EREVWD++G+FF  HPDLRRILTDYGFEGHPLRK+
Sbjct: 86  RVKTYVDEVTPLPSIISVFPCSNWWEREVWDLFGVFFLNHPDLRRILTDYGFEGHPLRKN 145

Query: 148 FPVTGFVELHYDDKVKKVVYRPV-ELMQEHRDYDFLSPWEG 187
           FP++G+VE+ YD+  K+VV  P+ +L QE R ++F +PW+ 
Sbjct: 146 FPLSGYVEVRYDESQKRVVCEPIKQLSQEFRSFNFPTPWKN 186


>gi|325520399|gb|EGC99517.1| NADH dehydrogenase subunit C [Burkholderia sp. TJI49]
          Length = 200

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 113/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + + + LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLEVATTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS   N RLR+++   +     V S+V I+  A+W+
Sbjct: 61  CGVDYQTFGDGAYDGPRFAAVSHLLSVTNNWRLRLRVFAPDDDLPIVASLVDIWTSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|239947492|ref|ZP_04699245.1| NADH-quinone oxidoreductase subunit C [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921768|gb|EER21792.1| NADH-quinone oxidoreductase subunit C [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 197

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 105/147 (71%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L+     L++     F  + DL G DF  R  RF+VVY+ LS K N+RL +K+ ++E ++
Sbjct: 36  LLPFLKALKESEELRFTVLTDLFGSDFPERDKRFEVVYNLLSLKLNKRLIIKVDISEKET 95

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +PS + I+  A W+EREV+DMYGI F+G+ D RRILTDY FEGHPLRKDFP+TG+ ++ Y
Sbjct: 96  IPSAMNIFSAACWYEREVYDMYGINFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQVKY 155

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPW 185
           D+K+KKV Y PV+L  E+R++DF S W
Sbjct: 156 DEKLKKVAYEPVDLDIEYREFDFSSHW 182


>gi|312796900|ref|YP_004029822.1| NADH-quinone oxidoreductase chain C [Burkholderia rhizoxinica HKI
           454]
 gi|312168675|emb|CBW75678.1| NADH-quinone oxidoreductase chain C (EC 1.6.5.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 200

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 115/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +    ++ A  S+G+L++ V   DL+ + + LRDDP   F  + DL
Sbjct: 1   MANKLETLKANLDKALGNKLKSATESLGQLTIVVAASDLIDVATRLRDDPTLGFKQLTDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS + N RLRV++   +     +PS++ ++   +W+
Sbjct: 61  CGVDYSTYGDGAYDGPRFAAVSHLLSIRNNWRLRVRVFAPDDDVPILPSLIDVWNSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G+VE+ YD   K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGYVEMRYDAAEKRVVYQPVTI 180


>gi|83719353|ref|YP_441616.1| NADH dehydrogenase subunit C [Burkholderia thailandensis E264]
 gi|167618533|ref|ZP_02387164.1| NADH dehydrogenase subunit C [Burkholderia thailandensis Bt4]
 gi|257139688|ref|ZP_05587950.1| NADH dehydrogenase subunit C [Burkholderia thailandensis E264]
 gi|123537637|sp|Q2SZN3|NUOC_BURTA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|83653178|gb|ABC37241.1| NADH dehydrogenase I, C subunit [Burkholderia thailandensis E264]
          Length = 200

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +        V +VGEL+L V   D + +   LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARAVSLVEAVGELTLVVKASDYLEVAKQLRDDRSLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+ +  +      RF  V H LS   N RLRV++   +     VPS+V I+  A+W+
Sbjct: 61  CGIDYQTYGDGAYDGPRFAAVLHLLSVANNWRLRVRVFAPDDDLPIVPSVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|115352336|ref|YP_774175.1| NADH dehydrogenase subunit C [Burkholderia ambifaria AMMD]
 gi|122322643|sp|Q0BDD2|NUOC_BURCM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|115282324|gb|ABI87841.1| NADH dehydrogenase subunit C [Burkholderia ambifaria AMMD]
          Length = 200

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP  CF  +IDL
Sbjct: 1   MASKIEILKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKTLRDDPKLCFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V   LS   N RLR+++   +     V S+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVSQLLSVTNNWRLRLRVFAPDDDLPIVASLVDIWTSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|33592009|ref|NP_879653.1| NADH dehydrogenase subunit C [Bordetella pertussis Tohama I]
 gi|161609262|ref|NP_890374.2| NADH dehydrogenase subunit C [Bordetella bronchiseptica RB50]
 gi|81425362|sp|Q7VZQ3|NUOC_BORPE RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|33571653|emb|CAE41146.1| respiratory-chain NADH dehydrogenase, 30 kDa subunit [Bordetella
           pertussis Tohama I]
 gi|332381425|gb|AEE66272.1| NADH dehydrogenase subunit C [Bordetella pertussis CS]
          Length = 207

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 17/188 (9%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +F   +     S+GEL+L+V      S C+ LR DP   F + IDL
Sbjct: 2   MMTRLETLKNNLQAAFGQDLAL-TESLGELTLEVAAEQWFSACTKLRTDPALRFESCIDL 60

Query: 61  CGVDFLSRSN--------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVG 104
           CGVD+L+  N              R+ VV H LS ++N RLRV+      E   V S++ 
Sbjct: 61  CGVDYLTWGNGTQPEEKTGPVTRGRYAVVVHLLSIEHNWRLRVRTWAPDDEFPMVSSLLE 120

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
            +PG +WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+
Sbjct: 121 CWPGVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKR 180

Query: 165 VVYRPVEL 172
           V+Y+PV +
Sbjct: 181 VIYQPVTI 188


>gi|81429888|sp|Q7WCU1|NUOC_BORBR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|33577256|emb|CAE35813.1| respiratory-chain NADH dehydrogenase, 30 kDa subunit [Bordetella
           bronchiseptica RB50]
          Length = 215

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 17/188 (9%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +F   +     S+GEL+L+V      S C+ LR DP   F + IDL
Sbjct: 10  MMTRLETLKNNLQAAFGQDLAL-TESLGELTLEVAAEQWFSACTKLRTDPALRFESCIDL 68

Query: 61  CGVDFLSRSN--------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVG 104
           CGVD+L+  N              R+ VV H LS ++N RLRV+      E   V S++ 
Sbjct: 69  CGVDYLTWGNGTQPEEKTGPVTRGRYAVVVHLLSIEHNWRLRVRTWAPDDEFPMVSSLLE 128

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
            +PG +WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+
Sbjct: 129 CWPGVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKR 188

Query: 165 VVYRPVEL 172
           V+Y+PV +
Sbjct: 189 VIYQPVTI 196


>gi|294340859|emb|CAZ89254.1| putative NADH (or F420H2) dehydrogenase, subunit C (NuoC)
           [Thiomonas sp. 3As]
          Length = 209

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 111/181 (61%), Gaps = 9/181 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +    +     SVGEL+LDV       +C  LRDD    F  +IDL
Sbjct: 1   MTSKLEQLDTALRAALGERIVALQASVGELTLDVAPAHYRDVCLALRDDAELHFEQLIDL 60

Query: 61  CGVDFLSRSN-------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADW 111
           CGVD+    N       RF VV H LS K+N RLRV++  A+     V SI  I+  A+W
Sbjct: 61  CGVDYAQYGNAVRDEAGRFMVVVHLLSLKHNWRLRVRVRCADDDLPLVASINDIWNSANW 120

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           FERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD   K+V+Y+PV 
Sbjct: 121 FEREAFDLYGIIFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPDSKRVIYQPVT 180

Query: 172 L 172
           +
Sbjct: 181 I 181


>gi|81426433|sp|Q7W5A9|NUOC_BORPA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|33574338|emb|CAE38674.1| respiratory-chain NADH dehydrogenase, 30 kDa subunit [Bordetella
           parapertussis]
          Length = 215

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 17/188 (9%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +F   +     S+GEL+L+V      S C+ LR DP   F + IDL
Sbjct: 10  MMTRLETLKNNLQAAFGQDLAL-TESLGELTLEVAAEQWFSACTKLRTDPALRFESCIDL 68

Query: 61  CGVDFLSRSN--------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVG 104
           CGVD+L+  N              R+ VV H LS ++N RLRV+      E   V S++ 
Sbjct: 69  CGVDYLTWGNGTQPEEKTGPVTHGRYAVVVHLLSIEHNWRLRVRTWAPDDEFPMVSSLLE 128

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
            +PG +WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+
Sbjct: 129 CWPGVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKR 188

Query: 165 VVYRPVEL 172
           V+Y+PV +
Sbjct: 189 VIYQPVTI 196


>gi|323525438|ref|YP_004227591.1| NADH (or F420H2) dehydrogenase subunit C [Burkholderia sp.
           CCGE1001]
 gi|323382440|gb|ADX54531.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp.
           CCGE1001]
          Length = 200

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 118/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     ++GEL++ V   D +++ + LRDD    F  ++DL
Sbjct: 1   MASKLETLKANLEAAFGGLLLSTTEAIGELTIVVKASDYLNVATRLRDDRSLGFDQMMDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++   +     +PS+V ++  A+W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDDMPILPSVVEVWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|161610381|ref|NP_885552.2| NADH dehydrogenase subunit C [Bordetella parapertussis 12822]
          Length = 207

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 17/188 (9%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +F   +     S+GEL+L+V      S C+ LR DP   F + IDL
Sbjct: 2   MMTRLETLKNNLQAAFGQDLAL-TESLGELTLEVAAEQWFSACTKLRTDPALRFESCIDL 60

Query: 61  CGVDFLSRSN--------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVG 104
           CGVD+L+  N              R+ VV H LS ++N RLRV+      E   V S++ 
Sbjct: 61  CGVDYLTWGNGTQPEEKTGPVTHGRYAVVVHLLSIEHNWRLRVRTWAPDDEFPMVSSLLE 120

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
            +PG +WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+
Sbjct: 121 CWPGVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKR 180

Query: 165 VVYRPVEL 172
           V+Y+PV +
Sbjct: 181 VIYQPVTI 188


>gi|88606931|ref|YP_505116.1| NADH dehydrogenase I, C subunit [Anaplasma phagocytophilum HZ]
 gi|88597994|gb|ABD43464.1| NADH dehydrogenase I, C subunit [Anaplasma phagocytophilum HZ]
          Length = 188

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%)

Query: 46  LRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGI 105
           LRDDP      + D+  VD+ ++ +RF+VVY  LS  YN R+  K+A+ EG  +PS+  +
Sbjct: 45  LRDDPKTKLRVLTDIFAVDYHNKKSRFEVVYMLLSLVYNIRVCCKVALTEGSIIPSVTSV 104

Query: 106 YPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKV 165
           +  A WFEREV+DMYGI F  HPDLRRILTDYGF GHP+ KDFP+TG+ E+ YD +  KV
Sbjct: 105 FGSAGWFEREVYDMYGIEFSDHPDLRRILTDYGFRGHPMLKDFPLTGYEEIRYDFRKGKV 164

Query: 166 VYRPVELMQEHRDYDFLSPWEG 187
            Y+PV+L Q  R ++ +SPW+G
Sbjct: 165 AYQPVDLQQNFRLFNSMSPWKG 186


>gi|237746749|ref|ZP_04577229.1| NADH-quinone oxidoreductase subunit C/D [Oxalobacter formigenes
           HOxBLS]
 gi|229378100|gb|EEO28191.1| NADH-quinone oxidoreductase subunit C/D [Oxalobacter formigenes
           HOxBLS]
          Length = 200

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 114/182 (62%), Gaps = 10/182 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M R   +L D +   F   ++  + S GE+++ V+      +   LRDD    F  +IDL
Sbjct: 1   MQRNPVELADRLRAVFGAKLKDLIESFGEVTIVVNKAVYPDVMGQLRDDSRFRFEELIDL 60

Query: 61  CGVDFLSRSN--------RFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGAD 110
           CGVD+    N        RF VV H LS  +N RLRV++   +     VPSI+ I+P A+
Sbjct: 61  CGVDYAGYGNEEKGLKGKRFAVVVHLLSLAFNCRLRVRVFADDDAMPEVPSIMAIWPAAN 120

Query: 111 WFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           WFERE +D+YGI F+GHPDLRRILTDYGF G+P RKDFPV G+VE+ YD+K K+VVY+PV
Sbjct: 121 WFEREAFDLYGILFKGHPDLRRILTDYGFVGYPFRKDFPVQGYVEMRYDEKQKRVVYQPV 180

Query: 171 EL 172
            +
Sbjct: 181 TI 182


>gi|295676039|ref|YP_003604563.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp.
           CCGE1002]
 gi|295435882|gb|ADG15052.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp.
           CCGE1002]
          Length = 200

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 115/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     SVGEL++ V  GD +++   LRDD    F   +DL
Sbjct: 1   MASKLETLKANLEAAFGGLLVSVTESVGELTIVVKAGDYLNVAKRLRDDRSLGFEQCVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CGVD+ + +       RF  V H LS + N RLR+++   +     +PS+V I+   +W+
Sbjct: 61  CGVDYQTYAEGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDDMPILPSVVDIWNSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|107023186|ref|YP_621513.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1054]
 gi|116690268|ref|YP_835891.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia HI2424]
 gi|170733607|ref|YP_001765554.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia MC0-3]
 gi|206560701|ref|YP_002231466.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia J2315]
 gi|254247659|ref|ZP_04940980.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia cenocepacia
           PC184]
 gi|123371444|sp|Q1BV15|NUOC_BURCA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534251|sp|B1JVN9|NUOC_BURCC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534253|sp|B4E5M0|NUOC_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534265|sp|A0K921|NUOC_BURCH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|105893375|gb|ABF76540.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1054]
 gi|116648357|gb|ABK08998.1| NADH dehydrogenase subunit C [Burkholderia cenocepacia HI2424]
 gi|124872435|gb|EAY64151.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia cenocepacia
           PC184]
 gi|169816849|gb|ACA91432.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia cenocepacia
           MC0-3]
 gi|198036743|emb|CAR52643.1| NADH dehydrogenase I chain C [Burkholderia cenocepacia J2315]
          Length = 200

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 113/181 (62%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
           CGVD+ +  +      RF  V H LS   N RLR++ A A    +P   S+V I+  A+W
Sbjct: 61  CGVDYQTFGDGAYDGPRFAAVSHLLSVTNNWRLRLR-AFAPDDDLPIVASLVDIWTSANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           +ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV 
Sbjct: 120 YEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|88608330|ref|YP_506318.1| NADH dehydrogenase I, C subunit [Neorickettsia sennetsu str.
           Miyayama]
 gi|123491985|sp|Q2GDX8|NUOC_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|88600499|gb|ABD45967.1| NADH dehydrogenase I, C subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 186

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 111/167 (66%), Gaps = 4/167 (2%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKY 83
           +N+ G   ++     LV L S L     C F  + D+ G+D+L R  R +VVY  L  K 
Sbjct: 12  INAPGRCVVNSSLESLVELISHLS---SCGFEQLTDIFGIDYLEREKRIEVVYLLLDLKR 68

Query: 84  NRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
           NRR  VK++V    + VP+  G++  A+WFEREV+DMYG+ FEGHPDLRRILTDY FEG 
Sbjct: 69  NRRCCVKVSVDPASEKVPTCCGVFSVANWFEREVYDMYGVVFEGHPDLRRILTDYEFEGF 128

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           P+ KDFP+TG+ E+ YD + K+VVY  V+L Q++R +D L+PW+GV 
Sbjct: 129 PMLKDFPLTGYKEVRYDLESKEVVYEKVDLSQDYRSFDSLTPWKGVG 175


>gi|78067044|ref|YP_369813.1| NADH dehydrogenase subunit C [Burkholderia sp. 383]
 gi|123568006|sp|Q39EE7|NUOC_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|77967789|gb|ABB09169.1| NADH dehydrogenase subunit C [Burkholderia sp. 383]
          Length = 200

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 113/181 (62%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  ++DL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKMLRDDPKLRFEQLLDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
           CGVD+ +  +      RF  V H LS   N RLR++ A A    +P   S+V I+  A+W
Sbjct: 61  CGVDYQTFGDGAYDGPRFAAVSHLLSVTNNWRLRLR-AFAPDDDLPIVASLVDIWTSANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           +ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV 
Sbjct: 120 YEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVT 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|307730338|ref|YP_003907562.1| NADH (or F420H2) dehydrogenase subunit C [Burkholderia sp.
           CCGE1003]
 gi|307584873|gb|ADN58271.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp.
           CCGE1003]
          Length = 200

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K E L   +  +F G +     ++GEL++ V   D +++ + LRDD    F  ++DL
Sbjct: 1   MASKFETLKANLEAAFGGLLLSTTEAIGELTIVVKASDYLNVATRLRDDRSLGFDQMMDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++   +     +PS+V I+  A+W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDDLPLLPSVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|154315521|ref|XP_001557083.1| hypothetical protein BC1G_04333 [Botryotinia fuckeliana B05.10]
 gi|150847273|gb|EDN22466.1| hypothetical protein BC1G_04333 [Botryotinia fuckeliana B05.10]
          Length = 274

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           EL + +    ++ + SFL+ +    F  I D+  VDF +R  RF++VY+ LS ++N R+R
Sbjct: 105 ELVIYISPSGVIPVFSFLKYNTSAEFTQISDITAVDFPTRDQRFEIVYNLLSVRHNSRIR 164

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K    E   VPS+  +Y GA+W+EREV+D++G+FF GHPDLRRI+TDYGF+GHPLRKDF
Sbjct: 165 IKTYADEASPVPSLCSLYDGANWYEREVYDLFGVFFVGHPDLRRIMTDYGFDGHPLRKDF 224

Query: 149 PVTGFVELHYDDKVKKVVYRPVELMQEHRDY-DFLSPWEGVNSL 191
           P+TG+ E+ +D++ K++V  P+ + Q  R+     + WE   +L
Sbjct: 225 PLTGYTEIRFDEEKKRIVVEPLGVTQAFRNLRGGTAAWETWQNL 268


>gi|167580424|ref|ZP_02373298.1| NADH dehydrogenase subunit C [Burkholderia thailandensis TXDOH]
          Length = 200

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +        V +VGEL+L V   D + +   LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARAVSLVEAVGELTLVVKASDYLEVAKQLRDDRSLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+ +  +      RF  V H LS   N RLR+++   +     VPS+V I+  A+W+
Sbjct: 61  CGIDYQTYGDGAYDGPRFAAVLHLLSVANNWRLRLRVFAPDDDLPIVPSVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|115610726|ref|XP_790261.2| PREDICTED: similar to LOC496233 protein [Strongylocentrotus
           purpuratus]
          Length = 151

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 90/115 (78%)

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRR 132
           ++VY+ LS +YN R+R+K    E  +V S+V ++  ADW EREVWDMYG+FF  HPDLRR
Sbjct: 13  NLVYNLLSLRYNERIRIKTYTDELSAVDSLVPVFKAADWLEREVWDMYGVFFANHPDLRR 72

Query: 133 ILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           ILTDYGFEGHPLRKDFP++GFVE+ YDD++K+VV  P+E+ QE R +D  SPWE 
Sbjct: 73  ILTDYGFEGHPLRKDFPLSGFVEVRYDDELKRVVAEPLEMTQEFRKFDLSSPWES 127


>gi|253998385|ref|YP_003050448.1| NADH (or F420H2) dehydrogenase subunit C [Methylovorus sp. SIP3-4]
 gi|313200461|ref|YP_004039119.1| NADH (or f420h2) dehydrogenase subunit c [Methylovorus sp. MP688]
 gi|253985064|gb|ACT49921.1| NADH (or F420H2) dehydrogenase, subunit C [Methylovorus sp. SIP3-4]
 gi|312439777|gb|ADQ83883.1| NADH (or F420H2) dehydrogenase, subunit C [Methylovorus sp. MP688]
          Length = 198

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 117/180 (65%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +++ L   I ++    +   V+ VGEL+++    +++ +C  LRD P   F  +IDL
Sbjct: 1   MSSRLQQLTANIESALGDKLGRLVSHVGELTIECSVANMLDVCLILRDHPSLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+           RF  VYHFLS   N+R+R+++  A+     +P++V ++P A+WF
Sbjct: 61  CGVDYAEYGEGSWSGLRFATVYHFLSISLNQRVRLRVFAADDDFPVLPTLVDMWPVANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI +EGHPDLRR+LTDYGF GHP RKDFP+ G VE+ YD + ++V+Y+PV +
Sbjct: 121 ERESFDLYGIMYEGHPDLRRLLTDYGFVGHPFRKDFPMIGNVEMRYDPEQQRVIYQPVTI 180


>gi|255019909|ref|ZP_05291984.1| NADH-ubiquinone oxidoreductase chain C [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970689|gb|EET28176.1| NADH-ubiquinone oxidoreductase chain C [Acidithiobacillus caldus
           ATCC 51756]
          Length = 198

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 108/173 (62%), Gaps = 7/173 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + D    ++      VR       EL+L+++   L+    FLRDDP C F  +IDLCGVD
Sbjct: 1   MNDTSQILLAELGQLVRHCRVDRAELTLELERDGLLESLRFLRDDPRCDFQQLIDLCGVD 60

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVW 117
           +    +      RF VVYH LS  +++RLRV++ + E    VPS V I+P A+WFERE +
Sbjct: 61  YAEYGDGSWSGPRFAVVYHLLSLNHHQRLRVRVYLDEELPIVPSAVEIWPAANWFEREAF 120

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           D++G  FEGHPDLRRILTDYGF GHP RKDFP+ G VE+ YD   ++VVY P 
Sbjct: 121 DLFGFLFEGHPDLRRILTDYGFVGHPFRKDFPLVGTVEMRYDADQRRVVYEPT 173


>gi|11467084|ref|NP_042560.1| NADH dehydrogenase, subunit 9 [Acanthamoeba castellanii]
 gi|3914188|sp|Q37383|NDUS3_ACACA RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
 gi|562065|gb|AAD11853.1| NADH dehydrogenase, subunit 9 [Acanthamoeba castellanii]
          Length = 195

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 106/164 (64%), Gaps = 2/164 (1%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYN 84
           N      L V+  +  +L   L+      F  + D+C VD+  + +RF++ Y+  S KYN
Sbjct: 33  NESNNAYLLVETANFYNLVFSLQRSSLTQFKVLNDVCIVDYPEKIDRFELSYNLSSIKYN 92

Query: 85  RRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPL 144
            R+ +K   +    VPSI  ++  A+W ERE WDM+G+FF  HPDLRRILTDYGFEG PL
Sbjct: 93  FRIFIKTYTSA--YVPSISTLFNSANWIERECWDMFGVFFTNHPDLRRILTDYGFEGFPL 150

Query: 145 RKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           RKDFP+TG++E+ YDD+   +VY P+EL QE+R ++F SPWE +
Sbjct: 151 RKDFPLTGYIEIRYDDEKANIVYEPLELSQEYRLFNFTSPWEKI 194


>gi|254251863|ref|ZP_04945181.1| NADH dehydrogenase I,D subunit [Burkholderia dolosa AUO158]
 gi|124894472|gb|EAY68352.1| NADH dehydrogenase I,D subunit [Burkholderia dolosa AUO158]
          Length = 200

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLDVAKTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS   N RLR+++   +     V S+V ++  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVTHLLSITNNWRLRLRVFAPDDDLPIVASLVDVWSSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|157803903|ref|YP_001492452.1| NADH dehydrogenase subunit C [Rickettsia canadensis str. McKiel]
 gi|157785166|gb|ABV73667.1| NADH dehydrogenase subunit C [Rickettsia canadensis str. McKiel]
          Length = 196

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%)

Query: 54  FVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFE 113
           F  + DL G DF  R  RF+VVY+ LS K N+RL +K+ ++E +S+PS + I+  A W+E
Sbjct: 51  FTVLTDLFGADFPERDKRFEVVYNLLSLKLNKRLIIKVQISEKESIPSAMNIFNAACWYE 110

Query: 114 REVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELM 173
           REV+DM+G+ FEG+ D RRILTDY FEGHPLRKDFP+TG+ ++ YD K+KKV Y PV+L 
Sbjct: 111 REVYDMFGVNFEGNDDKRRILTDYEFEGHPLRKDFPLTGYTQVKYDKKLKKVAYEPVDLD 170

Query: 174 QEHRDYDFLSPW 185
            E+R +DF S W
Sbjct: 171 IEYRKFDFSSQW 182


>gi|11466629|ref|NP_066312.1| NADH dehydrogenase subunit 9 [Malawimonas jakobiformis]
 gi|10178667|gb|AAG13679.1|AF295546_5 NADH dehydrogenase subunit 9 [Malawimonas jakobiformis]
          Length = 187

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 113/173 (65%), Gaps = 2/173 (1%)

Query: 13  VNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRF 72
           +NSF     F  N+  E+ L +    L+ L   L+ + +    ++ID+  +D+  R+NRF
Sbjct: 17  INSFLSFNYF--NNKKEIYLLISNIHLLRLLYILKKNTNILLKSLIDIICIDYPERTNRF 74

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRR 132
           ++ YH LS KYN R+ +K  + E     SI+ IYP A W EREVWD YG+FF+ + DLRR
Sbjct: 75  ELNYHLLSLKYNIRINIKTYIDEISLNNSIIKIYPNAMWSEREVWDSYGVFFKNNNDLRR 134

Query: 133 ILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           ILTDYGFEG P+RKDFP++G+ E++YDD  K + Y+ + L Q++R++D+ S W
Sbjct: 135 ILTDYGFEGFPMRKDFPLSGYNEIYYDDLNKSIYYQKLYLSQQYRNFDYKSAW 187


>gi|291498617|gb|ADE08091.1| nad9 [Triticum aestivum]
          Length = 190

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (68%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   +  
Sbjct: 41  LLCFLKWHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISP 100

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDK 161
           +V ++P A  +EREVWDM G+    HPDLRRI TDYGFEGHPLRKDFP++G+VE+ YDD 
Sbjct: 101 VVSLFPSAGRWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSGYVEVRYDDP 160

Query: 162 VKKVVYRPVELMQEHRDYDFLSPWE 186
            K+VV  P+E+ QE R +DF SPWE
Sbjct: 161 EKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|209518513|ref|ZP_03267334.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp. H160]
 gi|209501058|gb|EEA01093.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia sp. H160]
          Length = 200

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     +VGEL++ V   D +++   LRDD    F   +DL
Sbjct: 1   MASKLETLKANLEAAFGGLLLSTTEAVGELTIVVKASDYLNVAKRLRDDRTLGFEQCVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWF 112
           CGVD+ + ++      RF  V H LS + N RLR+++   +     +PS+V I+   +W+
Sbjct: 61  CGVDYQTYADGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDDMPILPSVVEIWNSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|239811626|gb|ACS27113.1| NADH dehydrogenase subunit 9 [Heterosigma akashiwo]
 gi|239811666|gb|ACS27152.1| NADH dehydrogenase subunit 9 [Heterosigma akashiwo]
 gi|288871923|dbj|BAI70609.1| NADH dehydrogenase subunit 9 [Heterosigma akashiwo]
          Length = 188

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
            E+ + V    L+    FL+      +  +  + GVD+   + RF+VVY FL+  YN R+
Sbjct: 26  NEIIVVVSSQFLLETVEFLKLHTQTQYKILTSISGVDYPEYNKRFEVVYDFLTLVYNGRI 85

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           RVK  V E   +PS++ ++P A+W+EREVWD++G+FF  H DLRRILTDYGFEGHP+RK+
Sbjct: 86  RVKTYVDEVTPLPSLIPLFPCANWWEREVWDLFGVFFSNHTDLRRILTDYGFEGHPMRKN 145

Query: 148 FPVTGFVELHYDDKVKKVVYRPV-ELMQEHRDYDFLSPW 185
           FP++G+VE+ YD+  K+VV  P+ +  QE R ++F SPW
Sbjct: 146 FPLSGYVEVRYDENQKRVVCEPIKQFSQEFRSFNFSSPW 184


>gi|198284344|ref|YP_002220665.1| NADH (or F420H2) dehydrogenase subunit C [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666570|ref|YP_002427006.1| NADH-quinone oxidoreductase, C subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218534236|sp|B5EN69|NUOC_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|226737321|sp|B7J7U3|NUOC_ACIF2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|198248865|gb|ACH84458.1| NADH (or F420H2) dehydrogenase, subunit C [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518783|gb|ACK79369.1| NADH-quinone oxidoreductase, C subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 202

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 7/177 (3%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +E+L  ++ +    ++R A    GEL++++      + C  LRDD  C F  ++D+
Sbjct: 1   MTDALENLRQHLSDELGATLRTAHLDRGELTVELSREGFPAACLLLRDDVACAFDLLVDV 60

Query: 61  CGVDF------LSRSNRFDVVYHFLSPKYNRRLRVKI-AVAEGKSVPSIVGIYPGADWFE 113
           CGVD+      L    RF VVYH LS K+ +RLRV+I A  +   VPS+V ++  A+WFE
Sbjct: 61  CGVDYSAYGEGLWEGPRFAVVYHLLSLKHRQRLRVRIFADDDLPIVPSVVEVWAAANWFE 120

Query: 114 REVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RE +D+YGI F+GHPDLRRILTDYGF GHP RKDFP+ G VE+ YD    +VVY P 
Sbjct: 121 REAFDLYGILFDGHPDLRRILTDYGFVGHPFRKDFPLVGTVEMRYDADQGRVVYEPT 177


>gi|81176530|ref|YP_398414.1| nad9 [Triticum aestivum]
 gi|416536|emb|CAA49376.1| 30 kDa subunit of complex I NADH dehydrogenase [Triticum aestivum]
 gi|78675254|dbj|BAE47679.1| nad9 [Triticum aestivum]
 gi|169649064|gb|ACA62625.1| nad9 [Triticum aestivum]
          Length = 287

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 95/129 (73%)

Query: 58  IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVW 117
           ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   +  +V ++P A  +EREVW
Sbjct: 154 IDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISPVVSLFPSAGRWEREVW 213

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR 177
           DM G+    HPDLRRI TDYGFEGHPLRKDFP++G+VE+ YDD  K+VV  P+E+ QE R
Sbjct: 214 DMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSGYVEVRYDDPEKRVVSEPIEMTQEFR 273

Query: 178 DYDFLSPWE 186
            +DF SPWE
Sbjct: 274 YFDFASPWE 282


>gi|187923342|ref|YP_001894984.1| NADH dehydrogenase subunit C [Burkholderia phytofirmans PsJN]
 gi|218534258|sp|B2T2E9|NUOC_BURPP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|187714536|gb|ACD15760.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia
           phytofirmans PsJN]
          Length = 200

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +  +F G +     ++GEL++ V   D +++ + LRDD    F   +DL
Sbjct: 1   MASKLETLKANLEAAFGGLLLNLSEAIGELTIVVKASDYLNVATRLRDDRSLGFEQCVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
           CGVD+ + +       RF  V H LS + N RLR+++     E   +PS+V I+   +W+
Sbjct: 61  CGVDYQTYAEGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDEVPILPSVVEIWNSVNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|56791598|gb|AAW30337.1| NADH dehydrogenase subunit 9 [Piper betle]
          Length = 180

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 101/153 (66%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +   L  L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 28  DTNTDYLFPLLCFLKFHTYTRVQVSIDICGVDHPSRKLRFEVVHNLLSTRYNSRIRVQTS 87

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A W+EREVWDM G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 88  ADEVTRISPVVSLFPSAGWWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 147

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           +VE+ YDD  K+VV  P+E+ QE R +D  SPW
Sbjct: 148 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASPW 180


>gi|237748889|ref|ZP_04579369.1| NADH-quinone oxidoreductase subunit C/D [Oxalobacter formigenes
           OXCC13]
 gi|229380251|gb|EEO30342.1| NADH-quinone oxidoreductase subunit C/D [Oxalobacter formigenes
           OXCC13]
          Length = 200

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 113/182 (62%), Gaps = 10/182 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M R    L + +   F   +        E++L +   D + +   L+  P   F  +IDL
Sbjct: 1   MRRHPAQLIEILRAVFGERITHLSEDFSEVTLVIGKSDYLDVMKTLKGAPELQFAELIDL 60

Query: 61  CGVDFLSRSN--------RFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGAD 110
           CG+D+   +N        RF VV H LS ++N RLRV++   + +  SVPSIV I+P A+
Sbjct: 61  CGIDYAGYNNDPNGLEGKRFAVVSHLLSLEFNCRLRVRVFAEDEQMPSVPSIVDIWPSAN 120

Query: 111 WFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           WFERE +D+YGI F+GHPDLRRILTDYGF GHP RKDFP+ G+VE+ YD++ K+VVY+PV
Sbjct: 121 WFEREAFDLYGILFDGHPDLRRILTDYGFVGHPFRKDFPIQGYVEMRYDEEQKRVVYQPV 180

Query: 171 EL 172
            +
Sbjct: 181 TI 182


>gi|171316305|ref|ZP_02905526.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ambifaria
           MEX-5]
 gi|171098531|gb|EDT43332.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ambifaria
           MEX-5]
          Length = 200

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  +IDL
Sbjct: 1   MASKIEILKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V   LS   N RLR+++   +     V S+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVSQLLSVTNNWRLRLRVFAPDDDLPIVASLVDIWASANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|89280732|ref|YP_514683.1| NADH dehydrogenase subunit 9 [Oryza sativa Indica Group]
 gi|289065051|ref|YP_003433862.1| NADH dehydrogenase subunit 9 [Oryza rufipogon]
 gi|1101745|dbj|BAA08794.1| NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group]
 gi|56784284|dbj|BAD81966.1| Mitochondrion NADH dehydrogenase subunit 9 [Oryza sativa Japonica
           Group]
 gi|74100099|gb|AAZ99263.1| NADH dehydrogenase subunit 9 [Oryza sativa Indica Group]
 gi|74100154|gb|AAZ99317.1| NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group]
 gi|74100208|gb|AAZ99370.1| NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group]
 gi|164422243|gb|ABY55216.1| NADH dehydrogenase subunit 9 [Bambusa oldhamii]
 gi|285026133|dbj|BAI67966.1| NADH dehydrogenase subunit 9 [Oryza rufipogon]
 gi|285026183|dbj|BAI68015.1| NADH dehydrogenase subunit 9 [Oryza sativa Indica Group]
 gi|285026196|dbj|BAI68028.1| NADH dehydrogenase subunit 9 [Oryza sativa Indica Group]
          Length = 190

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 99/145 (68%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   +  
Sbjct: 41  LLCFLKWHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISP 100

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDK 161
           +V  +P A  +EREVWDM G+    HPDLRRI TDYGFEGHPLRKDFP++G+VE+ YDD 
Sbjct: 101 VVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSGYVEVRYDDP 160

Query: 162 VKKVVYRPVELMQEHRDYDFLSPWE 186
            K+VV  P+E+ QE R +DF SPWE
Sbjct: 161 EKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|94502590|ref|YP_588298.1| NADH dehydrogenase subunit 9 [Zea mays subsp. mays]
 gi|114151581|ref|YP_740371.1| NADH dehydrogenase subunit 9 [Zea perennis]
 gi|114151613|ref|YP_740429.1| NADH dehydrogenase subunit 9 [Zea luxurians]
 gi|114151647|ref|YP_740398.1| NADH dehydrogenase subunit 9 [Zea mays subsp. parviglumis]
 gi|115278549|ref|YP_762327.1| NADH dehydrogenase subunit 9 [Sorghum bicolor]
 gi|115278619|ref|YP_762490.1| NADH dehydrogenase subunit 9 [Tripsacum dactyloides]
 gi|40795029|gb|AAR91073.1| NADH dehydrogenase subunit 9 [Zea mays]
 gi|93116054|gb|ABE98687.1| NADH dehydrogenase subunit 9 [Zea mays subsp. mays]
 gi|93116098|gb|ABE98730.1| NADH dehydrogenase subunit 9 [Zea mays subsp. mays]
 gi|93116146|gb|ABE98777.1| NADH dehydrogenase subunit 9 [Zea mays subsp. mays]
 gi|102567915|gb|ABF70832.1| NADH dehydrogenase subunit 9 [Zea perennis]
 gi|102567980|gb|ABF70864.1| NADH dehydrogenase subunit 9 [Zea mays subsp. parviglumis]
 gi|102579647|gb|ABF70927.1| NADH dehydrogenase subunit 9 [Zea mays subsp. mays]
 gi|110287609|gb|ABG65655.1| NADH dehydrogenase subunit 9 [Zea luxurians]
 gi|114309670|gb|ABI60887.1| NADH dehydrogenase subunit 9 [Sorghum bicolor]
 gi|114432110|gb|ABI74659.1| NADH dehydrogenase subunit 9 [Tripsacum dactyloides]
          Length = 190

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 99/145 (68%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   +  
Sbjct: 41  LLCFLKWHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISP 100

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDK 161
           +V  +P A  +EREVWDM G+    HPDLRRI TDYGFEGHPLRKDFP++G+VE+ YDD 
Sbjct: 101 VVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSGYVEVRYDDP 160

Query: 162 VKKVVYRPVELMQEHRDYDFLSPWE 186
            K+VV  P+E+ QE R +DF SPWE
Sbjct: 161 EKRVVSEPIEMTQEFRYFDFASPWE 185


>gi|170698111|ref|ZP_02889191.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ambifaria
           IOP40-10]
 gi|172061207|ref|YP_001808859.1| NADH dehydrogenase subunit C [Burkholderia ambifaria MC40-6]
 gi|218534293|sp|B1YTQ5|NUOC_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|170136969|gb|EDT05217.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ambifaria
           IOP40-10]
 gi|171993724|gb|ACB64643.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ambifaria
           MC40-6]
          Length = 200

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  +IDL
Sbjct: 1   MASKIEILKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V   LS   N RLR+++   +     V S+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVSQLLSVTNNWRLRLRVFAPDDDLPIVASLVDIWTSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|157825616|ref|YP_001493336.1| NADH dehydrogenase subunit C [Rickettsia akari str. Hartford]
 gi|157799574|gb|ABV74828.1| NADH dehydrogenase subunit C [Rickettsia akari str. Hartford]
          Length = 207

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 107/158 (67%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRV 89
           L+  V+   L+     L++     F  + DL G DF  R  RF+VVY+ LS K N+RL +
Sbjct: 27  LAYKVELNFLLPFLKALKESAELRFTVLTDLFGADFPKRDKRFEVVYNLLSLKLNKRLII 86

Query: 90  KIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           K+ ++E +++PS + I+  A W+EREV+DMYG+ F+G+ D RRILTDY F+GHPLRKDFP
Sbjct: 87  KVYISEEETIPSAMNIFSTACWYEREVYDMYGVNFDGNDDKRRILTDYEFDGHPLRKDFP 146

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           +TG+ ++ YD+++K+V Y PV    E+R++DF S W  
Sbjct: 147 LTGYTQVKYDEQLKQVAYEPVNCDIEYREFDFSSHWHS 184


>gi|194289161|ref|YP_002005068.1| NADH dehydrogenase subunit c [Cupriavidus taiwanensis LMG 19424]
 gi|218534267|sp|B3R3W9|NUOC_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|193222996|emb|CAQ69001.1| NADH:ubiquinone oxidoreductase complex I, chain C [Cupriavidus
           taiwanensis LMG 19424]
          Length = 199

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K++ L   +  +    V+  V + GEL+L V   D + +   LRDDP   F  +IDLCGV
Sbjct: 3   KLDTLKAALEKALGKRVQNLVEATGELTLIVKADDYLDVAQILRDDPSLRFEQLIDLCGV 62

Query: 64  DFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+L  ++      RF  V   LS  +N RLR++   ++     +PS++ ++   +WFERE
Sbjct: 63  DYLEYADGAWDGPRFAAVSQLLSVTHNWRLRLRAFASDDDFPVLPSLINVWNSVNWFERE 122

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D YGI F+GHPDLRRILTDYGF GHP RKDFPV+GFVE+ YD   K+V+Y+PV +
Sbjct: 123 AFDFYGIVFDGHPDLRRILTDYGFVGHPFRKDFPVSGFVEMRYDPDQKRVIYQPVTI 179


>gi|134296431|ref|YP_001120166.1| NADH dehydrogenase subunit C [Burkholderia vietnamiensis G4]
 gi|218534284|sp|A4JGC8|NUOC_BURVG RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|134139588|gb|ABO55331.1| NADH dehydrogenase subunit C [Burkholderia vietnamiensis G4]
          Length = 200

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D + +   LRDDP   F  +IDL
Sbjct: 1   MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLEVAKTLRDDPKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+ +  +      RF  V   LS   N RLR+++   +     VPS+V  +  ++W+
Sbjct: 61  CGIDYQTYGDGAYDGPRFAAVSQLLSVTNNWRLRLRVFAPDDDLPIVPSLVDTWSSSNWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRR+LTDYGF GHP RKDFPV+G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRLLTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI 180


>gi|116202719|ref|XP_001227171.1| hypothetical protein CHGG_09244 [Chaetomium globosum CBS 148.51]
 gi|88177762|gb|EAQ85230.1| hypothetical protein CHGG_09244 [Chaetomium globosum CBS 148.51]
          Length = 284

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 48  DDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYP 107
           D+    F  +  +  VDF +R  RF++VY+ LS ++N R+RVK    E   VPS   ++ 
Sbjct: 117 DNTAAEFTQMSTITAVDFPTRDQRFEIVYNLLSVRHNSRIRVKTYADETTPVPSATPLFD 176

Query: 108 GADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVY 167
           GA+W+EREV+DM+G+FF  HPDLRRI+TDYGFEGHPLRKDFPVTG+ E+ +D++ K++V 
Sbjct: 177 GANWYEREVYDMFGVFFLNHPDLRRIMTDYGFEGHPLRKDFPVTGYTEIRWDEEKKRIVT 236

Query: 168 RPVELMQEHRDYD-FLSPWEGV 188
            P+EL Q  R+++   S WE +
Sbjct: 237 EPLELTQAFRNFEGGSSAWEQI 258


>gi|319761764|ref|YP_004125701.1| NADH (or f420h2) dehydrogenase, subunit c [Alicycliphilus
           denitrificans BC]
 gi|330826544|ref|YP_004389847.1| NADH (or F420H2) dehydrogenase subunit C [Alicycliphilus
           denitrificans K601]
 gi|317116325|gb|ADU98813.1| NADH (or F420H2) dehydrogenase, subunit C [Alicycliphilus
           denitrificans BC]
 gi|329311916|gb|AEB86331.1| NADH (or F420H2) dehydrogenase, subunit C [Alicycliphilus
           denitrificans K601]
          Length = 202

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 111/175 (63%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +    +R    ++GE+++ V   D ++    LRD P C F  +IDLCGVD+
Sbjct: 9   EKLRDAVAGALGDKLREIRLALGEVTVVVAAEDYLAAMEILRDAPQCRFEQLIDLCGVDY 68

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            +         R+ VV H LS   N+RLRVK+   +     +PS+ GI+ GA+WFERE +
Sbjct: 69  STYGEVGTDGPRYAVVTHLLSLSLNQRLRVKVFCPDDDFPVIPSVTGIWNGANWFEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D+YGI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY PV +
Sbjct: 129 DLYGIVFDGHNDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDAEQRRVVYEPVTI 183


>gi|299066335|emb|CBJ37519.1| NADH-quinone oxidoreductase subunit C [Ralstonia solanacearum
           CMR15]
          Length = 200

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    ++    +VGEL+L V   D +     LRDD    F  +IDL
Sbjct: 1   MTDKLATLQSALEKALGNRIQSLTEAVGELTLVVKAADYLETMRTLRDDAALKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS  +N R+RV++   +     V S+V I+  ADWF
Sbjct: 61  CGVDYSTYGDGAWNGPRFAAVSHLLSVTHNWRVRVRVFAPDDDLPVVASVVDIWNAADWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVTI 180


>gi|92084858|emb|CAI83762.1| NADH dehydrogenase subunit 9 [Helianthus annuus]
          Length = 190

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (65%), Gaps = 2/154 (1%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           + DC     L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 34  NTDCP--FQLLCFLQLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSPFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +D  SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASPWE 185


>gi|224365639|ref|YP_002608366.1| NADH dehydrogenase subunit 9 [Vitis vinifera]
 gi|209954163|emb|CAQ77607.1| NADH dehydrogenase subunit 9 [Vitis vinifera]
 gi|239764763|gb|ACS15232.1| NADH dehydrogenase subunit 9 [Vitis vinifera]
          Length = 190

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 32  DTNTDYPFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 91

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 92  ADEVTRISPVVSPFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 151

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +D  SPWE
Sbjct: 152 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASPWE 185


>gi|225465147|ref|XP_002277597.1| PREDICTED: similar to nad9 [Vitis vinifera]
          Length = 229

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 71  DTNTDYPFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 130

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 131 ADEVTRISPVVSPFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 190

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           +VE+ YDD  K+VV  P+E+ QE R +D  SPWE
Sbjct: 191 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASPWE 224


>gi|34496398|ref|NP_900613.1| NADH dehydrogenase subunit C [Chromobacterium violaceum ATCC 12472]
 gi|81656635|sp|Q7NZH9|NUOC_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|34102251|gb|AAQ58617.1| NADH-ubiquinone oxidoreductase, chain C [Chromobacterium violaceum
           ATCC 12472]
          Length = 198

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 8/178 (4%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           +K+E LG  +  +    +  +  ++ EL++     DL+S+   LRD     F   ID+CG
Sbjct: 4   KKMEALGSVVAEALGDKLVRSTLALDELTIVCKASDLLSVAQTLRDHADLAFEQCIDVCG 63

Query: 63  VDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFER 114
           +D+ +  +      RF  VYH LS K N R+R+++   +     +PS+ GI+  A+WFER
Sbjct: 64  MDYSAYRDEPWDGPRFAAVYHLLSVKLNHRIRLRVFAEDDDFPVIPSVNGIWNAANWFER 123

Query: 115 EVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           E +D+YGI FEGHPDLRR+LTDYGF GHP RKDFP++G+VE+ YD   ++V+Y+PV +
Sbjct: 124 EAFDLYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPLSGYVEMRYDPTQQRVIYQPVTI 181


>gi|325130971|gb|EGC53698.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           OX99.30304]
          Length = 197

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I+DL + +           ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IQDLYETVSRVLGNQAGKVISALGEITVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLS------RSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +      R  RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEAWRGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVNIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|10802934|gb|AAG23682.1|AF288091_27 NADH dehydrogenase subunit 9 [Thraustochytrium aureum]
          Length = 194

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 106/161 (65%), Gaps = 3/161 (1%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHF 78
           SV+   NS+    L +    L+ +  FL    +C +  + D+  VD+   +NRF+++Y+ 
Sbjct: 18  SVKIETNSIF---LSIKKEKLLEVLVFLAKHTNCNYTILSDITVVDYPKNNNRFEIIYNL 74

Query: 79  LSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           LS   N RL VKI       VPS+V ++  A+W+ERE +D++GIFF GHPDLRRILTDYG
Sbjct: 75  LSLTNNHRLFVKIQTNSNWFVPSMVTLFSNANWYEREAFDIFGIFFSGHPDLRRILTDYG 134

Query: 139 FEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           FEGHPLRKDFP+ GF E+ +D + K+V+  P+E+ QE R+Y
Sbjct: 135 FEGHPLRKDFPLNGFNEVRFDFEKKRVICEPLEISQEFRNY 175


>gi|282767720|gb|ADA85897.1| NADH hydrogenase subunit 9 [Allium cepa]
          Length = 186

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/146 (50%), Positives = 100/146 (68%), Gaps = 9/146 (6%)

Query: 50  PHCCFVNI---------IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
           P  CF+ +         ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   + 
Sbjct: 40  PVLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRIS 99

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V ++P A  +EREVWDM+G+    HPDLRRI TD+GFEGHPLRKDFP++G+VE+ YDD
Sbjct: 100 PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRISTDHGFEGHPLRKDFPLSGYVEVRYDD 159

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPWE 186
             K+VV  P+E+ QE R +D  SPWE
Sbjct: 160 PEKRVVSEPIEMTQEFRYFDSASPWE 185


>gi|325983287|ref|YP_004295689.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosomonas sp. AL212]
 gi|325532806|gb|ADZ27527.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosomonas sp. AL212]
          Length = 207

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 106/158 (67%), Gaps = 15/158 (9%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-----------RFDVVYH 77
           EL++ V+  D++ +   LRDD    F  +IDLCG+D+L   N           RF V+YH
Sbjct: 30  ELTIVVNAEDILEVSKVLRDDSALMFDTLIDLCGIDYLIYGNDLSAKYDLKDRRFAVIYH 89

Query: 78  FLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
            LS   N+RLRV++ +AE    P   S+  ++P A+WFERE +D+YGI F  HPDLRRIL
Sbjct: 90  LLSVVRNQRLRVRV-LAENNEFPAVHSVTEVWPAANWFEREAFDLYGIVFPDHPDLRRIL 148

Query: 135 TDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           TDYGF G+P RKDFP+TG+VE+ YD++ ++V+Y+PV +
Sbjct: 149 TDYGFIGNPFRKDFPITGYVEMRYDEQQRRVIYQPVSI 186


>gi|113867072|ref|YP_725561.1| NADH dehydrogenase subunit C [Ralstonia eutropha H16]
 gi|123329441|sp|Q0KCS8|NUOC_RALEH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|113525848|emb|CAJ92193.1| NADH dehydrogenase chain C [Ralstonia eutropha H16]
          Length = 198

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K++ L   +  +    V+  + + GEL+L V   D + +   LRDDP   F  +IDLCGV
Sbjct: 3   KLDILKAALEKALGKRVQNLIEATGELTLIVKADDYLEVARILRDDPSLRFEQLIDLCGV 62

Query: 64  DFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+    +      RF  V   LS  +N RLRV++   +     +PS++ ++ G +WFERE
Sbjct: 63  DYSEYGDGAWDGLRFAAVSQLLSITHNWRLRVRVFAPDDDFPVLPSLIDVWNGVNWFERE 122

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D YGI F+GHPDLRRILTDYGF GHP RKDFPV+GFVE+ YD + K+V+Y+PV +
Sbjct: 123 AFDFYGIVFDGHPDLRRILTDYGFVGHPFRKDFPVSGFVEMRYDPEQKRVIYQPVTI 179


>gi|73540666|ref|YP_295186.1| NADH dehydrogenase subunit C [Ralstonia eutropha JMP134]
 gi|123625483|sp|Q473U1|NUOC_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|72118079|gb|AAZ60342.1| NADH (or F420H2) dehydrogenase, subunit C [Ralstonia eutropha
           JMP134]
          Length = 199

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 110/177 (62%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K+E L   +       V+  + + GEL+L V   D + +   LRDDP   F  +IDLCGV
Sbjct: 3   KLETLKAALEKVLGKRVQKLIEATGELTLIVKADDYLEVARTLRDDPSLRFEQLIDLCGV 62

Query: 64  DFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+    +      RF  V H LS  +N RLR+++   +     VPS++ ++   +WFERE
Sbjct: 63  DYSDFGDGAWDGLRFAAVSHLLSVTHNWRLRLRVFAPDDDFPVVPSLIDVWNSVNWFERE 122

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D YGI FEGHPDLRR+LTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 123 AFDFYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVTI 179


>gi|124266598|ref|YP_001020602.1| NADH dehydrogenase (quinone) [Methylibium petroleiphilum PM1]
 gi|218534299|sp|A2SFM8|NUOC_METPP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|124259373|gb|ABM94367.1| NADH dehydrogenase (quinone) [Methylibium petroleiphilum PM1]
          Length = 203

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 113/184 (61%), Gaps = 12/184 (6%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KI+ L   +  + +G ++  V   GEL+L V   D +++C+ LRD        +IDL
Sbjct: 1   MDHKIDLLQPALEAALAGKIQALVRDRGELTLTVTAADYLAVCTTLRDHAELKLEQLIDL 60

Query: 61  CGVDFLSRSN----------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPG 108
           CG+D+ S  +          R+ VV H LS   N RLR+K+  A+     VPS+  I+  
Sbjct: 61  CGLDYSSYKDGAGSPYTEGPRYCVVLHLLSVSKNWRLRLKVFCADDGLPVVPSVNEIWAA 120

Query: 109 ADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYR 168
           A+WFERE +D+YGI FEGH DLRRILTDYGF GHP RKDFP TG VE+ YD + ++V+Y+
Sbjct: 121 ANWFEREAFDLYGIVFEGHADLRRILTDYGFIGHPFRKDFPTTGHVEMRYDAEQRRVIYQ 180

Query: 169 PVEL 172
           PV +
Sbjct: 181 PVTI 184


>gi|300703644|ref|YP_003745246.1| NADH-quinone oxidoreductase subunit C [Ralstonia solanacearum
           CFBP2957]
 gi|299071307|emb|CBJ42625.1| NADH-quinone oxidoreductase subunit C [Ralstonia solanacearum
           CFBP2957]
          Length = 200

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    ++    +VGEL+L V   D +     LRDD    F  +IDL
Sbjct: 1   MTDKLATLKAALEKALGDRIQSLTEAVGELTLVVKAADYLDAMRTLRDDAALKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS  +N RLRV++   +     V S+V ++  ADWF
Sbjct: 61  CGVDYSAYGDGAWNGPRFAAVSHLLSITHNWRLRVRVFAPDDDLPVVASVVDVWNAADWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVTI 180


>gi|308388463|gb|ADO30783.1| NADH dehydrogenase I chain C [Neisseria meningitidis alpha710]
          Length = 197

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|325203360|gb|ADY98813.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M01-240355]
          Length = 197

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|17546779|ref|NP_520181.1| NADH dehydrogenase subunit C [Ralstonia solanacearum GMI1000]
 gi|81504308|sp|Q8XXQ3|NUOC_RALSO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|17429079|emb|CAD15767.1| probable nadh dehydrogenaseI(chain c) oxidoreductase protein
           [Ralstonia solanacearum GMI1000]
          Length = 200

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    ++    +VGE++L V   D +     LRDD    F  +IDL
Sbjct: 1   MTDKLATLQSALEKALGNRIQSLTEAVGEITLVVKAADYLETMRTLRDDATLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS  +N R+RV++   +     V S+V ++  ADWF
Sbjct: 61  CGVDYSAYGDGAWNGPRFAAVSHLLSVTHNWRVRVRVFAPDDDLPVVASVVDVWNAADWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVTI 180


>gi|319638816|ref|ZP_07993574.1| NADH-quinone oxidoreductase subunit C [Neisseria mucosa C102]
 gi|317399720|gb|EFV80383.1| NADH-quinone oxidoreductase subunit C [Neisseria mucosa C102]
          Length = 197

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 116/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V  F       ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVFGEQAGKVISALGEITVECLPEHYISVMTALRDHEDLHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSIKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|47214471|emb|CAG12476.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 325

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 123/253 (48%), Gaps = 70/253 (27%)

Query: 4   KIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++   G+Y+       V+   V    EL + +    ++ + +FLRD  +  F N+IDL  
Sbjct: 53  QLAAFGEYVSEMMPKYVQQVQVTCYNELEVMIHPDGVIPVLTFLRDHTNAQFRNMIDLTA 112

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREV------ 116
           VD  +R NRF++VY+ LS ++N R+RVK    E   V S V ++  A+W+EREV      
Sbjct: 113 VDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPVDSAVPVHIAANWYEREVSVGPRV 172

Query: 117 -------------------WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVE-- 155
                              WDM+G+FF  HPDLRRILTDYGFEGHP RKDFP++G+VE  
Sbjct: 173 RRRDGVCEDAGDRNLRVQVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEVS 232

Query: 156 ------------------------------------------LHYDDKVKKVVYRPVELM 173
                                                     + YDD+VK+VV  PVEL 
Sbjct: 233 SLLPVRTVLRISFMTVADVGWSLKSALLFRFPVLKALLLLPQVRYDDEVKRVVAEPVELS 292

Query: 174 QEHRDYDFLSPWE 186
           QE R +D  +PWE
Sbjct: 293 QEFRKFDLNTPWE 305


>gi|296313745|ref|ZP_06863686.1| NADH dehydrogenase, C subunit [Neisseria polysaccharea ATCC 43768]
 gi|296839668|gb|EFH23606.1| NADH dehydrogenase, C subunit [Neisseria polysaccharea ATCC 43768]
          Length = 197

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNELWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|218767067|ref|YP_002341579.1| NADH dehydrogenase subunit C [Neisseria meningitidis Z2491]
 gi|241760669|ref|ZP_04758761.1| NADH-quinone oxidoreductase, c subunit [Neisseria flavescens SK114]
 gi|261379578|ref|ZP_05984151.1| NADH dehydrogenase, C subunit [Neisseria subflava NJ9703]
 gi|11134094|sp|Q9JX80|NUOC_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|121051075|emb|CAM07345.1| NADH dehydrogenase I chain C [Neisseria meningitidis Z2491]
 gi|241318850|gb|EER55376.1| NADH-quinone oxidoreductase, c subunit [Neisseria flavescens SK114]
 gi|284798052|gb|EFC53399.1| NADH dehydrogenase, C subunit [Neisseria subflava NJ9703]
 gi|319411274|emb|CBY91681.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C;
           NDH-1, chain C) [Neisseria meningitidis WUE 2594]
 gi|325129041|gb|EGC51891.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           N1568]
          Length = 197

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|83746299|ref|ZP_00943352.1| NADH-quinone oxidoreductase chain C [Ralstonia solanacearum UW551]
 gi|207723875|ref|YP_002254273.1| nadh dehydrogenaseI(chain c) protein [Ralstonia solanacearum MolK2]
 gi|207742737|ref|YP_002259129.1| nadh dehydrogenaseI(chain c) protein [Ralstonia solanacearum
           IPO1609]
 gi|83727049|gb|EAP74174.1| NADH-quinone oxidoreductase chain C [Ralstonia solanacearum UW551]
 gi|206589080|emb|CAQ36042.1| nadh dehydrogenaseI(chain c) protein [Ralstonia solanacearum MolK2]
 gi|206594131|emb|CAQ61058.1| nadh dehydrogenaseI(chain c) protein [Ralstonia solanacearum
           IPO1609]
          Length = 200

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +       ++    +VGEL+L V   D + +   LRDD    F  +IDL
Sbjct: 1   MTDKLATLKAALEKVLGDRIQSLTEAVGELTLVVKAADYLDVMRTLRDDATLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS  +N RLRV++   +     V S+V ++  ADWF
Sbjct: 61  CGVDYSAYGDGAWNGPRFAAVSHLLSVTHNWRLRVRVFAPDDDLPVVASVVDVWNAADWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVTI 180


>gi|254805715|ref|YP_003083936.1| NADH dehydrogenase I chain C [Neisseria meningitidis alpha14]
 gi|304389068|ref|ZP_07371112.1| NADH-quinone oxidoreductase subunit C [Neisseria meningitidis ATCC
           13091]
 gi|254669257|emb|CBA08151.1| NADH dehydrogenase I chain C [Neisseria meningitidis alpha14]
 gi|304336941|gb|EFM03131.1| NADH-quinone oxidoreductase subunit C [Neisseria meningitidis ATCC
           13091]
          Length = 197

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|187929291|ref|YP_001899778.1| NADH dehydrogenase subunit C [Ralstonia pickettii 12J]
 gi|218534309|sp|B2U7Q9|NUOC_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|187726181|gb|ACD27346.1| NADH (or F420H2) dehydrogenase, subunit C [Ralstonia pickettii 12J]
          Length = 200

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 108/180 (60%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    V+    SVGEL+L V   D +     LRDD    F  ++DL
Sbjct: 1   MTDKLATLKAALEKALGNRVQSLTESVGELTLVVKAADYLDAMRTLRDDASLKFEQLMDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+    +      RF  V H LS  +N R+RV++   +     V S+  I+  ADWF
Sbjct: 61  CGVDYADYGDGAWNGPRFAAVSHLLSITHNWRVRVRVFAPDDDLPVVSSVTTIWNSADWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVVYQPVTI 180


>gi|257095317|ref|YP_003168958.1| NADH (or F420H2) dehydrogenase subunit C [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047841|gb|ACV37029.1| NADH (or F420H2) dehydrogenase, subunit C [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 202

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 112/177 (63%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
            +E L   +       V+    ++GE++++VD  D +++   LRD+P   F  +IDLCGV
Sbjct: 5   TLEALSHTLQEHLGDRVKSLKVALGEVTVEVDAADYLAVMQTLRDEPALSFEELIDLCGV 64

Query: 64  DFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+ + +N      RF  V H +S   N RLRV+    +    SVPS+ G++  ADWFERE
Sbjct: 65  DYSTYANAPRAGRRFAAVSHLISITRNWRLRVRCFAPDDDFPSVPSVTGVWNVADWFERE 124

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D++GI F GH DLRRILTDYGF GHP RKDFP++G+VE+ YD   ++V+Y+PV +
Sbjct: 125 AFDLFGIVFPGHLDLRRILTDYGFIGHPFRKDFPISGYVEMRYDPDQQRVIYQPVTI 181


>gi|332526749|ref|ZP_08402851.1| NADH dehydrogenase (quinone) [Rubrivivax benzoatilyticus JA2]
 gi|332111152|gb|EGJ11184.1| NADH dehydrogenase (quinone) [Rubrivivax benzoatilyticus JA2]
          Length = 199

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 115/180 (63%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +++ L   + ++ +G +R +V ++GE+++ V   D + +   LRD P   F  ++DL
Sbjct: 1   MSIRLDLLQSALESALAGKIRTSVRALGEITITVGAADYLDVARTLRDTPELRFEQLVDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+    N      RF VV H LS  +N RLR+K+   +     V S+  I+  A+WF
Sbjct: 61  CGVDYSDYRNQPWDGPRFCVVSHLLSVTHNWRLRLKVFCPDDDLPVVASVNDIWGSANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGH DLRRILTDYGF GHP+RKDFP TG VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDLYGIVFEGHLDLRRILTDYGFIGHPMRKDFPTTGNVEMRYDPEKKRVIYQPVTI 180


>gi|270158112|ref|ZP_06186769.1| NADH-quinone oxidoreductase C subunit [Legionella longbeachae
           D-4968]
 gi|289163623|ref|YP_003453761.1| NADH dehydrogenase I chain C [Legionella longbeachae NSW150]
 gi|269990137|gb|EEZ96391.1| NADH-quinone oxidoreductase C subunit [Legionella longbeachae
           D-4968]
 gi|288856796|emb|CBJ10607.1| NADH dehydrogenase I chain C [Legionella longbeachae NSW150]
          Length = 227

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 115/199 (57%), Gaps = 35/199 (17%)

Query: 9   GDYIVNSFSGSVRFAVNSV----GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
            DY+V      +   V+ V     E++++VD  +L ++   LRD    CF  +IDLC VD
Sbjct: 4   NDYLVEQLKSELASYVDGVSVAHNEVTIEVDVSNLKAVMHELRDLESFCFDQLIDLCAVD 63

Query: 65  FL-----------------SR-------------SNRFDVVYHFLSPKYNRRLRVKIAVA 94
           +L                 SR               RF VVYH LS K N R+RVK+ V 
Sbjct: 64  YLLYGQYDWETDAATEKGFSRGVERQETKACTLDKPRFAVVYHLLSTKKNHRIRVKVFVD 123

Query: 95  EGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           E    VPS+  ++ GA+WFERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFP++G 
Sbjct: 124 ESHLIVPSVHDLWKGANWFEREAYDLYGVLFEGHPDLRRILTDYGFIGHPFRKDFPLSGH 183

Query: 154 VELHYDDKVKKVVYRPVEL 172
           VE+ YD K +KV+Y PV++
Sbjct: 184 VEMRYDAKSEKVIYAPVDI 202


>gi|15676167|ref|NP_273299.1| NADH dehydrogenase subunit C [Neisseria meningitidis MC58]
 gi|11134102|sp|Q9K1C1|NUOC_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|7225465|gb|AAF40697.1| NADH dehydrogenase I, C subunit [Neisseria meningitidis MC58]
 gi|316985171|gb|EFV64123.1| NADH-quinone oxidoreductase subunit C [Neisseria meningitidis
           H44/76]
 gi|325141079|gb|EGC63582.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           CU385]
 gi|325199446|gb|ADY94901.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           H44/76]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I+DL + +           ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQDLYETVSRVLGNQAGKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|261391775|emb|CAX49230.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C;
           NDH-1, chain C) [Neisseria meningitidis 8013]
          Length = 197

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS + N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVQNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|309781854|ref|ZP_07676587.1| NADH dehydrogenase (ubiquinone), C subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308919495|gb|EFP65159.1| NADH dehydrogenase (ubiquinone), C subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 200

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 108/180 (60%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    V+    S+GEL+L V   D   +   LRDD    F  +IDL
Sbjct: 1   MTEKLATLKAALEKALGDRVQSLTESIGELTLVVKAADYYDVMRTLRDDASLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+    +      RF  V H LS  +N R+RV++   +     V S+  I+  ADW+
Sbjct: 61  CGVDYADYGDGAWNGPRFAAVSHLLSITHNWRVRVRVFAPDDDLPVVASVTTIWNSADWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVVYQPVTI 180


>gi|238028141|ref|YP_002912372.1| NADH dehydrogenase subunit C [Burkholderia glumae BGR1]
 gi|237877335|gb|ACR29668.1| NADH (or F420H2) dehydrogenase, subunit C [Burkholderia glumae
           BGR1]
          Length = 200

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     +VGEL+L V   D + + + LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGERVVSLTEAVGELTLVVRARDYIEVATLLRDDRKLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V   LS   N RLR+++   +     + S+V I+  A+W+
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVLQLLSITNNWRLRLRVFAPDDDLPIIASVVDIWNSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G+VE+ YD + K+VVY+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGYVEMRYDPEEKRVVYQPVTI 180


>gi|166895614|ref|YP_001661408.1| NADH dehydrogenase subunit 9 [Cycas taitungensis]
 gi|166706946|dbj|BAF98410.1| NADH dehydrogenase subunit 9 [Cycas taitungensis]
          Length = 197

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 100/143 (69%), Gaps = 4/143 (2%)

Query: 58  IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVW 117
           ID+ GVD+ SR  RF+VV++  S +YN R+RV+ +V E   +  +V  +P A  +EREVW
Sbjct: 57  IDIRGVDYPSRKRRFEVVHNSPSTRYNPRIRVRTSVDEITRISPVVSPFPSAGRWEREVW 116

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR 177
           DM G++   HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD  K+ V  P+ + QE R
Sbjct: 117 DMSGVYSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDDSEKRAVSEPIGMTQEFR 176

Query: 178 DYDFLSPWEGVNSLFAKEDSKDD 200
            +DF SPWE +    A+ D  D+
Sbjct: 177 YFDFASPWEQM----ARSDGSDN 195


>gi|171058187|ref|YP_001790536.1| NADH (or F420H2) dehydrogenase subunit C [Leptothrix cholodnii
           SP-6]
 gi|218534295|sp|B1Y829|NUOC_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|170775632|gb|ACB33771.1| NADH (or F420H2) dehydrogenase, subunit C [Leptothrix cholodnii
           SP-6]
          Length = 199

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M +K++ L   I       +   V   GEL+L V   D  ++   LRD P   F  +ID+
Sbjct: 1   MTQKLDTLQAAIERVIGDRIVHLVRDRGELTLTVKATDYAAIGKTLRDHPDLGFEQLIDI 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+    +      R+  V H LS ++N RLR+K+   +     V S+  I+ GA+WF
Sbjct: 61  CGVDYSGYKDGGYEGLRYAAVSHLLSVQHNWRLRLKVFAPDDDFPLVASLTPIWSGANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +DMYGI F+GH DLRRILTDYGF GHP+RKDFPVTG VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDMYGIVFDGHTDLRRILTDYGFIGHPMRKDFPVTGHVEMRYDPEQKRVIYQPVSI 180


>gi|74317162|ref|YP_314902.1| NADH dehydrogenase subunit C [Thiobacillus denitrificans ATCC
           25259]
 gi|123611052|sp|Q3SEX6|NUOC_THIDA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|74056657|gb|AAZ97097.1| NADH dehydrogenase I chain C [Thiobacillus denitrificans ATCC
           25259]
          Length = 200

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 111/186 (59%), Gaps = 10/186 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +E L   + N+   ++   +  +GEL+L V           LRD P C F  +IDL
Sbjct: 1   MSITLESLSACLKNALGDALVQTIERLGELTLVVKPQAYAPAMLALRDHPDCRFEQLIDL 60

Query: 61  CGVDFLS------RSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+           RF VV H LS   N R+RV++   +    +V S+V I+P A WF
Sbjct: 61  CGVDYSGYGEGAWEGPRFAVVAHLLSVSKNARVRVRVFCPDDDLPAVASVVDIWPAASWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGNVEMRYDPTQQRVIYQPVSI 180

Query: 173 MQEHRD 178
             E RD
Sbjct: 181 --EPRD 184


>gi|308311749|gb|ADO27643.1| nad9 [Rhizanthella gardneri]
          Length = 190

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 74/146 (50%), Positives = 97/146 (66%), Gaps = 9/146 (6%)

Query: 50  PHCCFVNI---------IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
           P  CF+ +         ID+CGVD  SR  RF VV++ LS +YN R+RV+ +  E   + 
Sbjct: 40  PLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFSVVHNLLSTRYNSRIRVQTSADEVTRIS 99

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V  +P A  +EREVWDM G+    HPDLRRI TD+GFEGHPLRKDFP++G+VE+ YDD
Sbjct: 100 PVVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDFPLSGYVEVRYDD 159

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPWE 186
             K+VV  P+E+ QE R +D  SPWE
Sbjct: 160 PEKRVVSEPIEMTQEFRYFDSASPWE 185


>gi|57239035|ref|YP_180171.1| NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578976|ref|YP_197188.1| NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617034|ref|YP_196233.1| NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium str.
           Gardel]
 gi|57161114|emb|CAH58024.1| putative NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58416646|emb|CAI27759.1| NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium str.
           Gardel]
 gi|58417602|emb|CAI26806.1| NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 191

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 98/142 (69%)

Query: 45  FLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVG 104
           FL +D  C F  +ID+  VD+  R  RF+++Y  LS   N R+  K+++ E +++ SI  
Sbjct: 46  FLCNDRICKFQILIDIFIVDYPHREARFEIIYSLLSIANNIRIFCKVSLHENENITSITN 105

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           I+  A WFERE +DMYGI F  +PDLRRILTDYGF GHP+ KDFP++G+ E+ YD   K+
Sbjct: 106 IFNAAGWFEREAFDMYGILFTNNPDLRRILTDYGFSGHPMLKDFPLSGYKEVRYDIAKKE 165

Query: 165 VVYRPVELMQEHRDYDFLSPWE 186
           V+Y PV L Q+ R +DFLSPW+
Sbjct: 166 VIYEPVNLQQDFRSFDFLSPWK 187


>gi|300691027|ref|YP_003752022.1| NADH-quinone oxidoreductase subunit C [Ralstonia solanacearum
           PSI07]
 gi|299078087|emb|CBJ50730.1| NADH-quinone oxidoreductase subunit C [Ralstonia solanacearum
           PSI07]
          Length = 200

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    ++    +VGE++L V   D +     LRDD    F  +IDL
Sbjct: 1   MTDKLATLKAALEKALGNRIQGLTEAVGEITLLVKAADYLETMRTLRDDVTLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF  V H LS  +N RLRV++   +     V S+V I+  A+WF
Sbjct: 61  CGVDYSAYGDGAWNGPRFAAVSHLLSVTHNWRLRVRVFAPDDDLPVVASVVDIWDAANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVIYQPVTI 180


>gi|293603921|ref|ZP_06686336.1| NADH-quinone oxidoreductase subunit C [Achromobacter piechaudii
           ATCC 43553]
 gi|292817758|gb|EFF76824.1| NADH-quinone oxidoreductase subunit C [Achromobacter piechaudii
           ATCC 43553]
          Length = 208

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 19/190 (10%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +    +     ++GEL+L+V      ++C+ LR +    F   IDL
Sbjct: 1   MMTRLESLKNNLQTTLGADIAL-TEALGELTLEVPAQQWFAVCNKLRTEAGLRFETCIDL 59

Query: 61  CGVDFLSRSN----------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSI 102
           CGVD+L+  N                RF VV H LS ++N RLRV+   A  E   V S+
Sbjct: 60  CGVDYLTWGNGTRQLPEEPGAKVHRARFAVVIHLLSIEHNWRLRVRTWAADDEFPIVASL 119

Query: 103 VGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKV 162
           +  +P   WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + 
Sbjct: 120 MECWPAVGWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQ 179

Query: 163 KKVVYRPVEL 172
           ++V+Y+PV +
Sbjct: 180 RRVIYQPVTI 189


>gi|254674106|emb|CBA09890.1| respiratory-chain NADH dehydrogenase, 30 kDa subunit [Neisseria
           meningitidis alpha275]
          Length = 197

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQAGKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDNFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|152980703|ref|YP_001353154.1| NADH dehydrogenase I chain C [Janthinobacterium sp. Marseille]
 gi|218534294|sp|A6SY07|NUOC_JANMA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|151280780|gb|ABR89190.1| NADH dehydrogenase I chain C [Janthinobacterium sp. Marseille]
          Length = 198

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + N+    ++    ++GE+++ V   D  S    LRD     F  +IDL
Sbjct: 1   MTIKLELLEAALRNALGDQLQSLTQALGEVTIVVKSHDYASAMRVLRDHADLRFEEMIDL 60

Query: 61  CGVDF------LSRSNRFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
           CGVD+      L    RF VV H LS K+N R+RV++  A  E   V S++ I+  A+W+
Sbjct: 61  CGVDYSTYGDGLWEGPRFAVVSHLLSIKHNWRVRVRVFAADDEMPVVASMIDIWATANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D +GI FEGH DLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDFFGILFEGHNDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVTI 180


>gi|148695559|gb|EDL27506.1| mCG13496, isoform CRA_b [Mus musculus]
          Length = 244

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 105/157 (66%), Gaps = 1/157 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V+ + EL + +    ++   +FLRD  +  F ++ DL 
Sbjct: 55  KQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLT 114

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E   + SIV ++  A+W+EREVWDM+G
Sbjct: 115 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFG 174

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VE+H+
Sbjct: 175 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVEIHF 211


>gi|87043014|ref|YP_492628.1| NADH dehydrogenase subunit 9 [Dictyostelium citrinum]
 gi|122000118|sp|Q2LCR4|NDUS3_DICCI RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
 gi|84682114|gb|ABC60379.1| NADH dehydrogenase subunit 9 [Dictyostelium citrinum]
          Length = 209

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 115/183 (62%), Gaps = 4/183 (2%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           DLG+ +  S  G ++  +     L + V+  +L+ +  FL++        ++D+  +D L
Sbjct: 13  DLGENLRGSIPGLIKKVMYKTQYLEIQVEKKNLLPVLRFLKESSKYQCTMLLDIVCIDCL 72

Query: 67  S----RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +    +  RF ++Y   S   N R+ +   V     + +  G++  + W ERE+WDM+GI
Sbjct: 73  NIEEIKIGRFKIIYVLNSIYNNTRVHISTYVENNGIIETTSGLFESSVWLEREIWDMFGI 132

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           +FE HPDLRRILTDYGF G+PL+KDFP+TG++E++YD   KK++Y+P+ELMQE+R+Y+F 
Sbjct: 133 YFEKHPDLRRILTDYGFVGYPLKKDFPITGYLEVYYDVADKKIIYKPIELMQEYRNYNFG 192

Query: 183 SPW 185
           + W
Sbjct: 193 AVW 195


>gi|221068610|ref|ZP_03544715.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           KF-1]
 gi|220713633|gb|EED69001.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           KF-1]
          Length = 203

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 111/175 (63%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +    VR    + GE++++V  G  + +   LR+ P C F  ++DLCGVD+
Sbjct: 9   EKLRDVVTAALGDKVRSVTLAYGEVTVEVSAGQYLDVMQILRNAPDCQFEMLLDLCGVDY 68

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            + +       RF VV H +S   N+RLRV++  A+     V SI  I+  A+WFERE +
Sbjct: 69  STYAEVGKDGPRFAVVSHLMSLTLNQRLRVRVYCADDDFPVVASINPIWNSANWFEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI FEGH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY+PV +
Sbjct: 129 DLFGIVFEGHEDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDAEQQRVVYQPVTI 183


>gi|296040737|gb|ADG85336.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
          Length = 144

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 71/132 (53%), Positives = 94/132 (71%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 13  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQT 72

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 73  SADEVTRISSVVSLFPSAGWWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLS 132

Query: 152 GFVELHYDDKVK 163
           G+VE+ YDD  K
Sbjct: 133 GYVEVRYDDPEK 144


>gi|94309874|ref|YP_583084.1| NADH dehydrogenase subunit C [Cupriavidus metallidurans CH34]
 gi|218534311|sp|Q1LPW1|NUOC_RALME RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|93353726|gb|ABF07815.1| NADH dehydrogenase chain C [Cupriavidus metallidurans CH34]
          Length = 199

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 104/161 (64%), Gaps = 8/161 (4%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFD 73
           V+  + + GEL+L V   D + +   LRDDP   F  ++DLCGVD+   +       RF 
Sbjct: 19  VQNLIEATGELTLIVKAADYLEVARLLRDDPSLRFEQLLDLCGVDYSDYAEGAWDGLRFA 78

Query: 74  VVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
            V   LS  +N RLR+++   +     +PS++ ++   +WFERE +D YGI FEGHPDLR
Sbjct: 79  AVSQLLSVTHNWRLRLRVFAPDDDFPVLPSVINVWNSVNWFEREAFDFYGIVFEGHPDLR 138

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           RILTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 139 RILTDYGFVGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVTI 179


>gi|229328252|ref|YP_002860265.1| NADH dehydrogenase subunit 9 [Megaceros aenigmaticus]
 gi|186695221|gb|ACC86788.1| NADH dehydrogenase subunit 9 [Nothoceros aenigmaticus]
          Length = 191

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (67%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  F +   +  F  +ID+ GVD+ SR  RF+VV++  S +YN R+RV+ +V E   
Sbjct: 37  LFELLWFPKHHTNTRFQVLIDIRGVDYPSRKRRFEVVHNSPSIRYNSRIRVESSVNEITP 96

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+VGI+P A W+EREVWDM+G +   HPD RRI  DYG EGH LRKD P++G+ E+ Y
Sbjct: 97  ICSVVGIFPSAGWWEREVWDMFGAYSSNHPDSRRISIDYGSEGHLLRKDLPLSGYFEVRY 156

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 157 DDSEKRVVSEPIEMTQESRYFDFASPWE 184


>gi|187477543|ref|YP_785567.1| NADH dehydrogenase subunit C [Bordetella avium 197N]
 gi|123513816|sp|Q2KV11|NUOC_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|115422129|emb|CAJ48653.1| NADH dehydrogenase I chain C [Bordetella avium 197N]
          Length = 206

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 116/188 (61%), Gaps = 17/188 (9%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +    +     ++GEL+L+V     +++C+ LR D    F + IDL
Sbjct: 1   MMTRLETLKNNLQATLGQDIAL-TEALGELTLEVPADQWLTVCNKLRTDAGLRFESCIDL 59

Query: 61  CGVDFLS--------------RSNRFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVG 104
           CG+D+ +              R  RF VV H LS ++N RLRV+      E   V S++ 
Sbjct: 60  CGMDYQTWGDGSHANAHDEPARPGRFAVVIHLLSIEHNWRLRVRTYAVDEEFPIVASLIE 119

Query: 105 IYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
            +PG +W+ERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + K+
Sbjct: 120 CWPGVNWYEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQKR 179

Query: 165 VVYRPVEL 172
           V+Y+PV +
Sbjct: 180 VIYQPVTI 187


>gi|261400471|ref|ZP_05986596.1| NADH-quinone oxidoreductase chain 5 [Neisseria lactamica ATCC
           23970]
 gi|269209730|gb|EEZ76185.1| NADH-quinone oxidoreductase chain 5 [Neisseria lactamica ATCC
           23970]
 gi|309379801|emb|CBX21577.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|325137070|gb|EGC59666.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M0579]
 gi|325202928|gb|ADY98382.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M01-240149]
 gi|325207274|gb|ADZ02726.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQAGKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|255067283|ref|ZP_05319138.1| NADH-quinone oxidoreductase chain 5 [Neisseria sicca ATCC 29256]
 gi|255048434|gb|EET43898.1| NADH-quinone oxidoreductase chain 5 [Neisseria sicca ATCC 29256]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L D +           ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYDTVSRVLGNQASKVISALGEVTVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V +Y  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|296040735|gb|ADG85335.1| NADH dehydrogenase subunit 9 [Silene paradoxa]
          Length = 144

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/132 (53%), Positives = 94/132 (71%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   L  L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 13  FDTNTDYLFQLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQT 72

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + S+V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 73  SADEVTRISSVVSLFPSAGWWEREVWDMFGLSFINHPDLRRILTDYGFEGHPLRKDFPLS 132

Query: 152 GFVELHYDDKVK 163
           G+VE+ YDD  K
Sbjct: 133 GYVEVRYDDPEK 144


>gi|325135046|gb|EGC57674.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M13399]
 gi|325145307|gb|EGC67585.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M01-240013]
 gi|325205328|gb|ADZ00781.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M04-240196]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + ++          ++++GE++++      +S  + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVIGVLGNQAGKVISALGEITVECLPEHYISAMTALRDHEDLHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|11466473|ref|NP_038176.1| NADH dehydrogenase subunit 9 [Chrysodidymus synuroideus]
 gi|7110470|gb|AAF36942.1|AF222718_16 NADH dehydrogenase subunit 9 [Chrysodidymus synuroideus]
          Length = 177

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 92/127 (72%)

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           + GVD L    RF VVY  LS  +N RLR+K+ + E  ++PS+  IY  ++W+EREVWD+
Sbjct: 51  IAGVDLLGCKYRFCVVYDLLSLSFNIRLRIKLFITEVNTIPSVTDIYVNSNWWEREVWDL 110

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +GI+FE HPDLRRILTDYGFEG+P+RKDFP+ G+ EL YD+  K++V   VEL Q  R +
Sbjct: 111 FGIYFENHPDLRRILTDYGFEGYPMRKDFPLYGYTELRYDESKKQIVVESVELSQNFRLF 170

Query: 180 DFLSPWE 186
           +F  PW+
Sbjct: 171 EFEMPWQ 177


>gi|262216847|gb|ACY37808.1| NADH dehydrogenase subunit 9 [Bremia lactucae]
 gi|262216850|gb|ACY37810.1| NADH dehydrogenase subunit 9 [Bremia lactucae]
 gi|262216853|gb|ACY37812.1| NADH dehydrogenase subunit 9 [Bremia lactucae]
          Length = 113

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 91/110 (82%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI++ E + + SI+GIY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKISLNELQPIDSIIGIYKSANWSEREVWDMFGIFFSNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY+P+ L Q++R ++F +PW
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEIFYNELKKRVVYKPINLSQQYRLFEFNNPW 110


>gi|134095029|ref|YP_001100104.1| putative NADH-quinone oxidoreductase chain C [Herminiimonas
           arsenicoxydans]
 gi|218534292|sp|A4G642|NUOC_HERAR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|133738932|emb|CAL61979.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           (NDH-1, chain C) [Herminiimonas arsenicoxydans]
          Length = 198

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 113/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + N+    ++    ++GE+++ V+  D  S    LRD     F  +IDL
Sbjct: 1   MTIKLELLESALRNALGDQLQSLTLALGEITIVVNSRDYASAMRVLRDHADLRFEELIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF VV H LS  +N R+RV++  +  E   V S+  I+P A+W+
Sbjct: 61  CGVDYSTYGDGAWDGQRFAVVSHLLSITHNWRVRVRVFASDDEMPVVASMTEIWPAANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D +GI FEGH DLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDFFGILFEGHNDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVTI 180


>gi|261364349|ref|ZP_05977232.1| NADH-quinone oxidoreductase chain 5 [Neisseria mucosa ATCC 25996]
 gi|288567613|gb|EFC89173.1| NADH-quinone oxidoreductase chain 5 [Neisseria mucosa ATCC 25996]
          Length = 197

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I  L + +V          ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IHKLYETVVRVLGNQASKVISALGEITVECLPEHYVSIMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V +Y  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|241663482|ref|YP_002981842.1| NADH dehydrogenase subunit C [Ralstonia pickettii 12D]
 gi|240865509|gb|ACS63170.1| NADH (or F420H2) dehydrogenase, subunit C [Ralstonia pickettii 12D]
          Length = 200

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 108/180 (60%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+  L   +  +    V+    S+GEL+L V   D   +   LRDD    F  +IDL
Sbjct: 1   MTEKLATLKAALEKALGDRVQSLTESIGELTLVVKAADYYDVMRTLRDDASLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+    +      RF  V H LS  +N R+RV++   +     V S+  I+  ADW+
Sbjct: 61  CGVDYADYGDGAWNGPRFAGVSHLLSITHNWRVRVRVFAPDDDLPVVASVTTIWNSADWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD   ++VVY+PV +
Sbjct: 121 EREAFDLYGLVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPVQRRVVYQPVTI 180


>gi|161870821|ref|YP_001599994.1| NADH dehydrogenase subunit C [Neisseria meningitidis 053442]
 gi|218534321|sp|A9M3E0|NUOC_NEIM0 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|161596374|gb|ABX74034.1| NADH dehydrogenase I chain C [Neisseria meningitidis 053442]
          Length = 197

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 115/176 (65%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V +Y  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|225077018|ref|ZP_03720217.1| hypothetical protein NEIFLAOT_02070 [Neisseria flavescens
           NRL30031/H210]
 gi|224951575|gb|EEG32784.1| hypothetical protein NEIFLAOT_02070 [Neisseria flavescens
           NRL30031/H210]
          Length = 197

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQAGKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD+  K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEAQKRVIYQPVTI 179


>gi|56791594|gb|AAW30335.1| NADH dehydrogenase subunit 9 [Berberis bealei]
          Length = 179

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/144 (50%), Positives = 96/144 (66%), Gaps = 9/144 (6%)

Query: 50  PHCCFVNI---------IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
           P  CF+ +         ID+CGVD  SR  RF+VVY+ LS +YN R+RV+    E   + 
Sbjct: 36  PLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTCADEVTRIS 95

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V  +P A W+EREVWDM+G+    HPDLRRI TD+GFEGHPLRKD P++G+VE+ YDD
Sbjct: 96  PVVSPFPSAGWWEREVWDMFGVSSINHPDLRRISTDHGFEGHPLRKDLPLSGYVEVRYDD 155

Query: 161 KVKKVVYRPVELMQEHRDYDFLSP 184
             K+VV  P+E+ QE R +D  SP
Sbjct: 156 PEKRVVSEPIEMTQEFRYFDSASP 179


>gi|253807638|gb|ACT36216.1| NADH dehydrogenase subunit 9 [Helicosporidium sp. ex Simulium
           jonesi]
          Length = 259

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 101/152 (66%), Gaps = 9/152 (5%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAE--- 95
           L+S   FL++  +  +  +ID+  VD+ S+ NRF++VY+ LS +YN R+ VK  V E   
Sbjct: 101 LLSFLDFLKNHMNTQYKVLIDITAVDYPSKYNRFEIVYNLLSVQYNNRIIVKTIVDEYSN 160

Query: 96  ------GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
                  + V S   +Y  A W+EREVWDM+GIFF+ +PDLRRILTDYGF GHPLRKDFP
Sbjct: 161 INSQNYSQCVDSSQSLYSCATWYEREVWDMFGIFFKNNPDLRRILTDYGFSGHPLRKDFP 220

Query: 150 VTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           ++G+ E+ YDD  K+V+   +E  QE R +D+
Sbjct: 221 LSGYKEVRYDDSEKRVITESIECSQEFRSFDY 252


>gi|120609952|ref|YP_969630.1| NADH (or F420H2) dehydrogenase subunit C [Acidovorax citrulli
           AAC00-1]
 gi|218534248|sp|A1TLL8|NUOC_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|120588416|gb|ABM31856.1| NADH dehydrogenase subunit C [Acidovorax citrulli AAC00-1]
          Length = 202

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 110/175 (62%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +    VR  V ++ EL++ V   D ++    LRD P C F  ++DLCG+D+
Sbjct: 9   EALRDAVAAALGDKVRDIVLALDELTVTVSAADYLAAMQLLRDAPGCRFEQLMDLCGIDY 68

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            +  +      R+ VV H LS   N+R+RVK+   +     V S+ GI+  A+W+ERE +
Sbjct: 69  STYGDVGTEGPRYAVVSHLLSVSLNQRVRVKVFCPDDDFPVVASVSGIWNSANWYEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D+YGI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY PV +
Sbjct: 129 DLYGIVFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDTEARRVVYEPVTI 183


>gi|254670955|emb|CBA07621.1| respiratory-chain NADH dehydrogenase, 30 kDa subunit [Neisseria
           meningitidis alpha153]
          Length = 197

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      +S+   LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQASKVISALGEITVECLPEHYISVMIALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|328925356|gb|AEB66297.1| NADH dehydrogenase subunit 9 [Silene subconica]
          Length = 150

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 96/135 (71%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +      L  FL+   +  +  ++D CGVD+ SR  RF+VVY+ LS ++N R+RV+ 
Sbjct: 16  FDTNTDFAFQLLCFLKLHXYTRYEVLVDXCGVDYPSRKLRFEVVYNLLSTRFNSRIRVQS 75

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +PS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 76  SADEVSRIPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 135

Query: 152 GFVELHYDDKVKKVV 166
           G+VE+ YDD  K+VV
Sbjct: 136 GYVEVRYDDPEKRVV 150


>gi|224824821|ref|ZP_03697928.1| NADH (or F420H2) dehydrogenase, subunit C [Lutiella nitroferrum
           2002]
 gi|224603314|gb|EEG09490.1| NADH (or F420H2) dehydrogenase, subunit C [Lutiella nitroferrum
           2002]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +       +  +  ++ EL++     ++V + S LRD     F  +IDL
Sbjct: 1   MASKMEALKSVVEQVLGDRLVQSTLALDELTIVCKAENIVEVASLLRDHAELSFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ S  +      RF VV H LS K+N R+R+K    E     V S+VG++  A+WF
Sbjct: 61  CGVDYSSYKDQPWDGPRFAVVSHLLSLKHNWRIRLKTFAPEDDFPVVNSVVGVWNSANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D++GI F+GHPDLRR+LTDYGF GHP RKDFP++G+VE+ YD   ++V+Y+PV +
Sbjct: 121 EREAFDLFGIVFDGHPDLRRLLTDYGFVGHPFRKDFPLSGYVEMRYDPTQQRVIYQPVTI 180


>gi|121634115|ref|YP_974360.1| NADH dehydrogenase subunit C [Neisseria meningitidis FAM18]
 gi|218534322|sp|A1KRS4|NUOC_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|120865821|emb|CAM09553.1| NADH dehydrogenase I chain C [Neisseria meningitidis FAM18]
 gi|325131611|gb|EGC54318.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           M6190]
 gi|325139134|gb|EGC61680.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           ES14902]
 gi|325143084|gb|EGC65431.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           961-5945]
 gi|325143154|gb|EGC65500.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           961-5945]
 gi|325197529|gb|ADY92985.1| NADH:ubiquinone dehydrogenase, C subunit [Neisseria meningitidis
           G2136]
          Length = 197

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQAGKVISALGEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|262216823|gb|ACY37792.1| NADH dehydrogenase subunit 9 [Phytophthora citrophthora]
          Length = 116

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 1/116 (0%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL+VKI + E + V SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKVKITINELQPVDSIINIYKAANWCEREVWDMFGIFFINHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW-EGVNS 190
           DYGFEGHPLRKDFP++GF+E+ Y+D  K+VVY P+ L Q++R ++F +PW + +NS
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNDLKKRVVYEPINLSQQYRLFEFNNPWDKKINS 116


>gi|262216814|gb|ACY37786.1| NADH dehydrogenase subunit 9 [Phytophthora cinnamomi]
          Length = 113

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL+VKI + E + + SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKVKITINELQPIDSIISIYKAANWCEREVWDMFGIFFSNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY P+ L Q++R ++F SPW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNSPWD 111


>gi|298370382|ref|ZP_06981698.1| NADH dehydrogenase (ubiquinone), C subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298281842|gb|EFI23331.1| NADH dehydrogenase (ubiquinone), C subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 261

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L D +           ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 68  IQNLYDTVSRVLGNQASKVISALGEITVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 127

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V +Y  ADW+ERE 
Sbjct: 128 YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREA 187

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 188 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 243


>gi|238023161|ref|ZP_04603587.1| hypothetical protein GCWU000324_03087 [Kingella oralis ATCC 51147]
 gi|237865544|gb|EEP66684.1| hypothetical protein GCWU000324_03087 [Kingella oralis ATCC 51147]
          Length = 195

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 102/155 (65%), Gaps = 8/155 (5%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFL 79
           + GE++L+    + +SL   LRD     F  ++DLCGVD+ +  N      RF  V   L
Sbjct: 24  AYGEITLECQPKNYLSLMQTLRDHDDLHFEQLVDLCGVDYSTYQNQAWQGKRFAAVSQLL 83

Query: 80  SPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
           S K N+R+RV++   +     VPS+V +Y  ADW+ERE +DMYGI F  HPDLRRILTDY
Sbjct: 84  SIKNNQRIRVRVWADDDDMPIVPSVVSLYNSADWYEREAFDMYGIIFNEHPDLRRILTDY 143

Query: 138 GFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GF GHP RKDFPV+G+VE+ YD+  K+V+Y+PV +
Sbjct: 144 GFVGHPFRKDFPVSGYVEMRYDEAEKRVIYQPVTI 178


>gi|262216832|gb|ACY37798.1| NADH dehydrogenase subunit 9 [Phytophthora humicola]
          Length = 113

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL+VKI + E + V SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKVKITINELQPVESIINIYKAANWCEREVWDMFGIFFSNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 111


>gi|262216820|gb|ACY37790.1| NADH dehydrogenase subunit 9 [Phytophthora inundata]
          Length = 116

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL+VKI + E + V SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKVKITINELQPVDSIINIYKAANWCEREVWDMFGIFFSNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPISLSQQYRLFEFNNPW 110


>gi|262216826|gb|ACY37794.1| NADH dehydrogenase subunit 9 [Phytophthora palmivora]
 gi|262216829|gb|ACY37796.1| NADH dehydrogenase subunit 9 [Phytophthora gonapodyides]
          Length = 116

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL+VKI + E + V SIV IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKVKITINEVQPVDSIVPIYKAANWCEREVWDMFGIFFSNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY PV L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPVNLAQQYRLFEFNNPWD 111


>gi|311104660|ref|YP_003977513.1| NADH-quinone oxidoreductase subunit C [Achromobacter xylosoxidans
           A8]
 gi|310759349|gb|ADP14798.1| NADH-quinone oxidoreductase subunit C [Achromobacter xylosoxidans
           A8]
          Length = 208

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 113/190 (59%), Gaps = 19/190 (10%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +    +     ++GEL+L+V      S+C+ LR +    F   IDL
Sbjct: 1   MMTRLETLKNNLQTTLGADIALT-EALGELTLEVPAQQWFSVCNKLRTEAGLRFETCIDL 59

Query: 61  CGVDFLSRSN----------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSI 102
           CGVD+L+  N                RF VV H +S ++N RLRV+      E   V S+
Sbjct: 60  CGVDYLTWGNGTRQMPEETAAKIHRARFAVVVHLVSIEHNWRLRVRTWAEDDEFPMVASL 119

Query: 103 VGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKV 162
           +  +P   WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + 
Sbjct: 120 MECWPTVGWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQ 179

Query: 163 KKVVYRPVEL 172
           ++V+Y+PV +
Sbjct: 180 RRVIYQPVTI 189


>gi|317401990|gb|EFV82590.1| NADH dehydrogenase subunit I [Achromobacter xylosoxidans C54]
          Length = 208

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 112/190 (58%), Gaps = 19/190 (10%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M+ ++E L + +  +    +     ++GEL+L+V      S+C+ LR +    F   IDL
Sbjct: 1   MMTRLETLKNNLQTTLGADIAL-TEALGELTLEVPAEQWFSVCNKLRTEAGLRFEICIDL 59

Query: 61  CGVDFLSRSN----------------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSI 102
           CGVD+L+  N                RF VV H LS + N RLRV+      E   V S+
Sbjct: 60  CGVDYLTWGNGTRQLPEEANAKVHRARFAVVAHLLSVENNWRLRVRTWAPDDEFPMVASL 119

Query: 103 VGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKV 162
           +  +P   WFERE +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + 
Sbjct: 120 MECWPAVGWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQ 179

Query: 163 KKVVYRPVEL 172
           K+V+Y+PV +
Sbjct: 180 KRVIYQPVTI 189


>gi|330817790|ref|YP_004361495.1| NADH dehydrogenase, subunit C [Burkholderia gladioli BSR3]
 gi|327370183|gb|AEA61539.1| NADH dehydrogenase, subunit C [Burkholderia gladioli BSR3]
          Length = 200

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 112/181 (61%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  KIE L   +  +    V     ++GEL+L V   D V + + LRDD    F  +IDL
Sbjct: 1   MASKIETLKANLEAALGERVVSLTEAIGELTLVVRARDYVEVATQLRDDRKLGFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
           CGVD+ +  +      RF  V   LS   N RLR+++  A    +P   S+V ++  A+W
Sbjct: 61  CGVDYQTYGDGAYDGPRFAAVLQLLSITNNWRLRLRV-FAPDDDLPILASMVEVWSSANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           +ERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP++G+VE+ YD + K+VVY+PV 
Sbjct: 120 YEREAFDLFGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGYVEMRYDPEEKRVVYQPVT 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|308311747|gb|ADO27642.1| nad9 [Rhizanthella gardneri]
          Length = 190

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (65%), Gaps = 9/146 (6%)

Query: 50  PHCCFVNI---------IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
           P  CF+ +         ID+CGVD  SR  RF VV++ LS +YN R+RV+ +  E   + 
Sbjct: 40  PLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFSVVHNLLSTRYNSRIRVQTSADEVTRIS 99

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V  +P A  +EREVWDM G+    HPDLRRI TD+GFEGH LRKDFP++G+VE+ YDD
Sbjct: 100 PVVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDHGFEGHSLRKDFPLSGYVEVRYDD 159

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPWE 186
             K+VV  P+E+ QE R +D  SPWE
Sbjct: 160 PEKRVVSEPIEMTQEFRYFDSASPWE 185


>gi|300311097|ref|YP_003775189.1| NADH dehydrogenase I subunit C [Herbaspirillum seropedicae SmR1]
 gi|300073882|gb|ADJ63281.1| NADH dehydrogenase I (Chain C) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 198

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 112/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + N+  G ++    ++GE+++ V   D +S    LRD     F  +IDL
Sbjct: 1   MTTKLETLEAALRNALGGYLQNLTVALGEVTVVVKAADYLSAMRVLRDHADTRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CGVD+ +  +      RF VV H +S  +N R+RV++   +     V S+  I+  A W+
Sbjct: 61  CGVDYSTYGDGAWEGPRFAVVSHLMSIAHNWRVRVRVFAPDDDLPIVASVDPIWNSAGWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D YGI F+GHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDFYGILFDGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDAEQKRVIYQPVTI 180


>gi|56478178|ref|YP_159767.1| NADH dehydrogenase subunit C [Aromatoleum aromaticum EbN1]
 gi|81356985|sp|Q5P1E8|NUOC_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|56314221|emb|CAI08866.1| NADH dehydrogenase I, chain C [Aromatoleum aromaticum EbN1]
          Length = 201

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 113/181 (62%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + N     VR  V   GE++L+V   D ++    LRD     F  +IDL
Sbjct: 1   MSSKLERLSSSLQNILGAKVRSVVVDRGEVTLEVAAADYLAAAQMLRDHRDLRFEELIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
            G+D+ +  N      RF V  H LS  +N R+R++ A A+  + P   S+VG++PG +W
Sbjct: 61  TGLDYSAYGNGAWTGKRFAVAVHLLSLTHNWRIRLR-AFADDDAFPMFESLVGVWPGVNW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           +ERE +D+YG+ F GHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD +  +VVY+PV 
Sbjct: 120 YEREAFDLYGLMFAGHPDLRRILTDYGFVGHPFRKDFPVSGYVEMRYDPEQGRVVYQPVT 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|296040733|gb|ADG85334.1| NADH dehydrogenase subunit 9 [Silene conica]
          Length = 144

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 68/132 (51%), Positives = 95/132 (71%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +   +  L  FL+   +  +  ++D+CGVD+ SR  RF+VVY+ LS ++N R+R++ 
Sbjct: 13  FDTNTDFIFQLLCFLKLHSYTRYEVLVDICGVDYPSRKLRFEVVYNLLSTRFNSRIRIQS 72

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +PS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 73  SADEVSRIPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 132

Query: 152 GFVELHYDDKVK 163
           G+VE+ YDD  K
Sbjct: 133 GYVEVRYDDPEK 144


>gi|262216802|gb|ACY37778.1| NADH dehydrogenase subunit 9 [Phytophthora alni subsp. alni]
 gi|262216805|gb|ACY37780.1| NADH dehydrogenase subunit 9 [Phytophthora alni subsp. multiformis]
 gi|262216808|gb|ACY37782.1| NADH dehydrogenase subunit 9 [Phytophthora cambivora]
          Length = 116

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E +SV SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKITINELQSVDSIITIYKAANWCEREVWDMFGIFFFNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP+ GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLRGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 111


>gi|56791606|gb|AAW30341.1| NADH dehydrogenase subunit 9 [Lonicera sp. Bergthorsson 0301]
          Length = 179

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/152 (48%), Positives = 98/152 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 28  DTNTDYPFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTS 87

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G
Sbjct: 88  ADEVTRISPVVSPFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSG 147

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           +VE+ YDD  K+VV  P+E+ QE R +D  SP
Sbjct: 148 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASP 179


>gi|56791586|gb|AAW30331.1| NADH dehydrogenase subunit 9 [Calycanthus floridus]
          Length = 177

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 26  DTNTDYPFQLLCFLKFHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTS 85

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A W+EREVWDM G+    HPDLRRI TD+GFEGHPLRKD P++G
Sbjct: 86  ADEVTRISPVVSPFPSAGWWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDLPLSG 145

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           +VE+ YDD  K+VV  P+E+ QE R +D  SP
Sbjct: 146 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASP 177


>gi|319794666|ref|YP_004156306.1| NADH (or f420h2) dehydrogenase, subunit c [Variovorax paradoxus
           EPS]
 gi|315597129|gb|ADU38195.1| NADH (or F420H2) dehydrogenase, subunit C [Variovorax paradoxus
           EPS]
          Length = 203

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 108/176 (61%), Gaps = 10/176 (5%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L   I  +     +    ++GE+++ V   D +   + LRD P C F  +IDLCG+D+
Sbjct: 9   EVLRATITETLGAKAKSVTLALGEVTVVVSAADYIEAATLLRDAPGCRFEQLIDLCGMDY 68

Query: 66  LS------RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYP---GADWFEREV 116
                   +  R+ VV H LS   N+R+R+K+  A  + +P +  + P    A WFERE 
Sbjct: 69  SDYREGEWQGERYGVVSHLLSVTLNQRVRLKV-FAPNEDLPVVDSLQPVWNAATWFEREA 127

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F+GH DLRRILTDYGF GHP RKDFPV+G VE+ YD++ K+VVY+PV +
Sbjct: 128 FDLYGIVFDGHDDLRRILTDYGFIGHPFRKDFPVSGHVEMRYDEEQKRVVYQPVSI 183


>gi|313669284|ref|YP_004049568.1| NADH dehydrogenase I chain C [Neisseria lactamica ST-640]
 gi|313006746|emb|CBN88216.1| NADH dehydrogenase I chain C [Neisseria lactamica 020-06]
          Length = 197

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++ E++++      +S+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQAGKVISALDEITVECLPEHYISVMTALRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V IY  ADW+ERE 
Sbjct: 64  YSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVDIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +DMYGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|229586622|ref|YP_002845123.1| NADH dehydrogenase subunit C [Rickettsia africae ESF-5]
 gi|228021672|gb|ACP53380.1| NADH dehydrogenase I chain C [Rickettsia africae ESF-5]
          Length = 242

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 98/131 (74%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYGI FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGINFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W   + 
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSY 222

Query: 191 LFAKEDSKDDM 201
           +   ++   D+
Sbjct: 223 VLPGDEKATDV 233


>gi|56791592|gb|AAW30334.1| NADH dehydrogenase subunit 9 [Liriodendron tulipifera]
          Length = 179

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 28  DTNTDYPFQLLCFLKFHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTS 87

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A W+EREVWDM G+    HPDLRRI TD+GFEGHPLRKD P++G
Sbjct: 88  ADEVTRISPVVSPFPSAGWWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDLPLSG 147

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSP 184
           +VE+ YDD  K+VV  P+E+ QE R +D  SP
Sbjct: 148 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASP 179


>gi|149022593|gb|EDL79487.1| NADH dehydrogenase (ubiquinone) Fe-S protein 3 (predicted), isoform
           CRA_a [Rattus norvegicus]
          Length = 248

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 104/157 (66%), Gaps = 1/157 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V    EL + +    ++   +FL+D  +  F ++ DL 
Sbjct: 56  KRLSAFGEYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLT 115

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +R NRF++VY+ LS ++N R+RVK    E  ++ SIV ++  A+W+EREVWDM+G
Sbjct: 116 AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFG 175

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +FF  HPDLRRILTDYGFEGHP RKDFP+TG+VE+++
Sbjct: 176 VFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVEIYF 212


>gi|11465870|ref|NP_066419.1| NADH dehydrogenase subunit 9 [Ochromonas danica]
 gi|10505203|gb|AAG18385.1|AF287134_10 NADH dehydrogenase subunit 9 [Ochromonas danica]
          Length = 181

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 90/126 (71%)

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           + G+DF S   RF + Y  LS   N R+RVKI V E   + S V IY  A+W+ERE+WDM
Sbjct: 56  ISGIDFFSLKYRFCIAYDLLSLVNNSRVRVKIFVNEITPIESCVEIYKNANWWEREIWDM 115

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YGI+F  HPDLRRILTDYGFEG+PLRKDFP++GFVEL YD   K+VV  P++L QE+R +
Sbjct: 116 YGIYFYNHPDLRRILTDYGFEGYPLRKDFPLSGFVELRYDSIKKRVVLEPLQLAQEYRLF 175

Query: 180 DFLSPW 185
           ++   W
Sbjct: 176 NYEIQW 181


>gi|54298770|ref|YP_125139.1| NADH dehydrogenase I chain C [Legionella pneumophila str. Paris]
 gi|81822494|sp|Q5X1A9|NUOC_LEGPA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|53752555|emb|CAH13987.1| NADH dehydrogenase I chain C [Legionella pneumophila str. Paris]
          Length = 227

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 117/201 (58%), Gaps = 31/201 (15%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K E L + +  + +  +    ++ GE++++ +  +L+ +   LRD     F  +IDLCGV
Sbjct: 3   KNEYLIEKLQANLANHITELTSAYGEVTIECEVHNLLPVMIELRDREEFSFDQLIDLCGV 62

Query: 64  DFLSRSN------------------------------RFDVVYHFLSPKYNRRLRVKIAV 93
           D+L   +                              RF VVYH LS K N RLRVK+ V
Sbjct: 63  DYLHYGDYDWETESATEHGFSRGVERQEAKAYAVNKPRFAVVYHLLSTKKNHRLRVKLFV 122

Query: 94  AEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
            E    VPS+  ++  A+WFERE +D+YGI F+GHPDLRR+LTDYGF GHP RKDFP++G
Sbjct: 123 EESHLIVPSVHHLWKSANWFEREAYDLYGILFDGHPDLRRLLTDYGFIGHPFRKDFPLSG 182

Query: 153 FVELHYDDKVKKVVYRPVELM 173
            VE+ YD K++KV+Y PV+++
Sbjct: 183 EVEMRYDAKLQKVIYAPVDIV 203


>gi|253996971|ref|YP_003049035.1| NADH (or F420H2) dehydrogenase subunit C [Methylotenera mobilis
           JLW8]
 gi|253983650|gb|ACT48508.1| NADH (or F420H2) dehydrogenase, subunit C [Methylotenera mobilis
           JLW8]
          Length = 198

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 113/181 (62%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K++ L   +       +     ++ E++++    D +++C  LRDD    F  +IDL
Sbjct: 1   MSAKLDQLLASLQTVLGEKITKQTVALDEVTIECRAEDYLAVCELLRDDTALKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
           CGVD+           R+ VV HFLS   N+RLR+++  A+ +  P   ++VG++P A+W
Sbjct: 61  CGVDYQEYGEGSYDGLRYAVVCHFLSVSLNQRLRLRV-FAKDEDFPILSTLVGLWPVANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           FERE +D+YGI FE HPDLRR+LTDYGF GHP RKDFP+ G VE+ YD + ++V+Y+PV 
Sbjct: 120 FEREAFDLYGILFENHPDLRRLLTDYGFVGHPFRKDFPMIGNVEMRYDPEQQRVIYQPVS 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|212212184|ref|YP_002303120.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii CbuG_Q212]
 gi|212010594|gb|ACJ17975.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii CbuG_Q212]
          Length = 227

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 112/200 (56%), Gaps = 32/200 (16%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           + L D I + F+  +   V  V  +++++    L+ +C+ LRDDP   F  ++D+CGVD+
Sbjct: 5   QTLIDAINDRFNSQIEAVVAGVDMVTIELLPTHLLEVCTALRDDPPFNFELLLDVCGVDY 64

Query: 66  LS-------------------------------RSNRFDVVYHFLSPKYNRRLRVKIAV- 93
           L                                   RF VVYH LS +YN R+R+K  V 
Sbjct: 65  LEYGMSPWRTEETPNTGFSRGFEEVIQEQIIPWNKPRFAVVYHLLSLRYNHRIRLKTYVE 124

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            +   VPS++ I+  ADW+ERE +D+YGI FEGHPDLRR+LTDYGF GHP RKDFP+ G 
Sbjct: 125 GDPPLVPSVIKIWSSADWYEREAFDLYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPLIGE 184

Query: 154 VELHYDDKVKKVVYRPVELM 173
           VEL YD   ++ VY PV + 
Sbjct: 185 VELRYDAAQQRCVYEPVSIQ 204


>gi|82702222|ref|YP_411788.1| NADH dehydrogenase subunit C [Nitrosospira multiformis ATCC 25196]
 gi|123544731|sp|Q2YA25|NUOC_NITMU RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|82410287|gb|ABB74396.1| NADH dehydrogenase subunit C [Nitrosospira multiformis ATCC 25196]
          Length = 205

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 111/183 (60%), Gaps = 15/183 (8%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++E L   + N  +  +      + +L + V   +L+ + S LRD P   F  +IDLCGV
Sbjct: 5   RLETLALCLQNVLADKLANVDQQLDQLIITVSPVNLLPVMSVLRDHPELGFEMLIDLCGV 64

Query: 64  DFL-----------SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGA 109
           D+                RF VVYH LS ++NRR+RVK A  E    P   S++ I+P A
Sbjct: 65  DYSIYGVEPTSEQGREGKRFAVVYHLLSIRHNRRVRVK-AFPEDDEFPVVVSVIDIWPSA 123

Query: 110 DWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRP 169
           +WFERE +D+YGI F GHPDLRRILTDYGF G+P RKDFP++G VE+ YD   ++VVY+P
Sbjct: 124 NWFEREAFDLYGIVFTGHPDLRRILTDYGFIGNPFRKDFPLSGNVEMRYDPDQQRVVYQP 183

Query: 170 VEL 172
           V +
Sbjct: 184 VTI 186


>gi|30249735|ref|NP_841805.1| NADH dehydrogenase subunit C [Nitrosomonas europaea ATCC 19718]
 gi|75540323|sp|Q82TU5|NUOC_NITEU RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|30180772|emb|CAD85686.1| Respiratory-chain NADH dehydrogenase 30 Kd subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 206

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 103/161 (63%), Gaps = 15/161 (9%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-----------RFDV 74
           ++GEL+L V   DL  +   LRD     F  +IDLCGVDF   S            RF V
Sbjct: 27  ALGELTLLVHSRDLPDIAEVLRDHQDLGFDTLIDLCGVDFSEYSTDTHAGYKREDRRFAV 86

Query: 75  VYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           VYH LS K+N RLRV++  AE    P   S++ ++P A+WFERE +D++GI F  HPDLR
Sbjct: 87  VYHLLSVKHNHRLRVRV-FAEDNEFPMVDSVMPVWPSANWFEREAFDLFGIIFNNHPDLR 145

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           RILTDYGF G+P RKDFP++G VE+ YD   K+VVY+PV +
Sbjct: 146 RILTDYGFIGNPFRKDFPLSGHVEMRYDPDQKRVVYQPVTI 186


>gi|52842985|ref|YP_096784.1| NADH dehydrogenase I, C subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|81376642|sp|Q5ZRU0|NUOC_LEGPH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|52630096|gb|AAU28837.1| NADH dehydrogenase I, C subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 227

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 116/201 (57%), Gaps = 31/201 (15%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K E L + +    +  +    ++ GE++++ +  +L+ +   LRD     F  +IDLCGV
Sbjct: 3   KNEYLIEKLQADLANHITELTSAYGEVTIECEVQNLLPVMIELRDREEFSFDQLIDLCGV 62

Query: 64  DFLSRSN------------------------------RFDVVYHFLSPKYNRRLRVKIAV 93
           D+L   +                              RF VVYH LS K N RLRVK+ V
Sbjct: 63  DYLHYGDYDWETESATEHGFSRGVERQEAKAYAVNKPRFAVVYHLLSTKKNHRLRVKLFV 122

Query: 94  AEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
            E    VPS+  ++  A+WFERE +D+YGI F+GHPDLRR+LTDYGF GHP RKDFP++G
Sbjct: 123 EESHLIVPSVHHLWKSANWFEREAYDLYGILFDGHPDLRRLLTDYGFIGHPFRKDFPLSG 182

Query: 153 FVELHYDDKVKKVVYRPVELM 173
            VE+ YD K++KV+Y PV+++
Sbjct: 183 EVEMRYDAKLQKVIYAPVDIV 203


>gi|34580592|ref|ZP_00142072.1| NADH dehydrogenase I chain C [Rickettsia sibirica 246]
 gi|28261977|gb|EAA25481.1| NADH dehydrogenase I chain C [Rickettsia sibirica 246]
          Length = 242

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 98/131 (74%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGVNFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W   + 
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSY 222

Query: 191 LFAKEDSKDDM 201
           +   ++   D+
Sbjct: 223 VLPGDEKATDV 233


>gi|264677200|ref|YP_003277106.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           CNB-2]
 gi|262207712|gb|ACY31810.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           CNB-2]
          Length = 203

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 110/175 (62%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +    VR    + GE++++V     + +   LR+ P C F  ++DLCGVD+
Sbjct: 9   EKLRDVVTAALGDRVRSVTLAYGEVTVEVSADKYLDVMQILRNAPDCQFEMLLDLCGVDY 68

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            + +       RF VV H +S   N+RLRV++  A+     V SI  I+  A+WFERE +
Sbjct: 69  STYAEVGKDGPRFAVVSHLMSLTLNQRLRVRVYCADDDFPVVASINPIWNSANWFEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI FEGH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY+PV +
Sbjct: 129 DLFGIVFEGHEDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDAEQQRVVYQPVTI 183


>gi|254496123|ref|ZP_05109022.1| NADH dehydrogenase I, C subunit [Legionella drancourtii LLAP12]
 gi|254354664|gb|EET13300.1| NADH dehydrogenase I, C subunit [Legionella drancourtii LLAP12]
          Length = 225

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (57%), Gaps = 35/200 (17%)

Query: 9   GDYIVNSFSGSVRFAVNSVG----ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
            DY+V      +   +N+V     E++++ D  +L +L   LRD     F  +IDLC VD
Sbjct: 4   NDYLVEKLKTELASHMNAVTVAYDEVTIECDVVNLKTLMLELRDLDAFSFDQLIDLCAVD 63

Query: 65  FL-----------------SR-------------SNRFDVVYHFLSPKYNRRLRVKIAVA 94
           +L                 SR               RF VVYH LS   N R+RVK+ V 
Sbjct: 64  YLLYGEYDWETDSATENGFSRGVERQDAKAYTLDKPRFAVVYHLLSTNKNHRVRVKVFVD 123

Query: 95  EGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           E    VPS+  I+ GA+WFERE +D+YG+ FEGHPDLRRILTDYGF GHP RKDFP++G 
Sbjct: 124 EKHLIVPSVHHIWKGANWFEREAYDLYGVLFEGHPDLRRILTDYGFIGHPFRKDFPLSGQ 183

Query: 154 VELHYDDKVKKVVYRPVELM 173
           VE+ YD K++KV+Y PV+++
Sbjct: 184 VEMRYDAKLQKVIYAPVDIV 203


>gi|157964435|ref|YP_001499259.1| NADH dehydrogenase subunit C [Rickettsia massiliae MTU5]
 gi|157844211|gb|ABV84712.1| NADH dehydrogenase I chain C [Rickettsia massiliae MTU5]
          Length = 242

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 98/131 (74%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGVNFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W   + 
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSY 222

Query: 191 LFAKEDSKDDM 201
           +   ++   D+
Sbjct: 223 VLPGDEKATDV 233


>gi|15892406|ref|NP_360120.1| NADH dehydrogenase subunit C [Rickettsia conorii str. Malish 7]
 gi|81528332|sp|Q92ID7|NUOC_RICCN RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|15619557|gb|AAL03021.1| NADH dehydrogenase I chain C [Rickettsia conorii str. Malish 7]
          Length = 242

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 98/131 (74%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGVNFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W   + 
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSY 222

Query: 191 LFAKEDSKDDM 201
           +   ++   D+
Sbjct: 223 VLPGDEKATDV 233


>gi|284794748|ref|YP_003412101.1| NADH dehydrogenase subunit 9 [Phaeoceros laevis]
 gi|254596068|gb|ACT75309.1| NADH dehydrogenase subunit 9 [Phaeoceros laevis]
          Length = 191

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 99/148 (66%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +  F   ID+ GVD+ SR  RF+VV++ LS +YN  +RV+ +V+E   
Sbjct: 37  LFELLWFLKHHINTRFQVSIDIRGVDYSSRKRRFEVVHNSLSIRYNSCIRVESSVSEITP 96

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +  +V I+P A W+EREVWDM+G +   HPD RRI  DYGFEGHPLRKD  ++G+ E+ Y
Sbjct: 97  ICLVVNIFPSAGWWEREVWDMFGAYSSNHPDSRRISIDYGFEGHPLRKDLSLSGYFEVRY 156

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DD  K+VV  P+E+ QE   +DF SPWE
Sbjct: 157 DDSEKRVVSEPIEMTQESCYFDFASPWE 184


>gi|163855989|ref|YP_001630287.1| NADH dehydrogenase subunit C [Bordetella petrii DSM 12804]
 gi|218534259|sp|A9II05|NUOC_BORPD RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|163259717|emb|CAP42018.1| NADH dehydrogenase I, 30 kDa subunit, chain C [Bordetella petrii]
          Length = 209

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 112/187 (59%), Gaps = 19/187 (10%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++E L   +  +    +     ++GEL+L+V     +++C+ LR D    F   IDLCGV
Sbjct: 5   RLETLKHNLQAALGADIAL-TEALGELTLEVPADQWLAVCNKLRTDAGLSFETCIDLCGV 63

Query: 64  DFLSRSN----------------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGI 105
           D+L+  N                R+ VV H LS  +N RLRV+    +     V S++  
Sbjct: 64  DYLTWGNGTRQAGEDKVAGVQRSRYAVVAHLLSIAHNWRLRVRTWAPDDDFPMVGSLIDC 123

Query: 106 YPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKV 165
           +PG +WFERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD + ++V
Sbjct: 124 WPGVNWFEREAFDLFGIVFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVEMRYDPEQRRV 183

Query: 166 VYRPVEL 172
           +Y+PV +
Sbjct: 184 IYQPVTI 190


>gi|71906590|ref|YP_284177.1| NADH dehydrogenase subunit C [Dechloromonas aromatica RCB]
 gi|123627978|sp|Q47HH4|NUOC_DECAR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|71846211|gb|AAZ45707.1| NADH dehydrogenase subunit C [Dechloromonas aromatica RCB]
          Length = 201

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 111/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   +   F   ++    ++GE++++V   D   + + LRD+    F  +IDL
Sbjct: 1   MSAKLETLSQNLQEHFGDKLKSLKLALGEITIEVAAADYFCVMTALRDEAAFGFEEMIDL 60

Query: 61  CGVDFLS------RSNRFDVVYHFLSPKYNRRLRVKI-AVAEG-KSVPSIVGIYPGADWF 112
           CGVD+ +      +  RF VV H LS   N RLRV++ A  EG  SV SI  ++  A+WF
Sbjct: 61  CGVDYSTYGDGTWQGARFAVVVHLLSVANNWRLRVRVFAEDEGFPSVASITTVWASANWF 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI F GH DLRRILTDYGF GHP RKDFP++G VE+ YD    +V+Y+PV +
Sbjct: 121 EREAFDLYGIAFVGHDDLRRILTDYGFIGHPFRKDFPISGHVEMRYDPDQARVIYQPVTI 180


>gi|324309726|gb|ADY18507.1| NADH dehydrogenase subunit 9-ribosomal protein S14 fusion protein
           [Phaeodactylum tricornutum]
          Length = 284

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 109/171 (63%), Gaps = 1/171 (0%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           +RF + S  E S  +    L  + + +++  +C F  +  + GVD+   S+RF +VY  L
Sbjct: 15  LRFEL-SRTEGSFLIQTNLLPEILTMVKNHFNCQFKVLTCISGVDYPESSHRFKIVYELL 73

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
           S K N RLR+K+ + E   + S+  I  GA W+E E+WDM+G+FF    +L R+LTDYGF
Sbjct: 74  SIKRNSRLRLKVILDELSPINSVEKIISGASWWECEIWDMFGVFFLNQDNLTRLLTDYGF 133

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNS 190
           +G+PLRKDFP++GF E  Y     +VVY  +E+ QE+R ++FLSPWE ++S
Sbjct: 134 QGYPLRKDFPLSGFTESRYSSIKSRVVYENLEMSQEYRTFEFLSPWEELSS 184


>gi|319943350|ref|ZP_08017632.1| NADH-quinone oxidoreductase subunit C [Lautropia mirabilis ATCC
           51599]
 gi|319743165|gb|EFV95570.1| NADH-quinone oxidoreductase subunit C [Lautropia mirabilis ATCC
           51599]
          Length = 202

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (67%), Gaps = 12/158 (7%)

Query: 25  NSVGELSLDV--DCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVY 76
            ++GE+++++  DC  +V  C  LRDDP   F  +IDLCG+D+ +  N      RF VV 
Sbjct: 23  TALGEVTIEISGDCHHIV--CERLRDDPRLGFEVMIDLCGIDYSTYGNAEWDAPRFAVVM 80

Query: 77  HFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
             LS ++N R+R++      E   V ++  ++P A+WFERE +D++GI F GHPDLRRIL
Sbjct: 81  QLLSIRHNHRVRLRSFCMDDEAPMVETVTDLWPCANWFEREAFDLFGIVFSGHPDLRRIL 140

Query: 135 TDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           TDYGF GHP RKDFP++G+ E+ YD+K ++VVY+PV +
Sbjct: 141 TDYGFIGHPFRKDFPISGYTEMRYDEKQRRVVYQPVTI 178


>gi|238651036|ref|YP_002916893.1| NADH dehydrogenase subunit C [Rickettsia peacockii str. Rustic]
 gi|238625134|gb|ACR47840.1| NADH dehydrogenase subunit C [Rickettsia peacockii str. Rustic]
          Length = 242

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 92/115 (80%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGVNFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHW 217


>gi|157828357|ref|YP_001494599.1| NADH dehydrogenase subunit C [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800838|gb|ABV76091.1| NADH dehydrogenase subunit C [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 242

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 92/115 (80%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 103 RFEVVYNLLSLKLNKRLIIKVYISEQETIPSAMSIFSAACWYEREVYDMYGVNFEGNDDK 162

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W
Sbjct: 163 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHW 217


>gi|261378538|ref|ZP_05983111.1| NADH-quinone oxidoreductase chain 5 [Neisseria cinerea ATCC 14685]
 gi|269145088|gb|EEZ71506.1| NADH-quinone oxidoreductase chain 5 [Neisseria cinerea ATCC 14685]
          Length = 197

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +           ++++GE++++      VS+ + LRD     F  ++DLCGVD
Sbjct: 4   IQNLYETVSRVLGNQASKVISALGEITVECLPEHYVSVMTTLRDHEELHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+V +Y  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVVPVYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+ V +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQSVTI 179


>gi|262216817|gb|ACY37788.1| NADH dehydrogenase subunit 9 [Phytophthora nicotianae var.
           parasitica]
          Length = 116

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E + + SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKITINELQPIDSIIKIYKAANWCEREVWDMFGIFFLNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 111


>gi|56791600|gb|AAW30338.1| NADH dehydrogenase subunit 9 [Platanus occidentalis]
          Length = 179

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 98/153 (64%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 27  DTNTDYPFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTS 86

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A  +EREVWDM G+    HPDLRRI TD+GFEGHPLRKD P++G
Sbjct: 87  ADEVTRISPVVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDLPLSG 146

Query: 153 FVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           +VE+ YDD  K+VV  P+E+ QE R +D  SPW
Sbjct: 147 YVEVRYDDPEKRVVSEPIEMTQEFRYFDSASPW 179


>gi|328925348|gb|AEB66293.1| NADH dehydrogenase subunit 9 [Silene coniflora]
          Length = 136

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 93/128 (72%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D     +  L SFL+   +  +  ++D+CGVD+ SRS RF+VVY+ LS ++N R+ V+ 
Sbjct: 9   FDTTTDFVFQLLSFLKLHSYTRYEVLVDICGVDYPSRSLRFEVVYNLLSTRFNSRISVQT 68

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E + +PS V ++P A+W ERE+WDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 69  SADEVRRIPSAVSLFPSANWCEREIWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 128

Query: 152 GFVELHYD 159
           G++E+ YD
Sbjct: 129 GYIEVRYD 136


>gi|262216811|gb|ACY37784.1| NADH dehydrogenase subunit 9 [Phytophthora rubi]
          Length = 116

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E +SV SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKITINELQSVDSIITIYKAANWCEREVWDMFGIFFFNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP+ GF+++ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLRGFLKVFYNELKKRVVYEPINLSQQYRLFEFNNPWD 111


>gi|56791588|gb|AAW30332.1| NADH dehydrogenase subunit 9 [Eichhornia crassipes]
          Length = 179

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/146 (50%), Positives = 97/146 (66%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   
Sbjct: 34  LFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSIRYNSRIRVQTSADEVTR 93

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +  +V  +P A  +EREVWDM G+    HPDLRRI TDYGFEGHPLRKDFP++G+VE+ Y
Sbjct: 94  ISPVVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSGYVEVRY 153

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSP 184
           DD  K+VV  P+E+ QE R +D  SP
Sbjct: 154 DDPEKRVVSEPIEMTQEFRYFDSASP 179


>gi|262216835|gb|ACY37800.1| NADH dehydrogenase subunit 9 [Phytophthora infestans]
          Length = 116

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 89/111 (80%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E + + SI+ IY  A+W EREVWDM+GIFF  HPDLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKITINELQPINSIIKIYRAANWCEREVWDMFGIFFLNHPDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY P+ L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYEPINLSQQYRVFEFNNPWD 111


>gi|91789114|ref|YP_550066.1| NADH (or F420H2) dehydrogenase subunit C [Polaromonas sp. JS666]
 gi|123164660|sp|Q127X4|NUOC_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|91698339|gb|ABE45168.1| NADH dehydrogenase subunit C [Polaromonas sp. JS666]
          Length = 203

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 107/173 (61%), Gaps = 8/173 (4%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LGD I       V+    ++GE+++ V   D ++    LRD   C F  +IDLCG+D+  
Sbjct: 12  LGDTIAAVLGDKVKSLKIALGEVTVTVGAADYLASAVLLRDAAGCRFEQLIDLCGLDYSE 71

Query: 68  RSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDM 119
             +      R+ V  H LS   N+R+R+K+   +     V S+ G++  A+WFERE +D+
Sbjct: 72  YKDGQYDGLRYCVASHLLSVSLNQRVRLKVFCPDDDFPVVDSVNGVWNSANWFEREAFDL 131

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           YGI FEGH DLRRILTDYGF GHP RKDFP TG+VE+ YD + K+V+Y+PV +
Sbjct: 132 YGIIFEGHNDLRRILTDYGFIGHPFRKDFPTTGYVEMRYDAEQKRVIYQPVTI 184


>gi|148361100|ref|YP_001252307.1| NADH dehydrogenase I subunit C [Legionella pneumophila str. Corby]
 gi|296108430|ref|YP_003620131.1| NADH dehydrogenase I chain C [Legionella pneumophila 2300/99 Alcoy]
 gi|218534316|sp|A5IHW1|NUOC_LEGPC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|148282873|gb|ABQ56961.1| NADH dehydrogenase I, C subunit [Legionella pneumophila str. Corby]
 gi|295650332|gb|ADG26179.1| NADH dehydrogenase I chain C [Legionella pneumophila 2300/99 Alcoy]
          Length = 227

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 116/201 (57%), Gaps = 31/201 (15%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           K E L + +    +  +    ++ GE++++ +  +L+ +   LRD     F  +IDLCGV
Sbjct: 3   KNEYLIEKLQADLANHITELTSAYGEVTIECEVQNLLPVMIELRDREEFSFDQLIDLCGV 62

Query: 64  DFLSRSN------------------------------RFDVVYHFLSPKYNRRLRVKIAV 93
           D+L   +                              RF VVYH LS + N RLRVK+ V
Sbjct: 63  DYLHYGDYDWETESATEHGFSRGVERQEAKAYAVNKPRFAVVYHLLSTQKNHRLRVKLFV 122

Query: 94  AEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
            E    VPS+  ++  A+WFERE +D+YGI F+GHPDLRR+LTDYGF GHP RKDFP++G
Sbjct: 123 EESHLIVPSVHHLWKSANWFEREAYDLYGILFDGHPDLRRLLTDYGFIGHPFRKDFPLSG 182

Query: 153 FVELHYDDKVKKVVYRPVELM 173
            VE+ YD K++KV+Y PV+++
Sbjct: 183 EVEMRYDAKLQKVIYAPVDIV 203


>gi|292559465|ref|YP_003540833.1| NADH dehydrogenase subunit 9 [Hartmannella vermiformis]
 gi|290775718|gb|ADD62217.1| NADH dehydrogenase subunit 9 [Hartmannella vermiformis]
          Length = 195

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 102/156 (65%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
           L  +  ++ SL  FL+      F +++D+ G D+  R+ RF+V +  L+     RL +++
Sbjct: 36  LITNSKNMRSLLIFLKFLFDTNFSSLMDIWGSDYPHRNYRFEVNFLILNLSLPYRLIIRV 95

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   + +I  +Y  A W EREVWDMYG++F GH DLRRILTDYGF G+PLRKDFP+T
Sbjct: 96  STNEYIPISTISDLYSSAGWLEREVWDMYGVYFSGHKDLRRILTDYGFSGYPLRKDFPLT 155

Query: 152 GFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           G+ E+ YDD  K+VV  P+E+ QE R ++F SPWE 
Sbjct: 156 GYTEVRYDDTKKQVVLEPLEISQELRLFNFKSPWEN 191


>gi|326316101|ref|YP_004233773.1| NADH (or F420H2) dehydrogenase subunit C [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372937|gb|ADX45206.1| NADH (or F420H2) dehydrogenase, subunit C [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 202

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 107/175 (61%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +     R  V ++ EL++ V   D ++    LRD P C F  ++DLCG+D+
Sbjct: 9   EALRDAVAAALGDKARDIVIALDELTVTVPAADYLAAMQLLRDAPGCRFEQLVDLCGIDY 68

Query: 66  LS------RSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            +         R+ VV H LS   N+R+RVK+   +     V S+  I+  A+W+ERE +
Sbjct: 69  STYGDVGTEGARYAVVSHLLSVSLNQRVRVKVFCPDDDFPVVASVSSIWNSANWYEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D+YGI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY PV +
Sbjct: 129 DLYGIVFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDTEARRVVYEPVTI 183


>gi|54295616|ref|YP_128031.1| NADH dehydrogenase I chain C [Legionella pneumophila str. Lens]
 gi|81822301|sp|Q5WT22|NUOC_LEGPL RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|53755448|emb|CAH16944.1| NADH dehydrogenase I chain C [Legionella pneumophila str. Lens]
 gi|307611656|emb|CBX01347.1| NADH dehydrogenase I chain C [Legionella pneumophila 130b]
          Length = 227

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 109/181 (60%), Gaps = 31/181 (17%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------------- 70
            ++ GE++++ +  +L+ +   LRD     F  +IDLCGVD+L   +             
Sbjct: 23  TSAYGEVTIECEVQNLLPVMIELRDREEFSFDELIDLCGVDYLHYGDYDWETESATEHGF 82

Query: 71  -----------------RFDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWF 112
                            RF VVYH LS K N RLRVK+ V E    VPS+  ++  A+WF
Sbjct: 83  SRGVERQEAKAYAVNKPRFAVVYHLLSTKKNHRLRVKLFVEESHLIVPSVHHLWKSANWF 142

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D+YGI F+GHPDLRR+LTDYGF GHP RKDFP++G VE+ YD K++KV+Y PV++
Sbjct: 143 EREAYDLYGILFDGHPDLRRLLTDYGFIGHPFRKDFPLSGEVEMRYDAKLQKVIYAPVDI 202

Query: 173 M 173
           +
Sbjct: 203 V 203


>gi|7524986|ref|NP_050084.1| NADH dehydrogenase subunit 9 [Dictyostelium discoideum]
 gi|128861|sp|P22237|NDUS3_DICDI RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
 gi|12910|emb|CAA36903.1| unnamed protein product [Dictyostelium discoideum]
 gi|4958889|dbj|BAA78066.1| NADH dehydrogenase subunit 9 [Dictyostelium discoideum]
          Length = 209

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 116/183 (63%), Gaps = 4/183 (2%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           +LG+++  S  G V+  +     L + V+   ++++  +L++        ++D+  VD L
Sbjct: 13  NLGEHLRLSIPGLVKKIMYKTHYLEIQVEKEKMLTVLKYLKEASKYQCNMLLDIVCVDCL 72

Query: 67  S----RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGI 122
           +    +  RF ++Y   S   N R+ +   V     + +  G++  + W ERE+WDM+GI
Sbjct: 73  NIEEIKIGRFKLIYVLNSIYNNTRVHLSTYVENNGIIETTSGLFESSVWLEREIWDMFGI 132

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFL 182
           +FE HPDLRRILTDYGF G+PL+KDFP+TG++E++YD   KK++Y+P+ELMQE+R+Y+F 
Sbjct: 133 YFEKHPDLRRILTDYGFVGYPLKKDFPITGYLEVYYDVNDKKIIYKPIELMQEYRNYNFG 192

Query: 183 SPW 185
           + W
Sbjct: 193 AVW 195


>gi|56791584|gb|AAW30330.1| NADH dehydrogenase subunit 9 [Asarum sp. Qiu 96018]
          Length = 179

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 94/146 (64%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  L  FL+   +      ID+ GVD  SR  RF VVY+ LS +YN R+RV+ +  E   
Sbjct: 34  LFQLLCFLKFHTYTRVQVSIDISGVDQPSRKRRFSVVYNLLSTRYNSRIRVQTSADEVTR 93

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +  +V  +P A W+EREVWDM G+    HPDLRRI TDYGFEGHPLRKD P++G+VE+ Y
Sbjct: 94  ISPVVSPFPSAGWWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDLPLSGYVEVRY 153

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSP 184
           DD  K+VV  P+E+ QE   +D  SP
Sbjct: 154 DDPEKRVVSEPIEMTQELSYFDSASP 179


>gi|329914958|ref|ZP_08276194.1| NADH-ubiquinone oxidoreductase chain C [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327545008|gb|EGF30333.1| NADH-ubiquinone oxidoreductase chain C [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 198

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 113/180 (62%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+++L   + ++    +    N++GE++L +     +S    LRD P   F  ++DL
Sbjct: 1   MTTKLDNLQAALHSALGDHIVSLTNALGEITLVIKDSHYLSAMRVLRDHPDTRFEQLLDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWF 112
            GVDF +  +      RF VV H LS  +N R+RV++  +  E   V S++ I+  A+W+
Sbjct: 61  AGVDFSTYGDGAWDGRRFAVVSHLLSLTHNWRVRVRVFASDDEVPVVASLIDIWSSANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +D +GI FEGH DLRRILTDYGF GHP RKDFPV+G+VE+ YD + K+V+Y+PV +
Sbjct: 121 EREAFDFFGILFEGHDDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEQKRVIYQPVTI 180


>gi|328925346|gb|AEB66292.1| NADH dehydrogenase subunit 9 [Silene coniflora]
          Length = 136

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 93/128 (72%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D     +  L SFL+   +  +  ++D+CGVD+ SRS RF+VVY+ LS ++N R+ V+ 
Sbjct: 9   FDTTTDFVFQLLSFLKLHSYTRYEVLVDICGVDYPSRSLRFEVVYNLLSTRFNSRISVQT 68

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E + +PS V ++P A+W ERE+WDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 69  SADEVRRIPSAVSLFPSANWCEREIWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 128

Query: 152 GFVELHYD 159
           G++E+ YD
Sbjct: 129 GYIEVRYD 136


>gi|59802070|ref|YP_208782.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae FA 1090]
 gi|194099645|ref|YP_002002776.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae NCCP11945]
 gi|239999842|ref|ZP_04719766.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae 35/02]
 gi|240015001|ref|ZP_04721914.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae DGI18]
 gi|240017449|ref|ZP_04723989.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae FA6140]
 gi|240081588|ref|ZP_04726131.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae FA19]
 gi|240113870|ref|ZP_04728360.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae MS11]
 gi|240116601|ref|ZP_04730663.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae PID18]
 gi|240118825|ref|ZP_04732887.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae PID1]
 gi|240122070|ref|ZP_04735032.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae PID24-1]
 gi|240124364|ref|ZP_04737320.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae PID332]
 gi|240126576|ref|ZP_04739462.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae SK-92-679]
 gi|240129041|ref|ZP_04741702.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae SK-93-1035]
 gi|254494625|ref|ZP_05107796.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae 1291]
 gi|260439638|ref|ZP_05793454.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae DGI2]
 gi|268595652|ref|ZP_06129819.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae 35/02]
 gi|268597684|ref|ZP_06131851.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae FA19]
 gi|268599936|ref|ZP_06134103.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae MS11]
 gi|268602270|ref|ZP_06136437.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae PID18]
 gi|268604536|ref|ZP_06138703.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae PID1]
 gi|268682991|ref|ZP_06149853.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           PID332]
 gi|268685156|ref|ZP_06152018.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687419|ref|ZP_06154281.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291042879|ref|ZP_06568620.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae DGI2]
 gi|293398110|ref|ZP_06642315.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae F62]
 gi|75355477|sp|Q5F617|NUOC_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534297|sp|B4RPI2|NUOC_NEIG2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|59718965|gb|AAW90370.1| putative NADH dehydrogenase I chain C [Neisseria gonorrhoeae FA
           1090]
 gi|193934935|gb|ACF30759.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae NCCP11945]
 gi|226513665|gb|EEH63010.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae 1291]
 gi|268549041|gb|EEZ44459.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae 35/02]
 gi|268551472|gb|EEZ46491.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae FA19]
 gi|268584067|gb|EEZ48743.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae MS11]
 gi|268586401|gb|EEZ51077.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae PID18]
 gi|268588667|gb|EEZ53343.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae PID1]
 gi|268623275|gb|EEZ55675.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           PID332]
 gi|268625440|gb|EEZ57840.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627703|gb|EEZ60103.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291013313|gb|EFE05279.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae DGI2]
 gi|291611373|gb|EFF40443.1| NADH-quinone oxidoreductase subunit C [Neisseria gonorrhoeae F62]
 gi|317165130|gb|ADV08671.1| NADH dehydrogenase subunit C [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 197

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 113/176 (64%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           I++L + +V          ++++GE++++      +S+ + L D     F  ++DLCGVD
Sbjct: 4   IQNLYETVVGVLGDQAGKVISALGEITVECLPEHYISVMTALHDHEDLHFELLVDLCGVD 63

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           + +  N      RF VV   LS K N+R+RV++ V++     V S+  IY  ADW+ERE 
Sbjct: 64  YSTYKNEAWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFPVVESVADIYNSADWYEREA 123

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI F  HPDLRRILTDYGF GHP RKDFP++G+VE+ YD++ K+V+Y+PV +
Sbjct: 124 FDLYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDEEQKRVIYQPVTI 179


>gi|165933065|ref|YP_001649854.1| NADH dehydrogenase subunit C [Rickettsia rickettsii str. Iowa]
 gi|165908152|gb|ABY72448.1| NADH-quinone oxidoreductase chain C [Rickettsia rickettsii str.
           Iowa]
          Length = 206

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 92/115 (80%)

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           RF+VVY+ LS K N+RL +K+ ++E +++PS + I+  A W+EREV+DMYG+ FEG+ D 
Sbjct: 67  RFEVVYNLLSLKLNKRLIIKVYISEQETIPSAMSIFSAACWYEREVYDMYGVNFEGNDDK 126

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           RRILTDY FEGHPLRKDFP+TG+ ++ YD+K+KKV Y PV+L  E+R++DF S W
Sbjct: 127 RRILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHW 181


>gi|145589232|ref|YP_001155829.1| NADH (or F420H2) dehydrogenase, subunit C [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|218534319|sp|A4SXQ1|NUOC_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|145047638|gb|ABP34265.1| NADH dehydrogenase subunit C [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 199

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/155 (47%), Positives = 101/155 (65%), Gaps = 8/155 (5%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS------RSNRFDVVYHFL 79
           ++GE+++ V+          +RDDP   F  +IDLCGVD+           RF VV H L
Sbjct: 26  ALGEVTVVVNADTYFESAMLMRDDPSLAFEQLIDLCGVDYQDFRDGAWNGQRFGVVSHLL 85

Query: 80  SPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
           S ++N RLRV++   +     V SI  ++  A+WFERE +D+YGI FEGH DLRRILTDY
Sbjct: 86  SLEHNWRLRVRVFAPDDSYPLVASITPVWSSANWFEREAFDLYGIIFEGHEDLRRILTDY 145

Query: 138 GFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GF GHP RKDFP++G VE+ YD ++K+VVY+PV +
Sbjct: 146 GFIGHPFRKDFPISGNVEMRYDPELKRVVYQPVTI 180


>gi|89900288|ref|YP_522759.1| NADH (or F420H2) dehydrogenase subunit C [Rhodoferax ferrireducens
           T118]
 gi|122479524|sp|Q21YC5|NUOC_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|89345025|gb|ABD69228.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodoferax ferrireducens
           T118]
          Length = 202

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 111/173 (64%), Gaps = 16/173 (9%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LGD +++S        V  + EL++ VD    +     LRDDP+C F  ++DLCGVD+ +
Sbjct: 19  LGDLLISS--------VLRLDELTVVVDGAHYLQAAKILRDDPNCRFEQLMDLCGVDYST 70

Query: 68  RSN------RFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDM 119
             +      R+ VV H LS   N+R+R+K+   +     V S+  ++  A+WFERE +D+
Sbjct: 71  YKDQPQTGLRYCVVSHLLSVSLNQRVRLKVFAPDDNLPVVQSLCDVWSSANWFEREAFDL 130

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +GI FEGH DLRRILTDYGF GHP RKDFPV+G VE+ YD ++K+VVY+PV +
Sbjct: 131 FGIVFEGHADLRRILTDYGFVGHPFRKDFPVSGHVEMRYDAELKRVVYQPVTI 183


>gi|121609760|ref|YP_997567.1| NADH (or F420H2) dehydrogenase subunit C [Verminephrobacter
           eiseniae EF01-2]
 gi|218534345|sp|A1WLP2|NUOC_VEREI RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|121554400|gb|ABM58549.1| NADH (or F420H2) dehydrogenase, subunit C [Verminephrobacter
           eiseniae EF01-2]
          Length = 203

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + E L D+I  +    +R    ++ E+++ +   D       LRDDP C F  +IDLC V
Sbjct: 8   RPERLRDHIAAALGARLRQITLALEEVTVVLAAADYFDAMRVLRDDPVCRFEQLIDLCAV 67

Query: 64  DF------LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+      + +  R+ VV H LS   N+RLRVK+   +     +PS+ G++  A+W+ERE
Sbjct: 68  DYSTYADAVQQGPRYCVVAHLLSVSLNQRLRVKVFCPDDDFPLLPSVCGLWNSANWYERE 127

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D++GI F+GH DLRRILTDYGF GHP RKDFP++G V++ YD ++++VVY PV +
Sbjct: 128 AFDLFGILFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVQMRYDAELRRVVYEPVSI 184


>gi|328925350|gb|AEB66294.1| NADH dehydrogenase subunit 9 [Silene lydia]
          Length = 136

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
           ++ D   +  L  FL+   +  +  ++D+CGVD+ SR  RF+VVY+ LS ++N R+RV+ 
Sbjct: 9   IETDMDFVFQLLCFLKLHTYTRYEVLVDICGVDYPSRRLRFEVVYNLLSTRFNSRIRVQS 68

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   VPS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 69  SADEVSRVPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 128

Query: 152 GFVELHYD 159
           G+VE+ YD
Sbjct: 129 GYVEVRYD 136


>gi|161829956|ref|YP_001597291.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii RSA
           331]
 gi|218534266|sp|A9N8X1|NUOC_COXBR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|161761823|gb|ABX77465.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii RSA
           331]
          Length = 227

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 32/200 (16%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           + L D I + F+  +   V  V  +++++    L+ +C+ LRDDP   F  ++D+CGVD+
Sbjct: 5   QTLIDAINDRFNSQIEAVVAGVDMVTIELLPTHLLEVCTTLRDDPPFNFELLLDVCGVDY 64

Query: 66  LS-------------------------------RSNRFDVVYHFLSPKYNRRLRVKIAV- 93
           L                                   RF VVYH LS ++N R+R+K  V 
Sbjct: 65  LEYGMSPWRTEETPNTGFSRGFEEVIQEQIIPWNKPRFAVVYHLLSLRHNHRIRLKTYVE 124

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            +   VPS++ I+  ADW+ERE +D+YGI FEGHPDLRR+LTDYGF GHP RKDFP+ G 
Sbjct: 125 GDPPLVPSVIKIWSSADWYEREAFDLYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPLIGE 184

Query: 154 VELHYDDKVKKVVYRPVELM 173
           VEL YD   ++ VY PV + 
Sbjct: 185 VELRYDAAQQRCVYEPVSIQ 204


>gi|29654737|ref|NP_820429.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii RSA
           493]
 gi|154705940|ref|YP_001423958.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii Dugway
           5J108-111]
 gi|81722521|sp|Q83BQ7|NUOC_COXBU RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534276|sp|A9KBK6|NUOC_COXBN RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|29542005|gb|AAO90943.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii RSA 493]
 gi|154355226|gb|ABS76688.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii Dugway
           5J108-111]
          Length = 227

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 32/200 (16%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           + L D I + F+  +   V  V  +++++    L+ +C+ LRDDP   F  ++D+CGVD+
Sbjct: 5   QTLIDAINDRFNSQIEAVVAGVDMVTIELLPTHLLEVCTALRDDPPFNFELLLDVCGVDY 64

Query: 66  LS-------------------------------RSNRFDVVYHFLSPKYNRRLRVKIAV- 93
           L                                   RF VVYH LS ++N R+R+K  V 
Sbjct: 65  LEYGMSPWRTEETPNTGFSRGFEEVIQEQIIPWNKPRFAVVYHLLSLRHNHRIRLKTYVE 124

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            +   VPS++ I+  ADW+ERE +D+YGI FEGHPDLRR+LTDYGF GHP RKDFP+ G 
Sbjct: 125 GDPPLVPSVIKIWSSADWYEREAFDLYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPLIGE 184

Query: 154 VELHYDDKVKKVVYRPVELM 173
           VEL YD   ++ VY PV + 
Sbjct: 185 VELRYDAAQQRCVYEPVSIQ 204


>gi|153207289|ref|ZP_01946053.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165918788|ref|ZP_02218874.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii RSA
           334]
 gi|212218214|ref|YP_002305001.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii CbuK_Q154]
 gi|120576777|gb|EAX33401.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917512|gb|EDR36116.1| NADH dehydrogenase (ubiquinone), C subunit [Coxiella burnetii RSA
           334]
 gi|212012476|gb|ACJ19856.1| NADH-quinone oxidoreductase chain C [Coxiella burnetii CbuK_Q154]
          Length = 227

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 32/200 (16%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           + L D I + F+  +   V  V  +++++    L+ +C+ LRDDP   F  ++D+CGVD+
Sbjct: 5   QTLIDAINDRFNSQIEAVVAGVDMVTIELLPTHLLEVCTALRDDPPFNFELLLDVCGVDY 64

Query: 66  LS-------------------------------RSNRFDVVYHFLSPKYNRRLRVKIAV- 93
           L                                   RF VVYH LS ++N R+R+K  V 
Sbjct: 65  LEYGMSPWRTEETPNTGFSRGFEEVIQEQIIPWNKPRFAVVYHLLSLRHNHRIRLKTYVE 124

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            +   VPS++ I+  ADW+ERE +D+YGI FEGHPDLRR+LTDYGF GHP RKDFP+ G 
Sbjct: 125 GDPPLVPSVIKIWSSADWYEREAFDLYGIVFEGHPDLRRLLTDYGFVGHPFRKDFPLIGE 184

Query: 154 VELHYDDKVKKVVYRPVELM 173
           VEL YD   ++ VY PV + 
Sbjct: 185 VELRYDAAQQRCVYEPVSIQ 204


>gi|328775177|gb|AEB39983.1| NADH dehydrogenase subunit 9 [Funaria hygrometrica]
          Length = 116

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/105 (61%), Positives = 83/105 (79%)

Query: 82  KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
           +YN R+RV+ +V E   + S V I+P A W+EREVWDM+G++F  HPDLRRILTDYGFEG
Sbjct: 1   QYNSRIRVQTSVDEITPICSAVSIFPSAGWWEREVWDMFGVYFSNHPDLRRILTDYGFEG 60

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           HPLRKDFP++G+VE+ YDD  K+VV  P+E+ QE R +DF SPWE
Sbjct: 61  HPLRKDFPLSGYVEVRYDDSEKRVVSEPIEMTQEFRYFDFASPWE 105


>gi|91776411|ref|YP_546167.1| NADH (or F420H2) dehydrogenase, subunit C [Methylobacillus
           flagellatus KT]
 gi|122399587|sp|Q1GZL1|NUOC_METFK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|91710398|gb|ABE50326.1| NADH dehydrogenase subunit C [Methylobacillus flagellatus KT]
          Length = 197

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++E L  ++ + F  S+        E++++     L+ + + LRD     F  +IDLCGV
Sbjct: 3   RLEQLKQHLQDVFGNSITRLQECRNEVTIECQAPCLLEVANLLRDHKLLKFEQLIDLCGV 62

Query: 64  DFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFERE 115
           D+           R+  VYHFLS   N+RLR+++   +     +P++V I+P A+WFERE
Sbjct: 63  DYADYGEGSWSGLRYATVYHFLSVSLNQRLRLRVFAPDDDFPVLPTVVDIWPVANWFERE 122

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            +D++GI +EGHPDLRR+LTDYGF GHP RKDFP+ G VE+ YD + ++VVY+PV +
Sbjct: 123 SFDLFGIMYEGHPDLRRLLTDYGFVGHPFRKDFPMIGNVEMRYDPERQRVVYQPVTI 179


>gi|114330927|ref|YP_747149.1| NADH dehydrogenase subunit C [Nitrosomonas eutropha C91]
 gi|122314157|sp|Q0AHJ8|NUOC_NITEC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|114307941|gb|ABI59184.1| NADH dehydrogenase subunit C [Nitrosomonas eutropha C91]
          Length = 206

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 119/186 (63%), Gaps = 18/186 (9%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-----------RFD 73
           +++GEL++ +   DL+ +   LR+     F  ++DLCGVD+   +            RF 
Sbjct: 26  HALGELTILIHSRDLLGIAETLRNHTDLAFDTLVDLCGVDYSEYTTNTHAGYKRGDKRFA 85

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           VVYH LS K+N RLR+++ V + +   + S++ I+P A+W+ERE +D++GI F  HPDLR
Sbjct: 86  VVYHLLSVKHNHRLRIRVFVDDNEFPMLDSVIHIWPSANWYEREAFDLFGIVFNNHPDLR 145

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSL 191
           RILTDYGF G+P RKDFP++G +E+ YD + K+V+Y+P+ +  E R+   ++P+      
Sbjct: 146 RILTDYGFIGNPFRKDFPLSGHMEMQYDPEQKRVIYQPITI--EPRE---ITPYIIREEQ 200

Query: 192 FAKEDS 197
           + KE++
Sbjct: 201 YGKEET 206


>gi|217970158|ref|YP_002355392.1| NADH dehydrogenase subunit C [Thauera sp. MZ1T]
 gi|217507485|gb|ACK54496.1| NADH (or F420H2) dehydrogenase, subunit C [Thauera sp. MZ1T]
          Length = 201

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 112/181 (61%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + + F   ++  V   GE++++V   +   +   LRD     F  +IDL
Sbjct: 1   MSAKLERLSQTLRDVFGNRIQSLVLDRGEVTIEVSAAEYPRVARQLRDHADLRFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
            G+D+ +  N      RF  V H  S K+N RLRV++  A+  + P   S+V ++P A+W
Sbjct: 61  SGLDYSAYGNAIWEGKRFASVAHLTSVKHNWRLRVRV-FADDDAFPVIDSVVDVWPSANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           +ERE +D+YGI + GHPDLRRILTDYGF GHP RKDFPV+G+VE+ YD +  +VVY+PV 
Sbjct: 120 YERESFDLYGILYSGHPDLRRILTDYGFVGHPFRKDFPVSGYVEMRYDPEQGRVVYQPVS 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|56791602|gb|AAW30339.1| NADH dehydrogenase subunit 9 [Eschscholzia californica]
          Length = 165

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 91/127 (71%)

Query: 58  IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVW 117
           ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   +  +V  +P A  +EREVW
Sbjct: 39  IDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISPVVSPFPSAGRWEREVW 98

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR 177
           DM+G+    HPDLRRI TD+GFEGHPLRKD P++G+VE+ YDD  K+VV  P+E+ QE R
Sbjct: 99  DMFGVSSINHPDLRRISTDHGFEGHPLRKDLPLSGYVEVRYDDPEKRVVSEPIEMTQEFR 158

Query: 178 DYDFLSP 184
            +D  SP
Sbjct: 159 YFDSASP 165


>gi|56791604|gb|AAW30340.1| NADH dehydrogenase subunit 9 [Agave attenuata]
          Length = 179

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (66%), Gaps = 9/144 (6%)

Query: 50  PHCCFVNI---------IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
           P  CF+ +         ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   + 
Sbjct: 36  PLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRIS 95

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V  +P A  +EREVWDM G+    HPDLRRI TD+GFEGHPLRKDFP++G+VE+ YDD
Sbjct: 96  PVVSPFPSAGRWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDFPLSGYVEVRYDD 155

Query: 161 KVKKVVYRPVELMQEHRDYDFLSP 184
             K+VV  P+E+ QE R +D  SP
Sbjct: 156 PEKRVVSEPIEMTQEFRYFDSASP 179


>gi|239816481|ref|YP_002945391.1| NADH (or F420H2) dehydrogenase, subunit C [Variovorax paradoxus
           S110]
 gi|239803058|gb|ACS20125.1| NADH (or F420H2) dehydrogenase, subunit C [Variovorax paradoxus
           S110]
          Length = 203

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 10/176 (5%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L   I  +     +    ++GE+++ V     +     LRD P C F  +IDLCG+D+
Sbjct: 9   EVLRATIAETLGARAKSVTLALGEVTVVVAADAYIEAAMLLRDAPGCRFEQLIDLCGMDY 68

Query: 66  LS------RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYP---GADWFEREV 116
                   +  R+ VV H LS   N+R+R+K+  A  + +P +  + P    A WFERE 
Sbjct: 69  SDYREGEWQGERYGVVTHLLSVSLNQRVRLKV-FAPNEDLPVVDSLQPVWNAATWFEREA 127

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI FEGH DLRRILTDYGF GHP RKDFPV+G VE+ YD++ K+VVY+PV +
Sbjct: 128 FDLYGIVFEGHDDLRRILTDYGFIGHPFRKDFPVSGHVEMRYDEEQKRVVYQPVSI 183


>gi|77166021|ref|YP_344546.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosococcus oceani
           ATCC 19707]
 gi|254436376|ref|ZP_05049882.1| NADH dehydrogenase, subunit C subfamily, putative [Nitrosococcus
           oceani AFC27]
 gi|123593539|sp|Q3J830|NUOC_NITOC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|76884335|gb|ABA59016.1| NADH dehydrogenase subunit C [Nitrosococcus oceani ATCC 19707]
 gi|207088066|gb|EDZ65339.1| NADH dehydrogenase, subunit C subfamily, putative [Nitrosococcus
           oceani AFC27]
          Length = 231

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 116/203 (57%), Gaps = 31/203 (15%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L   I   F G + F     GEL+++V      ++C  LRD+ +  F  +IDL
Sbjct: 1   MANSVAELRRRIEGRFDGEIGFCRLERGELTIEVPREFYFAVCKALRDEENFGFEQLIDL 60

Query: 61  CGVDFL-----------------SRS-------------NRFDVVYHFLSPKYNRRLRVK 90
           CGVD++                 SR+             +RF VV H LS ++N RLRV+
Sbjct: 61  CGVDYMEYGLSDWETKKATVDGFSRAVERRQYKKQAWTRSRFAVVVHLLSVRHNWRLRVR 120

Query: 91  IAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
             V E   V PS++ ++   +WFERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP
Sbjct: 121 TFVDEEILVAPSVIQLWASVNWFEREAFDLFGILFEGHPDLRRILTDYGFIGHPFRKDFP 180

Query: 150 VTGFVELHYDDKVKKVVYRPVEL 172
           ++G VE+ YD + ++V+Y PV +
Sbjct: 181 LSGNVEMRYDPEQQRVIYEPVSI 203


>gi|74325198|ref|YP_316618.1| NADH dehydrogenase subunit 9 [Thalassiosira pseudonana]
 gi|74100264|gb|AAZ99425.1| NADH dehydrogenase subunit 9 [Thalassiosira pseudonana]
          Length = 184

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 90/126 (71%)

Query: 60  LCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDM 119
           + GVD+ +   RF +VY  LS +YN RLRVK    E   V S   +Y  A W+E E+WDM
Sbjct: 59  ITGVDYPNNKYRFKLVYDLLSIRYNIRLRVKTFTHELFGVDSCDKLYFTAGWYECEIWDM 118

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           YG+FF+ H +L+RILTDYGFEGHPLRKDFP++GFVE+ Y++  K+V+   +EL QE+R +
Sbjct: 119 YGVFFKNHSNLKRILTDYGFEGHPLRKDFPLSGFVEMKYNETEKRVINESIELCQEYRTF 178

Query: 180 DFLSPW 185
            FLSPW
Sbjct: 179 KFLSPW 184


>gi|160900610|ref|YP_001566192.1| NADH (or F420H2) dehydrogenase subunit C [Delftia acidovorans
           SPH-1]
 gi|218534269|sp|A9BNB2|NUOC_DELAS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|160366194|gb|ABX37807.1| NADH (or F420H2) dehydrogenase, subunit C [Delftia acidovorans
           SPH-1]
          Length = 203

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 107/175 (61%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D +  +     R    ++GE++++V     +     L   P C F  ++DLCGVD+
Sbjct: 10  EVLRDVVAAALGDKARSVTVALGEVTVEVSAAQYLEAMQVLHTAPDCRFEVLVDLCGVDY 69

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            + +       RF VV H LS   N+RLRV++   +     V S+  ++ GA+WFERE +
Sbjct: 70  STYAEVGREGPRFAVVSHLLSISLNQRLRVRVFCTDDDFPVVASVTSVWAGANWFEREAF 129

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY+PV +
Sbjct: 130 DLFGIVFDGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDPEQQRVVYQPVTI 184


>gi|294788081|ref|ZP_06753325.1| NADH dehydrogenase (ubiquinone), C subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294484374|gb|EFG32057.1| NADH dehydrogenase (ubiquinone), C subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 195

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 101/152 (66%), Gaps = 8/152 (5%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFLSPK 82
           E++++      + + + LRD     F +I+DLCGVD+ +  N      RF  V   +S K
Sbjct: 27  EVTIECQPEHYLDIMTTLRDHEDLHFESIVDLCGVDYSTYKNEKWQGKRFAAVSQLVSVK 86

Query: 83  YNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
           +N+R+RV++   +     VPS+V IY  ADW+ERE +DMYGI F  HPDLRRILTDYGF 
Sbjct: 87  HNQRVRVRVWAQDDDLPLVPSVVNIYNSADWYEREAFDMYGIIFNEHPDLRRILTDYGFV 146

Query: 141 GHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GHP RKDFPV+G+VE+ YD+  K+V+Y+PV +
Sbjct: 147 GHPFRKDFPVSGYVEMRYDETEKRVIYQPVTI 178


>gi|119897689|ref|YP_932902.1| NADH dehydrogenase subunit C [Azoarcus sp. BH72]
 gi|218534250|sp|A1K5B0|NUOC_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|119670102|emb|CAL94015.1| respiratory-chain NADH dehydrogenase, chain C probable [Azoarcus
           sp. BH72]
          Length = 201

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 112/181 (61%), Gaps = 10/181 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E L   + +     V   V   GE++++V  G+ + +   LRD+    F  ++D+
Sbjct: 1   MSAKLERLSQTLRDVLGDVVESLVVDRGEVTIEVAAGNFLDVARRLRDEAALGFEQLMDI 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADW 111
            G+D+ +  N      RF  V H LS K N RLR+++  A+    P   S+V ++P A+W
Sbjct: 61  SGIDYSAFGNGAWQGKRFASVAHLLSVKNNWRLRLRV-FADDDDFPVLGSLVEVWPSANW 119

Query: 112 FEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           FERE +D+YGI + GHPDLRRILTDYGF GHP RKDFP++G+VE+ YD +  +VVY+PV 
Sbjct: 120 FEREAFDLYGILYAGHPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDPEQGRVVYQPVT 179

Query: 172 L 172
           +
Sbjct: 180 I 180


>gi|312088396|ref|XP_003145846.1| hypothetical protein LOAG_10271 [Loa loa]
 gi|307758994|gb|EFO18228.1| hypothetical protein LOAG_10271 [Loa loa]
          Length = 144

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 85/115 (73%)

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
           V+Y  LS ++N R+RV+    E   + SI  I+ GA+W+EREV+DMYG++F  HPDLRRI
Sbjct: 1   VIYALLSIRFNARIRVRTYTDEIAPLESITSIFKGANWYEREVYDMYGVWFNNHPDLRRI 60

Query: 134 LTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGV 188
           LTDYGFEGHP RKDFP++G+VEL YD ++ + VY P EL QE R +D  +PWE +
Sbjct: 61  LTDYGFEGHPFRKDFPLSGYVELRYDSELGRCVYEPTELAQEFRKFDLKTPWESM 115


>gi|225468996|ref|XP_002263031.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 315

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 97/146 (66%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +      ID+ GVD  SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 165 QLLCFLKLHTYTRVQVSIDIWGVDHPSRKRRFEVVYNLLSTQYNSRIRVQTSADEVTRIS 224

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
           S+V ++P +  +EREVWDM+G+    H DL R+ TDYGFEGHPLRKD P++G+VE+ YDD
Sbjct: 225 SVVSLFPSSVRWEREVWDMFGVSSINHLDLHRLSTDYGFEGHPLRKDLPLSGYVEVRYDD 284

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPWE 186
             K+VV  P+E+ QE R +D  SPWE
Sbjct: 285 LEKRVVSEPIEMTQEFRYFDSASPWE 310


>gi|255708944|gb|ACU30377.1| NADH dehydrogenase subunit 9 [Silene ammophila]
          Length = 131

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 92/125 (73%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +      L  FL+   +  +  ++D+CGVD+ SRS RF+VVY+ LS ++N RLRV+ 
Sbjct: 6   FDTNTDFTFQLLCFLKLHSYTRYEVLVDICGVDYPSRSLRFEVVYNLLSTRFNSRLRVQS 65

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E + +PS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 66  SADEVRRIPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 125

Query: 152 GFVEL 156
           G+VE+
Sbjct: 126 GYVEV 130


>gi|299530744|ref|ZP_07044159.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           S44]
 gi|298721260|gb|EFI62202.1| NADH (or F420H2) dehydrogenase, subunit C [Comamonas testosteroni
           S44]
          Length = 190

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 107/169 (63%), Gaps = 8/169 (4%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN- 70
           +  +    VR    + GE++++V     + +   LR+ P C F  ++DLCGVD+ + +  
Sbjct: 2   VTAALGDRVRSVTLAYGEVTVEVSADKYLDVMQILRNAPDCQFEMLLDLCGVDYSTYAEV 61

Query: 71  -----RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIF 123
                RF VV H +S   N+RLRV++  A+     V SI  I+  A+WFERE +D++GI 
Sbjct: 62  GKDGPRFAVVSHLMSLTLNQRLRVRVYCADDDFPVVASINPIWNSANWFEREAFDLFGIV 121

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           FEGH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY+PV +
Sbjct: 122 FEGHEDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDAEQQRVVYQPVTI 170


>gi|222110088|ref|YP_002552352.1| NADH (or f420h2) dehydrogenase subunit c [Acidovorax ebreus TPSY]
 gi|221729532|gb|ACM32352.1| NADH (or F420H2) dehydrogenase, subunit C [Acidovorax ebreus TPSY]
          Length = 202

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (60%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D + ++    VR    ++ E+++ V     +     LRD P C F  +IDLCGVD+
Sbjct: 9   ESLRDVVASALGDRVRQISVALDEVTVVVSAARYLEAMQILRDAPDCKFEQLIDLCGVDY 68

Query: 66  L------SRSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
                  S   R+ VV H LS   N+RLRVK+  ++     V S+  I+  A+WFERE +
Sbjct: 69  SAYGATGSEGPRYAVVSHLLSVSLNQRLRVKVFCSDDDFPIVASVTDIWNSANWFEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD   ++V+Y PV +
Sbjct: 129 DLFGIVFDGHNDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDADQRRVIYEPVTI 183


>gi|121593379|ref|YP_985275.1| NADH (or F420H2) dehydrogenase subunit C [Acidovorax sp. JS42]
 gi|218534270|sp|A1W4M4|NUOC_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|120605459|gb|ABM41199.1| NADH dehydrogenase subunit C [Acidovorax sp. JS42]
          Length = 202

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (60%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D + ++    VR    ++ E+++ V     +     LRD P C F  +IDLCGVD+
Sbjct: 9   ESLRDVVASALGDRVRQISVALDEVTVVVSAARYLEAMQILRDAPDCKFEQLIDLCGVDY 68

Query: 66  L------SRSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
                  S   R+ VV H LS   N+RLRVK+  ++     V S+  I+  A+WFERE +
Sbjct: 69  SAYGATGSEGPRYAVVSHLLSVSLNQRLRVKVFCSDDDFPIVASVTDIWNSANWFEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD   ++V+Y PV +
Sbjct: 129 DLFGIVFDGHNDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDADQRRVIYEPVTI 183


>gi|319779200|ref|YP_004130113.1| NADH-ubiquinone oxidoreductase chain C [Taylorella equigenitalis
           MCE9]
 gi|317109224|gb|ADU91970.1| NADH-ubiquinone oxidoreductase chain C [Taylorella equigenitalis
           MCE9]
          Length = 204

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 112/184 (60%), Gaps = 14/184 (7%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +R IEDL   ++ S  G     V  V E+++DV   D V  C  LRD     F   +DLC
Sbjct: 1   MRDIEDLKASLIQSI-GDKFPIVEHVHEITIDVPSSDWVQTCITLRDHVDLRFDIAVDLC 59

Query: 62  GVDF----------LSR-SNRFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPG 108
           GVD+          +S+  NR+ VV H LS  +N R+RV+      E   V S+  ++  
Sbjct: 60  GVDYSKYGFPGNSTISKFPNRYAVVLHLLSTVHNSRVRVRTFALDDELPMVRSLTDVWAN 119

Query: 109 ADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYR 168
             WFERE +DM+GI FEGHPDLRRILTDYGF GHPLRKDFPV+G+VE+ +D++  +VVY+
Sbjct: 120 IGWFEREAFDMFGIVFEGHPDLRRILTDYGFIGHPLRKDFPVSGYVEMIFDEEQNRVVYQ 179

Query: 169 PVEL 172
           PV +
Sbjct: 180 PVSI 183


>gi|291613540|ref|YP_003523697.1| NADH (or F420H2) dehydrogenase, subunit C [Sideroxydans
           lithotrophicus ES-1]
 gi|291583652|gb|ADE11310.1| NADH (or F420H2) dehydrogenase, subunit C [Sideroxydans
           lithotrophicus ES-1]
          Length = 209

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 114/192 (59%), Gaps = 21/192 (10%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   +  L   +  +FS  V      +GEL+L +   D++++ + LRDD    F  ++D+
Sbjct: 1   MATDLNILSANLNEAFSVKVVSLEERLGELTLVIKAHDMLAVFTRLRDDADLRFEELVDV 60

Query: 61  CGVDFLSRSN-----------------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP--- 100
           CG+D+ +  +                 RF  VYH LS  +N RLRV++  A+   +P   
Sbjct: 61  CGIDYSTYGSELCEDGKYLPDEPRAGPRFAAVYHLLSITHNIRLRVRV-FADDDDMPVLN 119

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
           S+ GI+P A+W+ERE +D+YGI F GHPDLRRILTDYGF G+P RKDFP++G VE+ YD 
Sbjct: 120 SVTGIWPSANWYEREAFDLYGIIFVGHPDLRRILTDYGFVGNPFRKDFPLSGTVEMRYDA 179

Query: 161 KVKKVVYRPVEL 172
             ++V+Y PV +
Sbjct: 180 AQQRVIYEPVTV 191


>gi|302879340|ref|YP_003847904.1| NADH (or F420H2) dehydrogenase, subunit C [Gallionella
           capsiferriformans ES-2]
 gi|302582129|gb|ADL56140.1| NADH (or F420H2) dehydrogenase, subunit C [Gallionella
           capsiferriformans ES-2]
          Length = 198

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/152 (46%), Positives = 100/152 (65%), Gaps = 8/152 (5%)

Query: 27  VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS------RSNRFDVVYHFLS 80
           +GE ++ V   D++ + + LRD  +  F  + DLCG+D+           RF VVY  LS
Sbjct: 27  LGETTIVVRAVDMLPVLTKLRDAENLQFTQMTDLCGMDYSEYGEGAWEGRRFAVVYQLLS 86

Query: 81  PKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
             +NRRLRV+I   E     + S+  ++ GA+WFERE +D++GI F GHPDLRRILTDYG
Sbjct: 87  VVHNRRLRVRIFAEEDDFPVLASVTPVWAGANWFEREAFDLFGIIFTGHPDLRRILTDYG 146

Query: 139 FEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           F G+P RKDFP++G VE+ YD + ++VVY+PV
Sbjct: 147 FVGNPFRKDFPISGHVEMRYDAEQQRVVYQPV 178


>gi|147801824|emb|CAN77857.1| hypothetical protein VITISV_001361 [Vitis vinifera]
          Length = 154

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +      ID+ GVD  SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 7   QLLCFLKLHTYTRVQVSIDIWGVDHPSRKRRFEVVYNLLSTQYNSRIRVQTSADEVTRIS 66

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
           S+V ++P +  +EREVWDM+G+    H DL R+ TDYGFEGHPLRKD P++G+VE+ YDD
Sbjct: 67  SVVSLFPSSVRWEREVWDMFGVSSINHLDLHRLSTDYGFEGHPLRKDLPLSGYVEVRYDD 126

Query: 161 KVKKVVYRPVELMQEHRDYDFLSPW 185
             K+VV  P+E+ QE R +D  SPW
Sbjct: 127 LEKRVVSEPIEMTQEFRYFDSASPW 151


>gi|332528753|ref|ZP_08404730.1| NADH (or F420H2) dehydrogenase, subunit C [Hylemonella gracilis
           ATCC 19624]
 gi|332041819|gb|EGI78168.1| NADH (or F420H2) dehydrogenase, subunit C [Hylemonella gracilis
           ATCC 19624]
          Length = 202

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 108/175 (61%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L + +  +    VR     + E++++V   D  +    LRD P C F  +IDLCGVD+
Sbjct: 9   EALKNAVTAALGELVRRIEVRLDEVTVEVAPKDYRTAAMLLRDAPGCQFEQLIDLCGVDY 68

Query: 66  LS------RSNRFDVVYHFLSPKYNRRLRVKIAVA--EGKSVPSIVGIYPGADWFEREVW 117
            +         R+ VV H LS   N+R+R+K+     E   + S+  ++  A+W+ERE +
Sbjct: 69  SAYGDGAWEGARYAVVSHLLSVSLNQRVRLKVYATDDEFPVLDSLTSVWAAANWYEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI FEGH DLRRILTDYGF GHP RKDFP++G VE+ YD ++++VVY+PV +
Sbjct: 129 DLFGIVFEGHDDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDAELQRVVYQPVSI 183


>gi|51473549|ref|YP_067306.1| NADH dehydrogenase subunit C [Rickettsia typhi str. Wilmington]
 gi|81390151|sp|Q68X18|NUOC_RICTY RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|51459861|gb|AAU03824.1| NADH dehydrogenase (ubiquinone) subunit C [Rickettsia typhi str.
           Wilmington]
          Length = 197

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 111/181 (61%), Gaps = 3/181 (1%)

Query: 10  DYIVNSFSGSVRFAVNSVG---ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           D +++  +   R  +  V     L+  ++   L+     L++     F  + DL GVDF 
Sbjct: 4   DELIDKLAAKSRILITKVTVKDHLAYKIEPHFLLPFLKALKESEELRFTVLTDLFGVDFP 63

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            R  RF++VY+ LS K N+ L +K  ++E +S+PS + I   A W+E EV+DMYG+ F G
Sbjct: 64  KREKRFEIVYNLLSLKLNKNLIIKTNISEKESIPSAMKILSAACWYELEVYDMYGVNFNG 123

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           + D RRILTDY FEGHPLRKDFP+TG+ ++ YD K+KK+ Y PV L  E+R++DF S W 
Sbjct: 124 NNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLKKIAYEPVNLDIEYREFDFSSHWH 183

Query: 187 G 187
            
Sbjct: 184 S 184


>gi|328925352|gb|AEB66295.1| NADH dehydrogenase subunit 9 [Silene multinervia]
 gi|328925354|gb|AEB66296.1| NADH dehydrogenase subunit 9 [Silene multinervia]
          Length = 150

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 91/126 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 25  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 84

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD
Sbjct: 85  PVVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDD 144

Query: 161 KVKKVV 166
             K+VV
Sbjct: 145 PEKRVV 150


>gi|262216844|gb|ACY37806.1| NADH dehydrogenase subunit 9 [Plasmopara halstedii]
          Length = 114

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 87/111 (78%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E + V SI+ IY  A+W EREVWDM+GIFF  H DLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKIKINELQPVNSIIEIYKSANWCEREVWDMFGIFFSNHSDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY  + L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYESINLSQQYRLFEFNNPWD 111


>gi|262216838|gb|ACY37802.1| NADH dehydrogenase subunit 9 [Plasmopara halstedii]
 gi|262216841|gb|ACY37804.1| NADH dehydrogenase subunit 9 [Plasmopara halstedii]
          Length = 113

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 87/111 (78%)

Query: 76  YHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           Y+ LS ++N RL++KI + E + V SI+ IY  A+W EREVWDM+GIFF  H DLRRILT
Sbjct: 1   YNLLSIRFNSRLKIKIKINELQPVNSIIEIYKSANWCEREVWDMFGIFFSNHSDLRRILT 60

Query: 136 DYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           DYGFEGHPLRKDFP++GF+E+ Y++  K+VVY  + L Q++R ++F +PW+
Sbjct: 61  DYGFEGHPLRKDFPLSGFLEVFYNELKKRVVYESINLSQQYRLFEFNNPWD 111


>gi|15604223|ref|NP_220739.1| NADH dehydrogenase subunit C [Rickettsia prowazekii str. Madrid E]
 gi|6647679|sp|Q9ZDH3|NUOC_RICPR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|3860915|emb|CAA14815.1| NADH DEHYDROGENASE I CHAIN C (nuoC) [Rickettsia prowazekii]
          Length = 197

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 110/181 (60%), Gaps = 3/181 (1%)

Query: 10  DYIVNSFSGSVRFAVNSVG---ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           D ++   +   R  +  V     L+  ++   L+     L++     F  + DL GVDF 
Sbjct: 4   DKLIEKLAAKFRIVITKVAVKDHLAYKIEPHFLLPFLKALKESEELRFTVLTDLFGVDFP 63

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            +  RF+VVY+ LS K N+ L +K  ++E +S+PS + I   A W+E EV+DMYG+ F G
Sbjct: 64  KKEKRFEVVYNLLSLKLNKNLIIKTHISEKESIPSAMQILSAAYWYELEVYDMYGVNFNG 123

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           + D RRILTDY FEGHPLRKDFP+TG+ ++ YD K++KV Y PV L  E+R++DF S W 
Sbjct: 124 NNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLEKVTYEPVNLDIEYREFDFSSHWH 183

Query: 187 G 187
            
Sbjct: 184 S 184


>gi|292571964|gb|ADE29879.1| NADH dehydrogenase I chain C [Rickettsia prowazekii Rp22]
          Length = 197

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 110/181 (60%), Gaps = 3/181 (1%)

Query: 10  DYIVNSFSGSVRFAVNSVG---ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           D ++   +   R  +  V     L+  ++   L+     L++     F  + DL GVDF 
Sbjct: 4   DKLIEKLAAKFRIVITKVAVKDHLAYKIEPHFLLPFLKALKESEELRFTVLTDLFGVDFP 63

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
            +  RF+VVY+ LS K N+ L +K  ++E +S+PS + I   A W+E EV+DMYG+ F G
Sbjct: 64  KKEKRFEVVYNLLSLKLNKNLIIKTHISEKESIPSAMQILSAAYWYELEVYDMYGVNFNG 123

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWE 186
           + D RRILTDY FEGHPLRKDFP+TG+ ++ YD K++KV Y PV L  E+R++DF S W 
Sbjct: 124 NNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLEKVTYEPVNLDIEYREFDFSSHWH 183

Query: 187 G 187
            
Sbjct: 184 S 184


>gi|332968233|gb|EGK07310.1| NADH-quinone oxidoreductase subunit C [Kingella kingae ATCC 23330]
          Length = 195

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 101/152 (66%), Gaps = 8/152 (5%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFLSPK 82
           E++++      + + + LRD     F +++DLCGVD+ +  N      RF  V   +S K
Sbjct: 27  EVTIECQPEHYLDIMTTLRDHEDLHFESLVDLCGVDYSTYKNEAWQGKRFAAVSQLVSVK 86

Query: 83  YNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
            N+R+RV++   +     VPS+V +Y GADW+ERE +DMYGI F  HPDLRRILTDYGF 
Sbjct: 87  NNQRVRVRVWAQDDDLPIVPSVVELYNGADWYEREAFDMYGIIFNEHPDLRRILTDYGFV 146

Query: 141 GHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GHP RKDFP++G+VE+ YD+  K+V+Y+PV +
Sbjct: 147 GHPFRKDFPISGYVEMRYDENEKRVIYQPVTI 178


>gi|292493666|ref|YP_003529105.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosococcus halophilus
           Nc4]
 gi|291582261|gb|ADE16718.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosococcus halophilus
           Nc4]
          Length = 231

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 113/203 (55%), Gaps = 31/203 (15%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + +L + +   F G +       GEL++ V      ++C  LRD+    F  +IDL
Sbjct: 1   MATGVMELQERVERRFEGEISSCRLDRGELTVQVPRESYFAVCKALRDEEDFAFEQLIDL 60

Query: 61  CGVDFL-----------------SRSN-------------RFDVVYHFLSPKYNRRLRVK 90
           CGVD+L                 SR+              RF V+ H LS ++N RLRV+
Sbjct: 61  CGVDYLEYGVGDWETRKATTQGFSRAVERRQHQEHVWGGLRFAVITHLLSIRHNWRLRVR 120

Query: 91  IAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
             V E   V PS+  ++  A+WFERE +D++GI F+GHPDLRRILTDYGF GHP RKDFP
Sbjct: 121 TFVEEEVPVAPSVTELWASANWFEREAFDLFGILFDGHPDLRRILTDYGFIGHPFRKDFP 180

Query: 150 VTGFVELHYDDKVKKVVYRPVEL 172
           ++G VE+ YD + ++V+Y PV +
Sbjct: 181 LSGNVEMRYDLEQQRVIYEPVSI 203


>gi|255709002|gb|ACU30406.1| NADH dehydrogenase subunit 9 [Silene macrodonta]
          Length = 131

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 90/125 (72%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +      L  FL+   +  +  ++D+CGVD+ SR  RF+VVY+ LS ++N RLRV+ 
Sbjct: 6   FDTNTDFAFQLLCFLKLHSYTRYEVLVDICGVDYPSRRLRFEVVYNLLSTRFNSRLRVQT 65

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +PS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 66  SADEVSRIPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 125

Query: 152 GFVEL 156
           G+VE+
Sbjct: 126 GYVEV 130


>gi|325267316|ref|ZP_08133978.1| NADH-quinone oxidoreductase subunit C [Kingella denitrificans ATCC
           33394]
 gi|324981253|gb|EGC16903.1| NADH-quinone oxidoreductase subunit C [Kingella denitrificans ATCC
           33394]
          Length = 195

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 10/175 (5%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
           DL         G     + + GEL+++      + +   LRD     F  +IDLCGVD+ 
Sbjct: 5   DLKAACTRILGGKADNIILAFGELTVECRPEHYLDIMQTLRDHAELHFETLIDLCGVDYS 64

Query: 67  SRSN------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVW 117
           +  N      RF VV   LS + N+R+RV++  A+  S P   ++  +Y GADW+ERE +
Sbjct: 65  TYKNQEWHGKRFAVVSQLLSVQNNQRVRVRVW-ADDDSFPIVHTVTHLYNGADWYEREAF 123

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           DMYGI F  HPDLRRILTDYGF GHP RKDFPV+G VE+ YD+  K+V+Y+PV +
Sbjct: 124 DMYGIIFNEHPDLRRILTDYGFVGHPFRKDFPVSGHVEMRYDETEKRVIYQPVTI 178


>gi|300113267|ref|YP_003759842.1| NADH /F420H2 dehydrogenase subunit C [Nitrosococcus watsonii C-113]
 gi|299539204|gb|ADJ27521.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrosococcus watsonii
           C-113]
          Length = 230

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (54%), Gaps = 31/203 (15%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   + DL   +   F G +       GEL+++V      ++C  LRD+    F  +IDL
Sbjct: 1   MANGVADLRRRVEGRFDGEIGSCRLDRGELTIEVPRESYFAVCKTLRDEEDFGFEQLIDL 60

Query: 61  CGVDFLSRSN------------------------------RFDVVYHFLSPKYNRRLRVK 90
           CGVD+L                                  RF VV H LS ++N RLRV+
Sbjct: 61  CGVDYLEHGVADWATRKATAQGFGRAVERRQHKEQAWAGLRFAVVVHLLSVRHNWRLRVR 120

Query: 91  IAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
             V E    VPS++ ++  A+WFERE +D++GI F+GHPDLRRILTDYGF GHP RKDFP
Sbjct: 121 TFVDEEILVVPSVIQLWASANWFEREAFDLFGILFDGHPDLRRILTDYGFIGHPFRKDFP 180

Query: 150 VTGFVELHYDDKVKKVVYRPVEL 172
           ++G VE+ YD + ++V+Y PV +
Sbjct: 181 LSGNVEMRYDPEQQRVIYEPVSI 203


>gi|269469170|gb|EEZ80712.1| NADH dehydrogenase I chain C [uncultured SUP05 cluster bacterium]
          Length = 204

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 110/196 (56%), Gaps = 32/196 (16%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +EDL + ++  F       V +  EL+L ++  D++  C  LRD     F  ++DLCGVD
Sbjct: 1   MEDLKEQLIEEFGEDS--LVEAFSELTLTINVNDIIKTCLKLRD--FFFFDTLVDLCGVD 56

Query: 65  FLS---------------------------RSNRFDVVYHFLSPKYNRRLRVKIAVAEGK 97
           +L+                            S RF VVYH LS   N+RLRVK  V E +
Sbjct: 57  YLTYGQSDWDAGASSSGFSRGREAQGGDDRHSERFAVVYHLLSVSKNQRLRVKSFVDEAE 116

Query: 98  SV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +  S+  I+  ADW+ERE +D+ GI FE H DLRRILTDYGF GHPLRKDFP+ G VE+
Sbjct: 117 PIIESVTDIWASADWYEREAFDLMGILFENHVDLRRILTDYGFVGHPLRKDFPMIGEVEM 176

Query: 157 HYDDKVKKVVYRPVEL 172
            YD+ + +VVY PV +
Sbjct: 177 RYDEDLGRVVYEPVSI 192


>gi|256821517|ref|YP_003145480.1| NADH (or F420H2) dehydrogenase subunit C [Kangiella koreensis DSM
           16069]
 gi|256795056|gb|ACV25712.1| NADH (or F420H2) dehydrogenase, subunit C [Kangiella koreensis DSM
           16069]
          Length = 231

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 111/199 (55%), Gaps = 32/199 (16%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L + + N F   +     + GE++++V   DL+ +   LRD     F  +IDL  VD+
Sbjct: 3   ESLVNTLGNIFGDKLIACDKAFGEVTIEVAQDDLLEVAKELRDQDELKFEQLIDLTVVDY 62

Query: 66  LS-------------------------------RSNRFDVVYHFLSPKYNRRLRVKIAVA 94
           ++                               + +RF VVYH LS  +N RLRVK  V 
Sbjct: 63  MTYGQDEWATTEATGTGFGRAREAISSPVHQEWQRDRFAVVYHLLSISHNWRLRVKCFVK 122

Query: 95  EGKS-VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           E +  +PS++ ++  A+W+ERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP+ G 
Sbjct: 123 ENRPMLPSVIPVWNSANWYEREAFDLFGILFEGHPDLRRILTDYGFIGHPFRKDFPLIGN 182

Query: 154 VELHYDDKVKKVVYRPVEL 172
           VEL YD K K+ VY PV +
Sbjct: 183 VELRYDAKQKRCVYEPVSI 201


>gi|294669094|ref|ZP_06734180.1| NADH dehydrogenase, C subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309086|gb|EFE50329.1| NADH dehydrogenase, C subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 196

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 10/156 (6%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFL 79
           ++ E++++      + +   LRD     F  ++DLCGVD+ +  N      RF VV   L
Sbjct: 24  ALDEVTVECRPEYYLDIMQTLRDHEEMHFELLVDLCGVDYSTYKNEAWPGQRFAVVSQLL 83

Query: 80  SPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTD 136
           S K N+R+RV++  AE    P   S++ IY  ADW+ERE +DMYGI FE HPDLRRILTD
Sbjct: 84  SVKNNQRIRVRVW-AENDDFPLVQSVINIYNSADWYEREAFDMYGIVFENHPDLRRILTD 142

Query: 137 YGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           YGF GHP RKDFP++G+VE+ YD+  K+V+Y+PV +
Sbjct: 143 YGFVGHPFRKDFPISGYVEMRYDETEKRVIYQPVTI 178


>gi|187764084|ref|YP_001876533.1| NADH dehydrogenase subunit 9 [Dictyostelium fasciculatum]
 gi|160688792|gb|ABX45207.1| NADH dehydrogenase subunit 9 [Dictyostelium fasciculatum]
          Length = 207

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 104/160 (65%), Gaps = 4/160 (2%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS----RSNRFDVVYHFLSPKYNR 85
           L++ V+  DL+++ + L+++    +  ++D+  VD L+    +  RF ++Y   S   N 
Sbjct: 34  LNVFVESKDLINILTILQNNTMFQYKMLLDIVVVDCLNIDENKKGRFKLLYVLHSIYNNH 93

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           RL +   +   + + +    Y  A W ERE+WDMYGI+FE HPDLRRILTDYGF  +PLR
Sbjct: 94  RLNIVTYLNNNEIIKTSSLNYSSAVWLEREIWDMYGIYFESHPDLRRILTDYGFSWYPLR 153

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPW 185
           KDFP+TG++E++YD   KK++Y+ +ELMQE R+Y+F   W
Sbjct: 154 KDFPLTGYLEVYYDINDKKIIYKSIELMQEFRNYEFGKSW 193


>gi|121604332|ref|YP_981661.1| NADH (or F420H2) dehydrogenase subunit C [Polaromonas
           naphthalenivorans CJ2]
 gi|218534341|sp|A1VM62|NUOC_POLNA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|120593301|gb|ABM36740.1| NADH dehydrogenase subunit C [Polaromonas naphthalenivorans CJ2]
          Length = 204

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 109/176 (61%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  LG+ I     G  +    ++GE+++ V   D ++  + LRD P C F  ++DLCG+D
Sbjct: 10  VSQLGETIALVLGGKAKSVKIALGEITVTVAAADYLAAATLLRDAPGCKFEQLLDLCGLD 69

Query: 65  FLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
           +    N      R+ V  H LS   N+R+R+K+   +     V S+ GI+  A+WFERE 
Sbjct: 70  YSEYKNGQYDGLRYCVSSHLLSVSLNQRVRLKVFCPDDDFPVVDSVNGIWNSANWFEREA 129

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI FEGH DLRRILTDYGF GHP RKDFP TG VE+ YD + K+V+Y+PV +
Sbjct: 130 FDLYGIVFEGHNDLRRILTDYGFIGHPFRKDFPTTGHVEMRYDAEQKRVIYQPVTI 185


>gi|117926907|ref|YP_867524.1| NADH (or F420H2) dehydrogenase, subunit C [Magnetococcus sp. MC-1]
 gi|117610663|gb|ABK46118.1| NADH dehydrogenase subunit C [Magnetococcus sp. MC-1]
          Length = 187

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 95/160 (59%), Gaps = 9/160 (5%)

Query: 29  ELSLDVDCGDLVSLC---------SFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           EL  +  CG LV  C           +RDDP   F   ID+  V +  R   F+VVY  L
Sbjct: 19  ELKREWVCGALVVWCDPEQVVDTLRTMRDDPGMNFKLFIDVTAVHYPKREKPFEVVYQLL 78

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
           S   N R+RVK  V     VPSI G++  ADWFERE+++M+GI   GHPDLRR+L DY F
Sbjct: 79  SVHKNHRIRVKTLVDADTPVPSITGLWKAADWFEREMYEMFGILISGHPDLRRLLLDYDF 138

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           +G PLRKDFPVTG  EL YD+  +++V  PV L   +R++
Sbjct: 139 DGFPLRKDFPVTGPFELRYDETQQRIVREPVSLTVPNRNF 178


>gi|319787441|ref|YP_004146916.1| NADH (or F420H2) dehydrogenase, subunit C [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465953|gb|ADV27685.1| NADH (or F420H2) dehydrogenase, subunit C [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 250

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 112/223 (50%), Gaps = 51/223 (22%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M          + + F G+        GE++L+V  GDL++ C  LRD+    F  +IDL
Sbjct: 1   MAEPAATFAQRLRDRFPGATVIVAEPRGEVTLEVSAGDLLATCFALRDE--LGFEQLIDL 58

Query: 61  CGVDFLSRSN-----------------------------------------------RFD 73
           CG+D++   +                                               RF 
Sbjct: 59  CGIDYMGYGSDEWDTDDVSSSGFSRGVEGKGPGRFGWGEKPSEQGEAGIEPVLVPERRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
            V H LS   N+RLRV+   A+     VPS+  ++ GA+WFERE +D+YGI FEGHPDLR
Sbjct: 119 AVTHLLSCANNQRLRVRCYAADDTLPVVPSLTRVWRGANWFEREAFDLYGIIFEGHPDLR 178

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           RI+TDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV  ++
Sbjct: 179 RIMTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPVTSVE 221


>gi|157166932|gb|ABV25446.1| NADH dehydrogenase subunit 9 [Silene noctiflora]
 gi|255709052|gb|ACU30431.1| NADH dehydrogenase subunit 9 [Silene turkestanica]
          Length = 131

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 88/125 (70%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D     L  L  FLR   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 6   FDTTPAFLFQLLCFLRLHTYTRFEVLIDICGVDYPSRQVRFEVVYNLLSTRYNSRIRVQS 65

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +  +V ++P A W+EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 66  SADEVTRISPVVSLFPSAGWWEREVWDMFGLSFINHPDLRRILTDYGFEGHPLRKDFPLS 125

Query: 152 GFVEL 156
           G+VE+
Sbjct: 126 GYVEV 130


>gi|171463528|ref|YP_001797641.1| NADH (or F420H2) dehydrogenase, subunit C [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|218534306|sp|B1XUK0|NUOC_POLNS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|171193066|gb|ACB44027.1| NADH (or F420H2) dehydrogenase, subunit C [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 199

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 100/156 (64%), Gaps = 10/156 (6%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS------RSNRFDVVYHFL 79
           ++GE+++ V           +RDDP   F  +IDLCGVD+           RF VV H L
Sbjct: 26  ALGEVTVVVYADTYFESAMLMRDDPSLAFEQLIDLCGVDYQDFRDGAWAGQRFGVVSHLL 85

Query: 80  SPKYNRRLRVKIAVAEGKSVPSIVGIYP---GADWFEREVWDMYGIFFEGHPDLRRILTD 136
           S ++N RLRV++  A   S P +  + P    A+WFERE +D+YGI F+GH DLRRILTD
Sbjct: 86  SLEHNWRLRVRV-FAPDDSYPLVASVSPVWNSANWFEREAFDLYGILFDGHDDLRRILTD 144

Query: 137 YGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           YGF GHP RKDFP++G VE+ YD ++K+V+Y+PV +
Sbjct: 145 YGFIGHPFRKDFPISGNVEMRYDPELKRVIYQPVTI 180


>gi|329118900|ref|ZP_08247595.1| NADH-quinone oxidoreductase subunit C [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464928|gb|EGF11218.1| NADH-quinone oxidoreductase subunit C [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 196

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/155 (45%), Positives = 100/155 (64%), Gaps = 8/155 (5%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFL 79
           + GE++++      + + + LRD     F  ++DLCGVD+ +  N      RF  V   L
Sbjct: 24  AFGEVTVECRAEHYLDVMTTLRDHEELHFELLVDLCGVDYSTYKNQAWQGKRFAAVSQLL 83

Query: 80  SPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
           S K N+R+RV++   +     V S+V +Y  ADW+ERE +DMYGI F  HPDLRRILTDY
Sbjct: 84  SVKNNQRIRVRVWADDDGFPVVESVVPVYNSADWYEREAFDMYGIIFNNHPDLRRILTDY 143

Query: 138 GFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GF GHP RKDFPV+G+VE+ YD+  K+V+Y+PV +
Sbjct: 144 GFVGHPFRKDFPVSGYVEMRYDEAEKRVIYQPVTI 178


>gi|118602277|ref|YP_903492.1| NADH (or F420H2) dehydrogenase, subunit C [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|218534343|sp|A1AVR4|NUOC_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|118567216|gb|ABL02021.1| NADH dehydrogenase subunit C [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 204

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 110/196 (56%), Gaps = 32/196 (16%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++DL   ++  F    R  V + GEL+L VD  D++  C  LRD     F  +IDLCGVD
Sbjct: 1   MQDLKASLIKVFGE--RHLVEAFGELTLIVDSQDIIKTCLKLRD--FFYFDTLIDLCGVD 56

Query: 65  FLS---------------------------RSNRFDVVYHFLSPKYNRRLRVKIAVAEGK 97
           +L+                              RF VVYH LS   N+R+RVK  V E +
Sbjct: 57  YLTYGQSDWNGNASASGFSRGRNHQGSKDRHEQRFVVVYHLLSVSKNKRIRVKSFVDEAE 116

Query: 98  SV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +  S+  I+  ADW+ERE +D+ GI FE H DLRRILTDYGF+GHPLRKDFP+ G VE+
Sbjct: 117 PIIKSVTDIWASADWYEREAFDLMGILFENHTDLRRILTDYGFKGHPLRKDFPMIGEVEM 176

Query: 157 HYDDKVKKVVYRPVEL 172
            YD+ + +VVY  V +
Sbjct: 177 RYDEDLGRVVYEKVSI 192


>gi|149927543|ref|ZP_01915797.1| NADH dehydrogenase subunit C [Limnobacter sp. MED105]
 gi|149823816|gb|EDM83042.1| NADH dehydrogenase subunit C [Limnobacter sp. MED105]
          Length = 203

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 107/176 (60%), Gaps = 8/176 (4%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +E L   +V +    +     + GE++L V     +  C  LRD     F  +IDLCG+D
Sbjct: 9   LEKLSADLVAALGDRIVECKLAFGEVNLTVKADSYMESCLILRDHEDLQFEQLIDLCGLD 68

Query: 65  F------LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREV 116
                  L+ S RF VV   LS   N R+R+K+   +    +V S++ ++  A+W+ERE 
Sbjct: 69  RSEYGNELNESQRFWVVCQLLSVSKNMRVRLKVCCPDDDLPTVASVIDVWSSANWYEREA 128

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           +D+YGI FEGHPDLRRILTDYGF GHP RKDFP++G VE+ YD ++ +VVY+PV +
Sbjct: 129 FDLYGIVFEGHPDLRRILTDYGFVGHPFRKDFPLSGHVEMRYDPELGRVVYQPVTI 184


>gi|56791608|gb|AAW30342.1| NADH dehydrogenase subunit 9 [Amborella trichopoda]
          Length = 173

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 89/123 (72%)

Query: 58  IDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVW 117
           ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +  E   + S+V  +P A  +EREVW
Sbjct: 50  IDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTSADEVTRISSVVSPFPSAGRWEREVW 109

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHR 177
           DM G+    HPDLRRI TD+GFEGHPLRKD P++G+VE+ +DD  K+VV  P+E+ QE R
Sbjct: 110 DMSGVSPINHPDLRRISTDHGFEGHPLRKDLPLSGYVEVRHDDPEKRVVSEPIEMTQEFR 169

Query: 178 DYD 180
            +D
Sbjct: 170 YFD 172


>gi|255708962|gb|ACU30386.1| NADH dehydrogenase subunit 9 [Silene conica]
          Length = 131

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +      L  FL+   +  +  ++D+CGVD+ SR  RF+VVY+ LS ++N R+R++ 
Sbjct: 6   FDTNTDFTFQLLCFLKLHSYTRYEVLVDICGVDYPSRKLRFEVVYNLLSTRFNSRIRIQS 65

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +PS+V ++P A+W EREVWDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 66  SADEVSRIPSVVSLFPSANWCEREVWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLS 125

Query: 152 GFVEL 156
           G+VE+
Sbjct: 126 GYVEV 130


>gi|225024123|ref|ZP_03713315.1| hypothetical protein EIKCOROL_00991 [Eikenella corrodens ATCC
           23834]
 gi|224943148|gb|EEG24357.1| hypothetical protein EIKCOROL_00991 [Eikenella corrodens ATCC
           23834]
          Length = 196

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 104/166 (62%), Gaps = 10/166 (6%)

Query: 16  FSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN----- 70
             G     + ++ E++++      + +   LRD     F  ++DLCGVD+ +  +     
Sbjct: 14  LEGKADKVLLALDEVTVECRPEYYLDIMQTLRDHEEMHFELLVDLCGVDYSTYKDEPWLG 73

Query: 71  -RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEG 126
            RF VV   LS K N+R+RV++  AE    P   S++ IY  ADW+ERE +DMYGI FE 
Sbjct: 74  KRFAVVSQLLSVKNNQRIRVRVW-AENDDFPLVQSVINIYNSADWYEREAFDMYGIVFEN 132

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           HPDLRRILTDYGF GHP RKDFP++G+VE+ YD+  K+V+Y+PV +
Sbjct: 133 HPDLRRILTDYGFVGHPFRKDFPISGYVEMRYDETEKRVIYQPVTI 178


>gi|160688744|gb|ABX45160.1| NADH dehydrogenase subunit 9 [Polysphondylium pallidum]
          Length = 207

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 110/182 (60%), Gaps = 4/182 (2%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           +G  +       ++  + + G L + +D  DL ++ S L+ +       ++D+  +D L+
Sbjct: 12  IGTILAKLVPNLIKKIIYTPGNLDVIIDSKDLNNVLSILKLNTIMQCKMLLDIVCIDCLN 71

Query: 68  ----RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
               +  RF ++Y   S   N R+ V + +   +++ S   ++  A W ERE+WDMYGI+
Sbjct: 72  IEENKLGRFKIIYVLNSIFNNSRIHVIVYLKNNETIDSCSSLFSSAVWLEREIWDMYGIY 131

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGF  +PL+KDFP+TG++E++YD   KK++Y+P+ELMQE R Y++  
Sbjct: 132 FANHPDLRRILTDYGFSWYPLKKDFPLTGYIEVYYDINDKKIIYKPIELMQEFRMYEYGI 191

Query: 184 PW 185
            W
Sbjct: 192 SW 193


>gi|255708964|gb|ACU30387.1| NADH dehydrogenase subunit 9 [Silene conoidea]
          Length = 131

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 88/116 (75%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  +  ++D+CGVD+ SR+ RF+VVY+ LS ++N R+RV+ +    + +P
Sbjct: 15  QLLCFLKLHSYTRYEVLVDICGVDYPSRNLRFEVVYNLLSTRFNSRIRVQTSADAVRRIP 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           S+V ++P A+W ERE WDM+GI F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  SVVSLFPSANWCEREAWDMFGISFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|326910754|gb|AEA11195.1| NADH dehydrogenase subunit 9 [Selaginella moellendorffii]
 gi|327176863|gb|AEA29870.1| NADH dehydrogenase subunit 9 [Selaginella moellendorffii]
          Length = 205

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 95/147 (64%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           L  +  FL+      F  ++ L GVD+ SR+ R  +VY  LS   N R+R++    E   
Sbjct: 38  LFQVLWFLKYHSIARFSVLMHLAGVDYPSRAQRVALVYTLLSVSLNTRIRLRTTYDELTP 97

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           + S+  ++P ADW+EREVWDM+G+ F  HPD RRILTDYGF+ HPLRK+FP++G+V + Y
Sbjct: 98  ICSVSSLFPTADWWEREVWDMFGVHFSHHPDCRRILTDYGFDWHPLRKEFPLSGYVHVRY 157

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPW 185
           DD   ++V  P+E+ QE+R +D   PW
Sbjct: 158 DDSDGRIVTAPIEMNQEYRYFDLACPW 184


>gi|241763290|ref|ZP_04761347.1| NADH (or F420H2) dehydrogenase, subunit C [Acidovorax delafieldii
           2AN]
 gi|241367565|gb|EER61852.1| NADH (or F420H2) dehydrogenase, subunit C [Acidovorax delafieldii
           2AN]
          Length = 202

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 104/175 (59%), Gaps = 8/175 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L D I        R    ++ E+++ V   D       LRD   C F  +IDLCGVD+
Sbjct: 9   EKLKDAIAAVLGAKARQITVALEEVTVVVAAADYRDAMQLLRDSEACRFEQLIDLCGVDY 68

Query: 66  LSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVW 117
            S ++      R+ VV H LS   N+R+RVK+   +     V S+  ++  A+W+ERE +
Sbjct: 69  SSYADKVHEGARYGVVSHLLSVSLNQRVRVKVFCPDDDFPVVASVSDLWNSANWYEREAF 128

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI F+GH DLRRILTDYGF GHP RKDFP++G VE+ YD + ++VVY PV +
Sbjct: 129 DLFGIVFDGHNDLRRILTDYGFIGHPFRKDFPLSGHVEMRYDTERRRVVYEPVSI 183


>gi|260223140|emb|CBA33406.1| NADH-quinone oxidoreductase subunit C [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 197

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 97/155 (62%), Gaps = 8/155 (5%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------RFDVVYHFL 79
           ++GE+++ V      +    LR  P C F  +IDLCGVD+           R+ VV H L
Sbjct: 24  ALGEVTVLVSAQHYHAAAEILRTAPGCQFEQLIDLCGVDYSEYKEGAYDGPRYAVVSHLL 83

Query: 80  SPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
           S   N+RLR+K+   +     V S+  I+  A+WFERE +D++GI FEGH DLRRILTDY
Sbjct: 84  SISLNQRLRLKVMAPDDDMPLVASVNDIWNSANWFEREAFDLFGIIFEGHDDLRRILTDY 143

Query: 138 GFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           GF GHP RKDFP+TG VE+ YD +  +VVY+PV +
Sbjct: 144 GFIGHPFRKDFPMTGHVEMRYDAEQARVVYQPVTI 178


>gi|226939458|ref|YP_002794531.1| NADH-quinone oxidoreductase [Laribacter hongkongensis HLHK9]
 gi|254767811|sp|C1DCA5|NUOC_LARHH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|226714384|gb|ACO73522.1| NADH-quinone oxidoreductase [Laribacter hongkongensis HLHK9]
          Length = 195

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 103/180 (57%), Gaps = 10/180 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M   ++ L   + +     +  A    GEL++      +   C  LRD     F   IDL
Sbjct: 1   MASSLDALKARVESLLGDHLESATIDRGELTIVCSASSIAVSCQLLRD--QAGFDQCIDL 58

Query: 61  CGVDF------LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
           CG+D+      L    RF VV H +S + N+RLRV+    +     VPS++ ++   +W+
Sbjct: 59  CGMDYSTYRDGLHDRPRFAVVLHLMSVQNNQRLRVRFFAPDDDFPVVPSLIDVWASVNWY 118

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +DMYGI FEGHPDLRRILTDYGF GHP RKDFPV+G VE+ YD    +V+Y+PV +
Sbjct: 119 EREAFDMYGIVFEGHPDLRRILTDYGFVGHPFRKDFPVSGHVEMRYDPTEGRVIYQPVTI 178


>gi|60117113|ref|YP_209576.1| NADH dehydrogenase subunit 9 [Polysphondylium pallidum]
 gi|51339677|gb|AAU00591.1| NADH dehydrogenase subunit 9 [Polysphondylium pallidum]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 112/182 (61%), Gaps = 4/182 (2%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           +G  ++    G ++  + +   +S+ V+  +L ++ S L+ +       ++D+  VD L+
Sbjct: 12  IGTMLLKLVPGLIQKIIYNPENISVIVNSKNLNNILSILKLNTIMQCKMLLDIVCVDCLN 71

Query: 68  ----RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIF 123
               +  RF ++Y   S   N R+ V + +   +++ S   ++  A W ERE+WDMYG++
Sbjct: 72  IEENKLGRFKLIYVLNSVFNNNRIHVIVYLKNNETIESCSSLFSSAVWLEREIWDMYGVY 131

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
           F  HPDLRRILTDYGF  +PL+KDFP+TG++E++YD   KK++Y+P+ELMQE R Y++  
Sbjct: 132 FANHPDLRRILTDYGFSWYPLKKDFPLTGYIEVYYDINDKKIIYKPIELMQEFRMYEYGI 191

Query: 184 PW 185
            W
Sbjct: 192 SW 193


>gi|160872520|ref|ZP_02062652.1| NADH-quinone oxidoreductase, c subunit [Rickettsiella grylli]
 gi|159121319|gb|EDP46657.1| NADH-quinone oxidoreductase, c subunit [Rickettsiella grylli]
          Length = 230

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (56%), Gaps = 34/194 (17%)

Query: 16  FSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS-------- 67
           F+  ++    +  E++L++    L  +   LRD+    F  ++D+C VD+          
Sbjct: 15  FNSVIQEIAVARNEINLEISAEKLKEVGLALRDEADFKFELLVDVCVVDYAEYGVSEWTT 74

Query: 68  -----------------------RSNRFDVVYHFLSPKYNRRLRVKI-AVAEGKSVPSIV 103
                                     RF VVYH LS  +N+RLR++I A  E   VPS++
Sbjct: 75  EQSTLTGFERGVDKTGDLHPINWNKPRFAVVYHLLSLTHNQRLRLRIFAQGEPPQVPSVI 134

Query: 104 GIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVK 163
            ++P A+W+ERE +D++G+FF+GHPDLRR+LTDYGF GHP RKDFP+TG VE+ YD    
Sbjct: 135 KLWPAANWYEREAFDLFGVFFDGHPDLRRLLTDYGFVGHPFRKDFPLTGHVEVRYDATKG 194

Query: 164 KVVYRPVELMQEHR 177
           +VVY+PV +  +HR
Sbjct: 195 RVVYQPVTI--KHR 206


>gi|254468244|ref|ZP_05081650.1| NADH dehydrogenase i chain c [beta proteobacterium KB13]
 gi|207087054|gb|EDZ64337.1| NADH dehydrogenase i chain c [beta proteobacterium KB13]
          Length = 195

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 105/178 (58%), Gaps = 11/178 (6%)

Query: 5   IEDLGDYIVNSFSGSVRFAVN-SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           + DL   I N  S   +  VN    E +L +   +++     L+      F+ +ID+  V
Sbjct: 1   MSDLNKLISNLKSTFPQAVVNKQFDEATLSIYGNEIIKTLKKLKTGSQFKFLQLIDIAAV 60

Query: 64  DF------LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSI---VGIYPGADWFER 114
           D+      L  +NR+ VVYH LS K N+RLRV+ A  E  + P I     +Y  ADW+ER
Sbjct: 61  DYSQYPQKLFDNNRYAVVYHLLSIKNNQRLRVR-AFVEDNNFPVIETATTVYANADWYER 119

Query: 115 EVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           E +D++G+ F  HPDLRRILTDYGF GHP RKDFP+ G VE+ YD + K+V+Y+PV +
Sbjct: 120 EAFDLFGVMFLNHPDLRRILTDYGFIGHPFRKDFPMIGNVEMRYDPEQKRVIYQPVTI 177


>gi|300122807|emb|CBK23822.2| unnamed protein product [Blastocystis hominis]
          Length = 196

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 106/168 (63%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I+N     ++ ++ S  EL+  ++    +++ +FL+   +  F  + D+C VD+  +  R
Sbjct: 20  ILNMLPNYIQASIYSNRELTFIIEKQYNLTVLNFLKKYTNGQFKTMSDMCAVDYPYKKYR 79

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F+++Y  LS  +N R+++K  + E   + SI  +Y GA+W+ERE++D +GI+F+ + DLR
Sbjct: 80  FEIIYTLLSLVFNSRVKIKTYLNELDDIESITSLYSGANWWEREIYDFFGIYFKNNKDLR 139

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           RILTDYGF+GHPLRKDFP+ G+ EL YDD  K +    +E   + + Y
Sbjct: 140 RILTDYGFKGHPLRKDFPLLGYYELVYDDSEKCIKRTAIEYSPKFKSY 187


>gi|171187537|gb|ACB41372.1| NADH dehydrogenase subunit C [Mimulus guttatus]
          Length = 153

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +      ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 25  QLLCFLKLHTYTRVQVSIDICGVDYPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 84

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            +V  +P A  +EREVWDM+G+    HPDLRRI TDYGFEGHPLRKD P++G+VE+ YDD
Sbjct: 85  PVVSPFPSAGRWEREVWDMFGVSSINHPDLRRISTDYGFEGHPLRKDLPLSGYVEVRYDD 144

Query: 161 KVKKVVYRP 169
             K+VV  P
Sbjct: 145 PEKRVVSEP 153


>gi|220934164|ref|YP_002513063.1| NADH (or F420H2) dehydrogenase, subunit C [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254767814|sp|B8GNY7|NUOC_THISH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|219995474|gb|ACL72076.1| NADH (or F420H2) dehydrogenase, subunit C [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 239

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 108/213 (50%), Gaps = 43/213 (20%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  ++E L   +   F  +     ++ GEL+L V    +      LRDD    F  +IDL
Sbjct: 1   MSERLEKLAARLTERFKAAGGKVDSAYGELTLTVPAAAMTDTAKALRDD--LGFEMLIDL 58

Query: 61  CGVDFLS----------RSN-----------------------------RFDVVYHFLSP 81
           CGVD+             SN                             RF VVYH LS 
Sbjct: 59  CGVDYQEYGVAEWSTEESSNQGFSRGVEKATFGRFIFDEVAERKAHEGPRFAVVYHLLSI 118

Query: 82  KYNRRLRVKIAVA--EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
             N+RLR+K+     E   V ++  ++  ADW+ERE +D++GI FEGHPDLRRILTDYGF
Sbjct: 119 SANQRLRMKVFCEDEEFPVVSTVTDVWTSADWYEREAFDLFGIMFEGHPDLRRILTDYGF 178

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            GHP RKDFP+ G VE+ YD +  +VVY+PV +
Sbjct: 179 VGHPFRKDFPLVGHVEMRYDPEQARVVYQPVSI 211


>gi|297538954|ref|YP_003674723.1| NADH (or F420H2) dehydrogenase subunit C [Methylotenera sp. 301]
 gi|297258301|gb|ADI30146.1| NADH (or F420H2) dehydrogenase, subunit C [Methylotenera sp. 301]
          Length = 198

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 110/180 (61%), Gaps = 8/180 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K++ L   +  S    +   V ++ E++++    + +++C  LRD     F  +IDL
Sbjct: 1   MSAKLDQLLSDLQASLGDKITKHVVALDEITIECKAENYLAVCQILRDATTLKFEQLIDL 60

Query: 61  CGVDFLSRSN------RFDVVYHFLSPKYNRRLRVKIAVAEG--KSVPSIVGIYPGADWF 112
            GVD+ +  +      R+ VV H LS   N R+R+++   +     +P++V I+  A+W+
Sbjct: 61  SGVDYQTYGDGAYDGVRYAVVCHLLSVSLNHRVRLRVFAQDEDFPILPTLVDIWSVANWY 120

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           ERE +DM+GI FE HPDLRR+LTDYGF GHP RKDFP+ G VE+ YD + ++V+Y+PV +
Sbjct: 121 EREAFDMFGIMFENHPDLRRLLTDYGFVGHPFRKDFPMIGNVEMRYDPEQQRVIYQPVTI 180


>gi|11466220|ref|NP_066543.1| NADH dehydrogenase subunit 9 [Naegleria gruberi]
 gi|10444255|gb|AAG17821.1|AF288092_46 NADH dehydrogenase subunit 9 [Naegleria gruberi]
          Length = 186

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 92/146 (63%)

Query: 40  VSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSV 99
           + +  FL  D +C F ++ID   VD+     RF+++YH +S  Y+ R+ +K  + E +S+
Sbjct: 38  IMISYFLYKDMNCQFKSLIDFTCVDYSLNKKRFNLIYHIISIYYHFRVFLKFFIEELESM 97

Query: 100 PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYD 159
            S+  IYP   W+EREVWD +G+FF  + +LRRIL DYGF GHPLRKDFP+TGFVEL Y 
Sbjct: 98  YSLCYIYPNISWYEREVWDFFGVFFLNNVNLRRILLDYGFVGHPLRKDFPLTGFVELVYS 157

Query: 160 DKVKKVVYRPVELMQEHRDYDFLSPW 185
                VV + V L Q  R Y+  + W
Sbjct: 158 IFYFSVVQKKVNLSQSFRKYETKTVW 183


>gi|288942132|ref|YP_003444372.1| NADH (or F420H2) dehydrogenase subunit C [Allochromatium vinosum
           DSM 180]
 gi|288897504|gb|ADC63340.1| NADH (or F420H2) dehydrogenase, subunit C [Allochromatium vinosum
           DSM 180]
          Length = 235

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 110/199 (55%), Gaps = 30/199 (15%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           +++ L   I   F+ S    +++  EL+L V    L+ +   LRD     F  +IDLCGV
Sbjct: 11  RVDALVAAIRAHFAESDFELIDAFDELTLVVPAERLLDVARTLRDHDDFRFEQLIDLCGV 70

Query: 64  DFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVKIAV- 93
           D+ +                                RF VV H LS  +N RLR+++ V 
Sbjct: 71  DYAAYGCSEWETDEASTTGFGRGVDRDLRIEADDPKRFGVVVHLLSLAHNHRLRLRVHVG 130

Query: 94  AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           A    V S++ ++  A+WFERE +D+YGI F GHPDLRRILTDYGF GHP RKDFP++G 
Sbjct: 131 AAAPIVDSLIPVWDSANWFEREAFDLYGILFRGHPDLRRILTDYGFVGHPFRKDFPLSGQ 190

Query: 154 VELHYDDKVKKVVYRPVEL 172
           VE+ YD ++K+VVY PV +
Sbjct: 191 VEMRYDPELKRVVYEPVSI 209


>gi|200004066|ref|YP_002221400.1| NADH dehydrogenase subunit 9 [Blastocystis sp. NandII]
 gi|187438964|gb|ACD10935.1| NADH dyhydrogenase subunit 9 [Blastocystis sp. NandII]
 gi|198385488|gb|ACH86081.1| NADH dehydrogenase subunit 9 [Blastocystis sp. NandII]
          Length = 196

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 105/168 (62%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I+N     ++ ++ S  EL+  ++      + +FL+   +  +  + D+C +D+  ++ R
Sbjct: 20  IMNMLPNYIQASIYSNRELTFIINKNYNKLVLNFLKKYTNGQYKTMSDMCAIDYPYKTYR 79

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F+V+Y  LS  +N R+++K  + E  S+ SI  I+ GA+W+ERE++D +GI+F  + DLR
Sbjct: 80  FEVIYTLLSLVFNSRVKIKTYLTELDSIESITSIFSGANWWEREIYDFFGIYFNNNKDLR 139

Query: 132 RILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDY 179
           RILTDYGF+GHPLRKDFP+ G+ EL YDD  K +    +E   + + Y
Sbjct: 140 RILTDYGFKGHPLRKDFPLCGYYELIYDDVNKVIKKTNIEFSPKFKSY 187


>gi|21231958|ref|NP_637875.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767915|ref|YP_242677.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991031|ref|YP_001903041.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv. campestris
           str. B100]
 gi|81306108|sp|Q4UWB6|NUOC_XANC8 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|81860265|sp|Q8P7T4|NUOC_XANCP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534327|sp|B0RRA0|NUOC_XANCB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|21113689|gb|AAM41799.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66573247|gb|AAY48657.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167732791|emb|CAP50985.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas campestris
           pv. campestris]
          Length = 250

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 112/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+    V   GE++L+V      + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQISVVQPRGEVTLEVAAAQWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SR------------------------------SNRFD 73
           CGVD+L                 SR                              + RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKALGRFAWGEFPSQESSNGAQPQQLPTQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPV 217


>gi|157166916|gb|ABV25438.1| NADH dehydrogenase subunit 9 [Silene latifolia]
          Length = 131

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708934|gb|ACU30372.1| NADH dehydrogenase subunit 9 [Heliosperma pusillum]
          Length = 131

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+ F  HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSFINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|56791590|gb|AAW30333.1| NADH dehydrogenase subunit 9 [Laurus nobilis]
          Length = 163

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 88/138 (63%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 26  DTNTDYPFQLLCFLKFHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTS 85

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A W+EREVWDM G+    HPDLRRI TD+GFEGHPLRKD P++G
Sbjct: 86  ADEVTRISPVVSPFPSAGWWEREVWDMSGVSSINHPDLRRISTDHGFEGHPLRKDLPLSG 145

Query: 153 FVELHYDDKVKKVVYRPV 170
           +VE+ YDD  K+V   PV
Sbjct: 146 YVEVRYDDPEKRVFLNPV 163


>gi|200004038|ref|YP_002221373.1| NADH dehydrogenase subunit 9 [Blastocystis sp. DMP/02-328]
 gi|198385462|gb|ACH86056.1| NADH dehydrogenase subunit 9 [Blastocystis sp. DMP/02-328]
          Length = 196

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 103/170 (60%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +R   +    I+N     ++ ++ +  EL+  ++      + +FL+   +  +  + D+C
Sbjct: 10  IRLYINFSKSILNMLPNYIQASIYTNRELTFIINKNYNTLVINFLKKYTNSQYQTMADMC 69

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            +D+  +  RF++VY  LS  YN R+++K  + E  S+ +I  ++ GA+W+ERE++D +G
Sbjct: 70  AIDYPMKQFRFEIVYTLLSLVYNSRIKIKTYLKELDSIETITTLFKGANWWEREIYDFFG 129

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVE 171
           I+F  + DLRRILTDYGF GHPL KDFP+ GF E+ YDD  K +   P+E
Sbjct: 130 IYFTHNTDLRRILTDYGFIGHPLSKDFPLMGFYEVTYDDITKCIKKTPIE 179


>gi|157166936|gb|ABV25448.1| NADH dehydrogenase subunit 9 [Lychnis coronaria]
          Length = 131

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKQRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|114777363|ref|ZP_01452360.1| NADH dehydrogenase I, C subunit [Mariprofundus ferrooxydans PV-1]
 gi|114552145|gb|EAU54647.1| NADH dehydrogenase I, C subunit [Mariprofundus ferrooxydans PV-1]
          Length = 210

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 103/166 (62%), Gaps = 13/166 (7%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD------FLSRSNRFDVVYHFLSPKY 83
           ++L  +C  +   C +L+ +    F  ++D+CGVD      + + + RF VVY  LS   
Sbjct: 50  VTLAREC--IAEACHYLKGEHS--FEQVMDICGVDRSDYRGWPADAPRFQVVYQLLSVSR 105

Query: 84  NRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHP 143
           N R+R+K+   E   V S+  ++P A+WFERE +DMYGI F  HPDLRR+LTDYGFEG+P
Sbjct: 106 NCRIRLKVGANERDLVDSVTEVWPTANWFEREAFDMYGIIFNHHPDLRRLLTDYGFEGYP 165

Query: 144 LRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVN 189
           LRKDFPVTG VE+ +D+   + VYRP +L  E R       W GV+
Sbjct: 166 LRKDFPVTGRVEMFFDEAQWRCVYRPNKL--EARQL-IQKSWPGVD 208


>gi|21243430|ref|NP_643012.1| NADH dehydrogenase subunit C [Xanthomonas axonopodis pv. citri str.
           306]
 gi|81860559|sp|Q8PJ42|NUOC_XANAC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|21108983|gb|AAM37548.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 250

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPV 217


>gi|148244391|ref|YP_001219085.1| NADH dehydrogenase I chain C [Candidatus Vesicomyosocius okutanii
           HA]
 gi|218534339|sp|A5CXF9|NUOC_VESOH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|146326218|dbj|BAF61361.1| NADH dehydrogenase I chain C [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 204

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/196 (40%), Positives = 107/196 (54%), Gaps = 32/196 (16%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++DL   +V  F  +    V S  EL+L V   +++  C  LRD     F  +IDLCGVD
Sbjct: 1   MQDLKTSLVEVFGKTN--LVESFDELTLTVGSQNIIKTCLKLRD--FFSFDTLIDLCGVD 56

Query: 65  FLS---------------------------RSNRFDVVYHFLSPKYNRRLRVKIAVAEGK 97
           +L+                              RF VVYH LS   N+R+RVK  V E +
Sbjct: 57  YLTYGQSDWNGNASASGFSRGRSHQGLKDIHEERFAVVYHLLSVSKNKRIRVKSFVDEVE 116

Query: 98  SV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +  S+  I+  ADW+ERE +D+ GI FE H DLRRILTDYGF GHPLRKDFP+ G VE+
Sbjct: 117 PIIKSVTDIWASADWYEREAFDLMGILFENHTDLRRILTDYGFTGHPLRKDFPMIGEVEM 176

Query: 157 HYDDKVKKVVYRPVEL 172
            YD+ + +V+Y  V +
Sbjct: 177 RYDEDLCRVIYEKVSI 192


>gi|289667378|ref|ZP_06488453.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 250

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 110/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D    C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVTLPRGEVTLEVAAADWHVTCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAIGRFAWGEFPSQESSSGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  K VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDKQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPV 217


>gi|294624676|ref|ZP_06703346.1| NADH dehydrogenase subunit C [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601032|gb|EFF45099.1| NADH dehydrogenase subunit C [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 250

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 112/224 (50%), Gaps = 53/224 (23%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFLSRSN-----------------------------------------------RFD 73
           CGVD+L   +                                               RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKRRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV  ++
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPVTSVE 221


>gi|56791596|gb|AAW30336.1| NADH dehydrogenase subunit 9 [Philodendron hederaceum var.
           oxycardium]
          Length = 160

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 86/132 (65%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +      L  FL+   +      ID+CGVD  SR  RF+VV++ LS +YN R+RV+ +
Sbjct: 29  DTNTDYPFQLLCFLKFHTYTRVQVSIDICGVDHPSRKRRFEVVHNLLSTRYNSRIRVQTS 88

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V  +P A W+EREVWDM G+    HPDLRRI TDYGFEGHPLRKDFP++G
Sbjct: 89  ADEVTRISPVVSPFPSAGWWEREVWDMSGVSSINHPDLRRISTDYGFEGHPLRKDFPLSG 148

Query: 153 FVELHYDDKVKK 164
           +VE+ YDD  K+
Sbjct: 149 YVEVRYDDPEKR 160


>gi|28198173|ref|NP_778487.1| NADH dehydrogenase subunit C [Xylella fastidiosa Temecula1]
 gi|81725066|sp|Q87EQ3|NUOC_XYLFT RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534353|sp|B2I786|NUOC_XYLF2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|28056243|gb|AAO28136.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xylella fastidiosa
           Temecula1]
          Length = 250

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 119/225 (52%), Gaps = 55/225 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAV-NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M  +     D +++ F  +VR +V    GE+SLDV   +  ++C  LRD+    F  + D
Sbjct: 1   MAEQTLSFVDCLMSRFP-TVRVSVAQPRGEISLDVPVVEWCAVCKALRDEFD--FEQLSD 57

Query: 60  LCGVDFLSRSN-----------------------------------------------RF 72
           LCGVD+L   N                                               RF
Sbjct: 58  LCGVDYLGYGNAEWDTTDVSAQGFSRGVAGKAVGRFAWGEFPSAGSNDGTQPWDVPQERF 117

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            V+ H +S ++NRRLRV+   A   ++P   S+  ++PG +WFERE +D++GI FEGHPD
Sbjct: 118 AVLAHLISYRHNRRLRVR-CFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHPD 176

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           LRRILTDYGF GHP RKDFP+TG VE+ YD++ K+VVY PV  ++
Sbjct: 177 LRRILTDYGFIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVE 221


>gi|254491841|ref|ZP_05105020.1| putative NADH dehydrogenase, subunit C subfamily [Methylophaga
           thiooxidans DMS010]
 gi|224463319|gb|EEF79589.1| putative NADH dehydrogenase, subunit C subfamily [Methylophaga
           thiooxydans DMS010]
          Length = 219

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 102/175 (58%), Gaps = 33/175 (18%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF-----------------LSRSN- 70
           E+++ V    +V++C  LRD     F  ++DLCGVD+                  SR+  
Sbjct: 26  EITMHVAAEQIVAVCQRLRD--QYDFEQLLDLCGVDYSEYGGSAWETKQSSEFGFSRAVD 83

Query: 71  ------------RFDVVYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVW 117
                       RF VVYH LS K+N+RLR+K+ + A+   V S+  ++  A+WFERE +
Sbjct: 84  GMGHAEPVQDGLRFAVVYHLLSIKHNQRLRLKVRLEADSPVVDSVTSVWNSAEWFEREAF 143

Query: 118 DMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           D++GI F GH DLRRILTDYGF GHP RKDFP+ G VE+ YD   K+VVY PV +
Sbjct: 144 DLFGILFNGHNDLRRILTDYGFVGHPFRKDFPLIGNVEMRYDPDKKRVVYEPVSI 198


>gi|289665175|ref|ZP_06486756.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 250

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M ++     D +   F+G+        GE++L+V   D    C  LRD+    F  + DL
Sbjct: 1   MAKQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHVTCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAIGRFAWGEFPSQESSSGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPV 217


>gi|255708994|gb|ACU30402.1| NADH dehydrogenase subunit 9 [Silene khasiana]
          Length = 131

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%)

Query: 33  DVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIA 92
           D +    + L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +
Sbjct: 7   DTNTDYPLKLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTS 66

Query: 93  VAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
             E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G
Sbjct: 67  ADEVTRISPVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSG 126

Query: 153 FVEL 156
           +VE+
Sbjct: 127 YVEV 130


>gi|58582857|ref|YP_201873.1| NADH dehydrogenase subunit C [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624722|ref|YP_452094.1| NADH dehydrogenase subunit C [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577694|ref|YP_001914623.1| NADH dehydrogenase subunit C [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|81311785|sp|Q5GXT3|NUOC_XANOR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|123521395|sp|Q2P0V7|NUOC_XANOM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534329|sp|B2SVL7|NUOC_XANOP RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|58427451|gb|AAW76488.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84368662|dbj|BAE69820.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188522146|gb|ACD60091.1| NADH-quinone oxidoreductase chain c [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 250

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSGEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPLVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPV 217


>gi|294666775|ref|ZP_06732009.1| NADH dehydrogenase subunit C [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603436|gb|EFF46853.1| NADH dehydrogenase subunit C [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 250

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   +  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAAEWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YDD+ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDDERKRVVYEPV 217


>gi|157166918|gb|ABV25439.1| NADH dehydrogenase subunit 9 [Silene latifolia]
          Length = 131

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTKFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|307579275|gb|ADN63244.1| NADH dehydrogenase subunit C [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 238

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 112/207 (54%), Gaps = 54/207 (26%)

Query: 19  SVRFAV-NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN------- 70
           +VR +V    GE+SLDV   +  ++C  LRD+    F  + DLCGVD+L   N       
Sbjct: 6   TVRVSVAQPRGEISLDVPVVEWCAVCKALRDE--FDFEQLSDLCGVDYLGYGNAEWDTTD 63

Query: 71  ----------------------------------------RFDVVYHFLSPKYNRRLRVK 90
                                                   RF V+ H +S ++NRRLRV+
Sbjct: 64  VSAQGFSRGVAGKAVGRFAWGEFPSAGSNDGTQPWDVPQERFAVLAHLISYRHNRRLRVR 123

Query: 91  IAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
              A   ++P   S+  ++PG +WFERE +D++GI FEGHPDLRRILTDYGF GHP RKD
Sbjct: 124 -CFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHPDLRRILTDYGFIGHPFRKD 182

Query: 148 FPVTGFVELHYDDKVKKVVYRPVELMQ 174
           FP+TG VE+ YD++ K+VVY PV  ++
Sbjct: 183 FPLTGNVEVRYDEEKKRVVYVPVTSVE 209


>gi|15836910|ref|NP_297598.1| NADH dehydrogenase subunit C [Xylella fastidiosa 9a5c]
 gi|81788889|sp|Q9PGJ3|NUOC_XYLFA RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|9105130|gb|AAF83118.1|AE003884_3 NADH-ubiquinone oxidoreductase, NQO5 subunit [Xylella fastidiosa
           9a5c]
          Length = 250

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 118/225 (52%), Gaps = 55/225 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAV-NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M  +     D + + F  +VR +V    GE++LDV   +  ++C  LRD+    F  + D
Sbjct: 1   MAEQTLSFVDCLTSRFP-TVRVSVAQPRGEITLDVPAVEWCAVCRALRDEFD--FEQLSD 57

Query: 60  LCGVDFLSRSN-----------------------------------------------RF 72
           LCGVD+L   N                                               RF
Sbjct: 58  LCGVDYLGYGNTEWDTTDVSAQGFSRGVAGKAVGRFAWGEFPSAGSNDGTQPWDVPQERF 117

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            V+ H +S ++NRRLRV+   A   ++P   S+  ++PG +WFERE +D++GI FEGHPD
Sbjct: 118 AVLAHLISYRHNRRLRVR-CFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHPD 176

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           LRRILTDYGF GHP RKDFP+TG VE+ YD++ K+VVY PV  ++
Sbjct: 177 LRRILTDYGFIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVE 221


>gi|255708946|gb|ACU30378.1| NADH dehydrogenase subunit 9 [Silene antirrhina]
          Length = 131

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (69%)

Query: 32  LDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI 91
            D +    + L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ 
Sbjct: 6   FDTNTDYPLQLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQT 65

Query: 92  AVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +  E   +  +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++
Sbjct: 66  SADEVTRISPVVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLS 125

Query: 152 GFVEL 156
           G+VE+
Sbjct: 126 GYVEV 130


>gi|182680807|ref|YP_001828967.1| NADH dehydrogenase subunit C [Xylella fastidiosa M23]
 gi|182630917|gb|ACB91693.1| NADH (or F420H2) dehydrogenase, subunit C [Xylella fastidiosa M23]
          Length = 228

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 107/197 (54%), Gaps = 53/197 (26%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN----------------- 70
           GE+SLDV   +  ++C  LRD+    F  + DLCGVD+L   N                 
Sbjct: 6   GEISLDVPVVEWCAVCKALRDE--FDFEQLSDLCGVDYLGYGNAEWDTTDVSAQGFSRGV 63

Query: 71  ------------------------------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
                                         RF V+ H +S ++NRRLRV+   A   ++P
Sbjct: 64  AGKAVGRFAWGEFPSAGSNDGTQPWDVPQERFAVLAHLISYRHNRRLRVR-CFASNDALP 122

Query: 101 ---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELH 157
              S+  ++PG +WFERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP+TG VE+ 
Sbjct: 123 IVASLTDVWPGVNWFEREAFDLFGIVFEGHPDLRRILTDYGFIGHPFRKDFPLTGNVEVR 182

Query: 158 YDDKVKKVVYRPVELMQ 174
           YD++ K+VVY PV  ++
Sbjct: 183 YDEEKKRVVYVPVTSVE 199


>gi|133854266|gb|ABO39168.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854270|gb|ABO39170.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854280|gb|ABO39175.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854284|gb|ABO39177.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854294|gb|ABO39182.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854300|gb|ABO39185.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854306|gb|ABO39188.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166850|gb|ABV25405.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166858|gb|ABV25409.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166874|gb|ABV25417.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166878|gb|ABV25419.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166880|gb|ABV25420.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166882|gb|ABV25421.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166884|gb|ABV25422.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166886|gb|ABV25423.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166888|gb|ABV25424.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166890|gb|ABV25425.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166892|gb|ABV25426.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166894|gb|ABV25427.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166896|gb|ABV25428.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166898|gb|ABV25429.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166900|gb|ABV25430.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166902|gb|ABV25431.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166904|gb|ABV25432.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166906|gb|ABV25433.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166908|gb|ABV25434.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166910|gb|ABV25435.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166912|gb|ABV25436.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166914|gb|ABV25437.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166920|gb|ABV25440.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166922|gb|ABV25441.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166924|gb|ABV25442.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166926|gb|ABV25443.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|157166928|gb|ABV25444.1| NADH dehydrogenase subunit 9 [Silene latifolia]
 gi|255708930|gb|ACU30370.1| NADH dehydrogenase subunit 9 [Atocion lerchenfeldianum]
 gi|255708932|gb|ACU30371.1| NADH dehydrogenase subunit 9 [Eudianthe laeta]
 gi|255708942|gb|ACU30376.1| NADH dehydrogenase subunit 9 [Silene akinfievii]
 gi|255708966|gb|ACU30388.1| NADH dehydrogenase subunit 9 [Silene cordifolia]
 gi|255708970|gb|ACU30390.1| NADH dehydrogenase subunit 9 [Silene delicatula]
 gi|255708986|gb|ACU30398.1| NADH dehydrogenase subunit 9 [Silene hookeri]
 gi|255709000|gb|ACU30405.1| NADH dehydrogenase subunit 9 [Silene littorea]
 gi|255709004|gb|ACU30407.1| NADH dehydrogenase subunit 9 [Silene menziesii]
 gi|255709026|gb|ACU30418.1| NADH dehydrogenase subunit 9 [Silene pendula]
 gi|255709044|gb|ACU30427.1| NADH dehydrogenase subunit 9 [Silene sordida]
 gi|255709060|gb|ACU30435.1| NADH dehydrogenase subunit 9 [Silene zawadskii]
 gi|255709062|gb|ACU30436.1| NADH dehydrogenase subunit 9 [Viscaria alpina]
 gi|255709064|gb|ACU30437.1| NADH dehydrogenase subunit 9 [Viscaria vulgaris]
          Length = 131

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708952|gb|ACU30381.1| NADH dehydrogenase subunit 9 [Silene auriculata]
          Length = 131

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255709048|gb|ACU30429.1| NADH dehydrogenase subunit 9 [Silene succulenta]
          Length = 131

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR+ RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRNLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|325915541|ref|ZP_08177852.1| NADH dehydrogenase subunit C [Xanthomonas vesicatoria ATCC 35937]
 gi|325538257|gb|EGD09942.1| NADH dehydrogenase subunit C [Xanthomonas vesicatoria ATCC 35937]
          Length = 250

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 113/224 (50%), Gaps = 53/224 (23%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFGWGEFPSQESSTGAHPQHMPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV  ++
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPVTSVE 221


>gi|78048407|ref|YP_364582.1| NADH dehydrogenase subunit C [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|123584673|sp|Q3BRN1|NUOC_XANC5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|78036837|emb|CAJ24530.1| NADH-ubiquinone oxidoreductase NQO5 subunit [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 250

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPV 217


>gi|325924677|ref|ZP_08186115.1| NADH dehydrogenase subunit C [Xanthomonas perforans 91-118]
 gi|325544883|gb|EGD16228.1| NADH dehydrogenase subunit C [Xanthomonas perforans 91-118]
          Length = 250

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD+L                 SR                                RF 
Sbjct: 59  CGVDYLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSSGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPV 217


>gi|78485164|ref|YP_391089.1| NADH (or F420H2) dehydrogenase, subunit C [Thiomicrospira crunogena
           XCL-2]
 gi|123555686|sp|Q31HF8|NUOC_THICR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|78363450|gb|ABB41415.1| NADH dehydrogenase chain C [Thiomicrospira crunogena XCL-2]
          Length = 223

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 107/202 (52%), Gaps = 45/202 (22%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E LGD IV          V+ +    L V+     SL +  +      F  +ID+CGVD+
Sbjct: 14  ETLGDAIV----------VSDIKLDELTVELAPEQSLSALTKLKEKLGFDQLIDVCGVDY 63

Query: 66  LSRSN---------------------------------RFDVVYHFLSPKYNRRLRVKIA 92
           L+  +                                 RF VVYH LS + NRR+RVK+ 
Sbjct: 64  LAFGDVTWETRKATNSGFSRGVFDFAEEDGEADTNIPRRFAVVYHLLSVENNRRVRVKVY 123

Query: 93  VAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPV 150
             + +   V S+V ++  ADWFERE +D++GI F GHPDLRRILTDYGF GHPLRKDFP+
Sbjct: 124 PEDTQMPMVDSVVSVWNCADWFEREAFDLFGILFNGHPDLRRILTDYGFVGHPLRKDFPL 183

Query: 151 TGFVELHYDDKVKKVVYRPVEL 172
           TG VE+ YD +  +VVY PV +
Sbjct: 184 TGHVEMRYDAEKGRVVYEPVTI 205


>gi|255708940|gb|ACU30375.1| NADH dehydrogenase subunit 9 [Silene acutifolia]
 gi|255708972|gb|ACU30391.1| NADH dehydrogenase subunit 9 [Silene dichotoma]
 gi|255708990|gb|ACU30400.1| NADH dehydrogenase subunit 9 [Silene integripetala]
 gi|255709012|gb|ACU30411.1| NADH dehydrogenase subunit 9 [Silene nana]
 gi|255709018|gb|ACU30414.1| NADH dehydrogenase subunit 9 [Silene odontopetala]
 gi|255709028|gb|ACU30419.1| NADH dehydrogenase subunit 9 [Silene pygmaea]
 gi|255709030|gb|ACU30420.1| NADH dehydrogenase subunit 9 [Silene repens]
          Length = 131

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 16  LLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|133854345|gb|ABO39195.1| NADH dehydrogenase subunit 9 [Silene paradoxa]
 gi|157166934|gb|ABV25447.1| NADH dehydrogenase subunit 9 [Silene stellata]
 gi|255708938|gb|ACU30374.1| NADH dehydrogenase subunit 9 [Silene acaulis]
 gi|255708948|gb|ACU30379.1| NADH dehydrogenase subunit 9 [Silene argentina]
 gi|255708968|gb|ACU30389.1| NADH dehydrogenase subunit 9 [Silene davidii]
 gi|255708974|gb|ACU30392.1| NADH dehydrogenase subunit 9 [Silene douglasii]
 gi|255708978|gb|ACU30394.1| NADH dehydrogenase subunit 9 [Silene fruticosa]
 gi|255708982|gb|ACU30396.1| NADH dehydrogenase subunit 9 [Silene gallinyi]
 gi|255708992|gb|ACU30401.1| NADH dehydrogenase subunit 9 [Silene involucrata]
 gi|255708998|gb|ACU30404.1| NADH dehydrogenase subunit 9 [Silene laciniata]
 gi|255709006|gb|ACU30408.1| NADH dehydrogenase subunit 9 [Silene moorcroftiana]
 gi|255709022|gb|ACU30416.1| NADH dehydrogenase subunit 9 [Silene paradoxa]
 gi|255709032|gb|ACU30421.1| NADH dehydrogenase subunit 9 [Silene sachalinensis]
 gi|255709036|gb|ACU30423.1| NADH dehydrogenase subunit 9 [Silene samojedorum]
 gi|255709046|gb|ACU30428.1| NADH dehydrogenase subunit 9 [Silene sorensenis]
 gi|255709050|gb|ACU30430.1| NADH dehydrogenase subunit 9 [Silene tunicoides]
 gi|255709056|gb|ACU30433.1| NADH dehydrogenase subunit 9 [Silene vittata]
          Length = 131

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708954|gb|ACU30382.1| NADH dehydrogenase subunit 9 [Silene bellidifolia]
 gi|255708980|gb|ACU30395.1| NADH dehydrogenase subunit 9 [Silene gallica]
 gi|255708988|gb|ACU30399.1| NADH dehydrogenase subunit 9 [Silene imbricata]
          Length = 131

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR+ RF+VVY+ LS +YN R+RV+    E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRNLRFEVVYNLLSTRYNSRIRVQTGADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708936|gb|ACU30373.1| NADH dehydrogenase subunit 9 [Petrocoptis pyrenaica]
          Length = 131

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255709042|gb|ACU30426.1| NADH dehydrogenase subunit 9 [Silene seoulensis]
          Length = 131

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 16  LLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|166712612|ref|ZP_02243819.1| NADH dehydrogenase subunit C [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 250

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 111/220 (50%), Gaps = 53/220 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVASADWHATCLALRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CG+D+L                 SR                                RF 
Sbjct: 59  CGIDYLGYGSGEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSAGAQPQQLPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASVTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEERKRVVYEPV 217


>gi|157166876|gb|ABV25418.1| NADH dehydrogenase subunit 9 [Silene latifolia]
          Length = 131

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFPVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|133854260|gb|ABO39165.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854262|gb|ABO39166.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854264|gb|ABO39167.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854268|gb|ABO39169.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854272|gb|ABO39171.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854274|gb|ABO39172.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854276|gb|ABO39173.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854278|gb|ABO39174.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854282|gb|ABO39176.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854286|gb|ABO39178.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854288|gb|ABO39179.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854290|gb|ABO39180.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854292|gb|ABO39181.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854296|gb|ABO39183.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854298|gb|ABO39184.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854302|gb|ABO39186.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854304|gb|ABO39187.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|133854308|gb|ABO39189.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166844|gb|ABV25402.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166846|gb|ABV25403.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166848|gb|ABV25404.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166852|gb|ABV25406.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166854|gb|ABV25407.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166856|gb|ABV25408.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166860|gb|ABV25410.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166862|gb|ABV25411.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166864|gb|ABV25412.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166866|gb|ABV25413.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166868|gb|ABV25414.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166870|gb|ABV25415.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|157166872|gb|ABV25416.1| NADH dehydrogenase subunit 9 [Silene vulgaris]
 gi|255708956|gb|ACU30383.1| NADH dehydrogenase subunit 9 [Silene caesia]
 gi|255709054|gb|ACU30432.1| NADH dehydrogenase subunit 9 [Silene uniflora]
          Length = 131

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  ++D+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLVDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708950|gb|ACU30380.1| NADH dehydrogenase subunit 9 [Silene armena]
 gi|255708958|gb|ACU30384.1| NADH dehydrogenase subunit 9 [Silene caryophylloides]
          Length = 131

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 16  LLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|88812974|ref|ZP_01128217.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrococcus mobilis
           Nb-231]
 gi|88789752|gb|EAR20876.1| NADH (or F420H2) dehydrogenase, subunit C [Nitrococcus mobilis
           Nb-231]
          Length = 240

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 111/213 (52%), Gaps = 46/213 (21%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +E L  +I  +  G V  +    GEL+L V   +L+ +   LRD+    F  +ID+ GVD
Sbjct: 1   MEQLAGHIEQALDGRVSESQIHCGELTLVVKPAELMPVMRVLRDNEAFRFDQLIDITGVD 60

Query: 65  FLS---------------------------------------RSN---RFDVVYHFLSPK 82
           + +                                       +SN   RF  VYH LS  
Sbjct: 61  YAAYGQDEWITEQASATGFSRGVDGFTTGRLGLTGIYGVHEIKSNTGRRFAAVYHLLSVA 120

Query: 83  YNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
            N+R+RV+ A  E  + P   SI  I+  ADWFERE +D++GI F+GHPDLRRILTDYGF
Sbjct: 121 LNQRVRVR-AFCEDDNFPMLDSITSIWSCADWFEREAFDLFGIIFDGHPDLRRILTDYGF 179

Query: 140 EGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
            GHP RKDFP+ G VE+ YD+  ++VVY PV +
Sbjct: 180 VGHPFRKDFPLIGNVEVRYDEDRQRVVYEPVSI 212


>gi|312093106|ref|XP_003147569.1| NADH-ubiquinone oxidoreductase 30 kDa subunit [Loa loa]
 gi|307757266|gb|EFO16500.1| NADH-ubiquinone oxidoreductase 30 kDa subunit [Loa loa]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 93/150 (62%), Gaps = 5/150 (3%)

Query: 4   KIEDLGDYIVN---SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           K+   G Y       F   V+FA     EL L +    ++ + +FL+ +    F NI+ +
Sbjct: 52  KLAKFGRYCAECLPKFVQRVQFAAGD--ELELLIHPTGVLPVIAFLKGNHAAQFTNIVFI 109

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
            G+D  SR  RF+V+Y  LS ++N R+RV+    E   + SI  I+ GA+W+EREV+DMY
Sbjct: 110 TGMDVPSRKFRFEVIYALLSIRFNARIRVRTYTDEIAPLESITSIFKGANWYEREVYDMY 169

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPV 150
           G++F  HPDLRRILTDYGFEGHP RKDFP+
Sbjct: 170 GVWFNNHPDLRRILTDYGFEGHPFRKDFPL 199


>gi|157166930|gb|ABV25445.1| NADH dehydrogenase subunit 9 [Silene acaulis]
 gi|255708984|gb|ACU30397.1| NADH dehydrogenase subunit 9 [Silene gracilicaulis]
 gi|255709008|gb|ACU30409.1| NADH dehydrogenase subunit 9 [Silene multicaulis]
 gi|255709016|gb|ACU30413.1| NADH dehydrogenase subunit 9 [Silene nutans]
 gi|255709020|gb|ACU30415.1| NADH dehydrogenase subunit 9 [Silene otites]
 gi|255709024|gb|ACU30417.1| NADH dehydrogenase subunit 9 [Silene paucifolia]
 gi|255709040|gb|ACU30425.1| NADH dehydrogenase subunit 9 [Silene schwarzenbergii]
          Length = 131

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708996|gb|ACU30403.1| NADH dehydrogenase subunit 9 [Silene lacera]
          Length = 131

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 85/115 (73%), Gaps = 1/115 (0%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           LC FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 17  LC-FLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255709034|gb|ACU30422.1| NADH dehydrogenase subunit 9 [Silene samia]
          Length = 131

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 85/115 (73%), Gaps = 1/115 (0%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           LC FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 17  LC-FLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708928|gb|ACU30369.1| NADH dehydrogenase subunit 9 [Agrostemma githago]
          Length = 131

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (71%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+    E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTCADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708960|gb|ACU30385.1| NADH dehydrogenase subunit 9 [Silene ciliata]
          Length = 131

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (71%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
             V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PAVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|71897768|ref|ZP_00679994.1| NADH (or F420H2) dehydrogenase, subunit C [Xylella fastidiosa
           Ann-1]
 gi|71732323|gb|EAO34377.1| NADH (or F420H2) dehydrogenase, subunit C [Xylella fastidiosa
           Ann-1]
          Length = 227

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 107/197 (54%), Gaps = 53/197 (26%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN----------------- 70
           GE++LDV   +  ++C  LRD+    F  + DLCGVD+L   N                 
Sbjct: 6   GEITLDVPVVEWCAVCKGLRDE--FDFEQLSDLCGVDYLGYGNAEWDTTDVSAQGFSRGV 63

Query: 71  ------------------------------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
                                         RF V+ H +S ++NRRLRV+   A   ++P
Sbjct: 64  AGKAVGRFAWGEFPSAGSNDGTQPWDVPQERFAVLAHLISYRHNRRLRVR-CFASNDALP 122

Query: 101 ---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELH 157
              S+  ++PG +WFERE +D++GI FEGHPDLRRILTDYGF GHP RKDFP+TG VE+ 
Sbjct: 123 IVASLTDVWPGVNWFEREAFDLFGIVFEGHPDLRRILTDYGFIGHPFRKDFPLTGNVEVR 182

Query: 158 YDDKVKKVVYRPVELMQ 174
           YD++ K+VVY PV  ++
Sbjct: 183 YDEEKKRVVYVPVTSVE 199


>gi|325921409|ref|ZP_08183266.1| NADH dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
 gi|325548167|gb|EGD19164.1| NADH dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
          Length = 250

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 112/224 (50%), Gaps = 53/224 (23%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  +     D +   F+G+        GE++L+V   D  + C  LRD+    F  + DL
Sbjct: 1   MAEQASSFTDRLAARFAGAQIAVALPRGEVTLEVAAADWHATCLVLRDE--LGFEQLSDL 58

Query: 61  CGVDFL-----------------SRS------------------------------NRFD 73
           CGVD L                 SR                                RF 
Sbjct: 59  CGVDHLGYGSDEWDTADVSSQGFSRGVEGKAVGRFAWGEFPSQESSDGAHPQHMPKQRFA 118

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           VV   +S ++N+RLRV+   A  + VP   S+  I+PG +WFERE +D++GI F+GHPDL
Sbjct: 119 VVAQLISYQHNQRLRVRC-YAPDEQVPVVASLTDIWPGVNWFEREAFDLFGIVFDGHPDL 177

Query: 131 RRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           RRILTDYGF GHP RKDFP+ G VE+ YD++ K+VVY PV  ++
Sbjct: 178 RRILTDYGFVGHPFRKDFPLIGNVEVRYDEEKKRVVYEPVTSVE 221


>gi|255709010|gb|ACU30410.1| NADH dehydrogenase subunit 9 [Silene muscipula]
          Length = 131

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVRLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255708976|gb|ACU30393.1| NADH dehydrogenase subunit 9 [Silene flavescens]
 gi|255709058|gb|ACU30434.1| NADH dehydrogenase subunit 9 [Silene yemensis]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  F++   +  F  +ID+CGVD+ SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 15  QLLCFIKLHTYTRFQVLIDICGVDYPSRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|255709014|gb|ACU30412.1| NADH dehydrogenase subunit 9 [Silene niceensis]
          Length = 131

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 84/116 (72%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +  F  +ID+CGVD+ SR+ RF+VVY+ LS +YN R+ V+ +  E   + 
Sbjct: 15  QLLCFLKLHTYTRFQVLIDICGVDYPSRNLRFEVVYNLLSTRYNSRISVQTSADEVTRIS 74

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
            +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 75  PVVSLFPSAGRWEREVWDMFGVSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|118340563|gb|ABK80613.1| putative proton-translocating NADH dehydrogenase I chain C
           [uncultured marine Nitrospinaceae bacterium]
          Length = 161

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 85/124 (68%), Gaps = 4/124 (3%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSPKYNRRLR 88
           +++  DCG+      FLRDD    F+ ++D+  VD+LS+ + RF+VVYHF S KYN RLR
Sbjct: 30  VTMKKDCGN--EFFQFLRDDSELAFIFLMDITAVDYLSKKDERFEVVYHFYSLKYNHRLR 87

Query: 89  VKIAVAEGKSVP-SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           VKI VAE   V  SI   +  A+W+ERE+WDMYGI F  HP+LRRIL    F+GHPLRKD
Sbjct: 88  VKIPVAEEDCVAESITPFWKTANWYEREIWDMYGIKFRNHPNLRRILMYEEFKGHPLRKD 147

Query: 148 FPVT 151
           +P+ 
Sbjct: 148 YPIN 151


>gi|295798102|emb|CAX68921.1| NADH-quinone oxidoreductase subunit C [uncultured bacterium]
          Length = 156

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 88/126 (69%), Gaps = 3/126 (2%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL--SRSNRFDVVYHFLSPKYNR 85
           GE S+++    ++ L  +L++D    F  ++DLCGVD+L  +R  RF+VVYH  S   N 
Sbjct: 20  GEASIEISKHQVLELLKYLKEDADLDFSVLMDLCGVDYLWQNRKPRFEVVYHLYSISKNH 79

Query: 86  RLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPL 144
           RLRVK+A+ E   ++PS+  ++P A+W+ERE WDM+GI F GHP+L+RIL    F+GHPL
Sbjct: 80  RLRVKVALQEEDLTIPSVAPLWPAANWYEREAWDMFGIKFVGHPNLKRILLYEEFQGHPL 139

Query: 145 RKDFPV 150
           RKD+P+
Sbjct: 140 RKDYPI 145


>gi|147832583|emb|CAN72618.1| hypothetical protein VITISV_029599 [Vitis vinifera]
          Length = 149

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 86/132 (65%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
            L  FL+   +      I++CGVD  SR  RF+VVY+ LS +YN R+RV+ +  E   + 
Sbjct: 17  QLLCFLKLHTYTKVQVSINICGVDHPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTRIS 76

Query: 101 SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDD 160
            ++  +P    +EREVW M+G+    HPDL RI TDYGFEGHPLRKD P++G+VE+ YDD
Sbjct: 77  PVLSPFPSVVRWEREVWHMFGVSSINHPDLHRISTDYGFEGHPLRKDLPLSGYVEVRYDD 136

Query: 161 KVKKVVYRPVEL 172
             K+VV  P+E+
Sbjct: 137 PEKRVVSEPIEM 148


>gi|167627155|ref|YP_001677655.1| NADH dehydrogenase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|218534285|sp|B0TWP6|NUOC_FRAP2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|167597156|gb|ABZ87154.1| NADH dehydrogenase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
          Length = 215

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 109/193 (56%), Gaps = 37/193 (19%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR-- 68
           I+N FS     A    GE+++ + D  D+  +   L+ + H  F  + D+  VD+L+   
Sbjct: 15  ILNGFSVECYVAY---GEINISIKDQRDIHLVLKKLKKEYH--FKQLTDITAVDYLTYGQ 69

Query: 69  ---------------------------SNRFDVVYHFLSPKYNRRLRVKIAVAEGK--SV 99
                                      +NRF+++Y  LS   N R+RVK  + + +   V
Sbjct: 70  SDWQVGKVVSQTGFSRGRQQGFKTADVNNRFEIIYQLLSMANNVRVRVKCKLKDAQIIMV 129

Query: 100 PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYD 159
            S+  ++P A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDFP TG+VE+ YD
Sbjct: 130 DSVEDLWPSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYD 189

Query: 160 DKVKKVVYRPVEL 172
           + + KVVY PVE+
Sbjct: 190 ENLGKVVYEPVEI 202


>gi|16263285|ref|NP_436078.1| NuoC2 NADH I chain C [Sinorhizobium meliloti 1021]
 gi|307304396|ref|ZP_07584147.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           BL225C]
 gi|307318103|ref|ZP_07597539.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           AK83]
 gi|7387953|sp|P56896|NUOC2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit C 2; AltName:
           Full=NADH dehydrogenase I subunit C 2; AltName:
           Full=NDH-1 subunit C 2
 gi|5650746|emb|CAB51631.1| putative NADH-ubiquinone oxidoreductase subunit [Sinorhizobium
           meliloti]
 gi|14523962|gb|AAK65490.1| NuoC2 NADH:quinone oxidoreductase (chain C) [Sinorhizobium meliloti
           1021]
 gi|306896144|gb|EFN26894.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           AK83]
 gi|306902598|gb|EFN33192.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium meliloti
           BL225C]
          Length = 182

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 85/142 (59%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I+ SF G+V     + G  +  V    +V  C FL++ P   F  + D+CGVD    + R
Sbjct: 12  IIGSFGGAVENLGAAHGIYAFAVPPEQIVEFCRFLKEHPALEFDFLSDICGVDHYPETPR 71

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F+ VYH  S K   R+R+K  + E   VP++ G++  A+W ERE WDMYGI FEGHPDLR
Sbjct: 72  FETVYHLYSLKNKWRVRIKCRLGEPPHVPTVTGVWRTANWHEREAWDMYGIRFEGHPDLR 131

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI    GFEG P RKDFP+ G+
Sbjct: 132 RIYMWEGFEGFPQRKDFPLRGY 153


>gi|114321117|ref|YP_742800.1| NADH (or F420H2) dehydrogenase, subunit C [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311304|sp|Q0A777|NUOC_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|114227511|gb|ABI57310.1| NADH dehydrogenase subunit C [Alkalilimnicola ehrlichii MLHE-1]
          Length = 247

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 111/218 (50%), Gaps = 46/218 (21%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNII 58
           M +K+E L   +       +R  V     GEL+++V   DL    + LRD     F  ++
Sbjct: 1   MAKKLEQLQTAVQERLGERLRDCVLDADRGELAIEVAPADLHQAMTTLRDAEGLRFDMLM 60

Query: 59  DLCGVDFLS------------------------------------------RSNRFDVVY 76
           DL GVD+ +                                             RF  VY
Sbjct: 61  DLAGVDYAAWGEDEWFTDTAEGTGFSRGVQGNNFARLGITGIYGVQEITENTGRRFAAVY 120

Query: 77  HFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
             LS + N+RLRV+    + +   + S+V ++ GA+WFERE +D+YGI F+GHPDLRRIL
Sbjct: 121 QLLSVELNQRLRVRCFCEDDRFPVLDSVVDVWSGANWFEREAFDLYGIIFDGHPDLRRIL 180

Query: 135 TDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           TDYGF GHP RKDFP+ G VE+ YD++ ++V+Y+PV +
Sbjct: 181 TDYGFVGHPFRKDFPLIGNVEVRYDEQKRRVIYQPVSI 218


>gi|241667717|ref|ZP_04755295.1| NADH dehydrogenase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 215

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 80/106 (75%), Gaps = 2/106 (1%)

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           +NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  
Sbjct: 97  NNRFEIIYQLLSMANNVRVRVKCKLKDAQIIMVDSVEDLWPSANWAEREVYDMFGIYFNN 156

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           HPDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + KVVY PVE+
Sbjct: 157 HPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGKVVYEPVEI 202


>gi|254876261|ref|ZP_05248971.1| NADH dehydrogenase I [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842282|gb|EET20696.1| NADH dehydrogenase I [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 217

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 80/106 (75%), Gaps = 2/106 (1%)

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGK--SVPSIVGIYPGADWFEREVWDMYGIFFEG 126
           +NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  
Sbjct: 99  NNRFEIIYQLLSMANNVRVRVKCKLKDAQIIMVDSVEDLWPSANWAEREVYDMFGIYFNN 158

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           HPDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + KVVY PVE+
Sbjct: 159 HPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGKVVYEPVEI 204


>gi|283795064|ref|YP_003359480.1| NADH dehydrogenase subunit 9 [Synedra acus]
 gi|261279720|gb|ACX62028.1| NADH dehydrogenase subunit 9 [Synedra acus]
          Length = 209

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 110/173 (63%), Gaps = 4/173 (2%)

Query: 23  AVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FDVVYHFLSP 81
           A+++   + + +D   L S   FL+    C +  + DL GV  +S+ ++ +DV+Y  LS 
Sbjct: 39  AIDTFYTICVSLDKTYLRSYLFFLKYHVLCQYDLLTDLTGVSNVSQEDKPYDVIYELLSI 98

Query: 82  KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
           ++N RLRVK+  A   SV ++  IY  A+W E E+WDMYGI+ E H  L R+LTDYGFEG
Sbjct: 99  RFNNRLRVKVQ-AINNSVSTVSDIYLSANWSECELWDMYGIYPENHDRLIRLLTDYGFEG 157

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDFLSPWEGVNSLFAK 194
           HPLRKDFP++G+ ++ Y++  K+V+   +EL QE+R +D+       N LF+K
Sbjct: 158 HPLRKDFPLSGYYDVRYNEFKKRVIIDKLELGQEYRIFDY--KVSSDNRLFSK 208


>gi|301353206|ref|YP_003795203.1| NADH dehydrogenase subunit 9 [Proteromonas lacertae]
 gi|301353244|ref|YP_003795241.1| NADH dehydrogenase subunit 9 [Proteromonas lacertae]
 gi|290573154|gb|ADD46341.1| NADH dehydrogenase subunit 9 [Proteromonas lacertae]
 gi|290573192|gb|ADD46379.1| NADH dehydrogenase subunit 9 [Proteromonas lacertae]
          Length = 195

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 81/123 (65%)

Query: 44  SFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIV 103
           +FL  +  C F  + D+  VD+  R +RFDVVY+ LS +YN R+R+K  + +G  + S  
Sbjct: 50  NFLNKNTFCLFKVLCDMTAVDWPVRVHRFDVVYNLLSIQYNSRIRIKTVIGQGSPIISAC 109

Query: 104 GIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVK 163
             Y  A+WFERE+WD++GI F  HP++ RILTDYGF GH LRKDFPV GF ++ Y  K  
Sbjct: 110 LTYSNANWFEREIWDLFGILFYFHPNMCRILTDYGFIGHALRKDFPVVGFFDVSYSLKTH 169

Query: 164 KVV 166
            V+
Sbjct: 170 SVI 172


>gi|255709038|gb|ACU30424.1| NADH dehydrogenase subunit 9 [Silene schafta]
          Length = 131

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%)

Query: 42  LCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPS 101
           L  FL+   +  F  +ID+CGVD+  R  RF+VVY+ LS +YN R+RV+ +  E   +  
Sbjct: 16  LLCFLKLHTYTRFQVLIDICGVDYPYRKLRFEVVYNLLSTRYNSRIRVQTSADEVTRISP 75

Query: 102 IVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVEL 156
           +V ++P A  +EREVWDM+G+    HPDLRRILTDYGFEGHPLRKDFP++G+VE+
Sbjct: 76  VVSLFPSAGRWEREVWDMFGLSSINHPDLRRILTDYGFEGHPLRKDFPLSGYVEV 130


>gi|134301248|ref|YP_001121216.1| NADH dehydrogenase I subunit C [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|218534286|sp|A4IVZ4|NUOC_FRATW RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|134049025|gb|ABO46096.1| NADH dehydrogenase I subunit C [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 110/204 (53%), Gaps = 34/204 (16%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIID 59
           M  K++D  D I    SG       S GE++  + D  D+  +   L+ +    F  + D
Sbjct: 1   MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKE--YLFEQLTD 58

Query: 60  LCGVDFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVK 90
           +  VD+L+                               NRF+++Y  LS   N R+RVK
Sbjct: 59  VTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVK 118

Query: 91  IAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             + + +   V S+  ++P A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDF
Sbjct: 119 CKLKDAQIILVDSVSDLWPSANWTEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDF 178

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P TG+VE+ YD+ + +VVY PVE+
Sbjct: 179 PQTGYVEMRYDENLGRVVYEPVEI 202


>gi|187930990|ref|YP_001890974.1| NADH dehydrogenase I, C subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456274|ref|ZP_03664747.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|218534272|sp|B2SEV1|NUOC_FRATM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|187711899|gb|ACD30196.1| NADH dehydrogenase I, C subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|282158321|gb|ADA77712.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 110/204 (53%), Gaps = 34/204 (16%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIID 59
           M  K++D  D I    SG       S GE++  + D  D+  +   L+ +    F  + D
Sbjct: 1   MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKE--YLFEQLTD 58

Query: 60  LCGVDFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVK 90
           +  VD+L+                               NRF+++Y  LS   N R+RVK
Sbjct: 59  VTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVK 118

Query: 91  IAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             + + +   V S+  ++P A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDF
Sbjct: 119 CKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDF 178

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P TG+VE+ YD+ + +VVY PVE+
Sbjct: 179 PQTGYVEMRYDENLGRVVYEPVEI 202


>gi|290952991|ref|ZP_06557612.1| NADH-quinone oxidoreductase subunit C [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313811|ref|ZP_06804384.1| NADH-quinone oxidoreductase subunit C [Francisella tularensis
           subsp. holarctica URFT1]
          Length = 214

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 98  NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWVEREVYDMFGIYFNNH 157

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 158 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 202


>gi|169656769|ref|YP_001429367.2| NADH dehydrogenase I subunit C [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|218534354|sp|A7NEK8|NUOC_FRATF RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|164551837|gb|ABU62411.2| NADH dehydrogenase I subunit C [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 216

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 100 NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWVEREVYDMFGIYFNNH 159

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 160 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 204


>gi|56707213|ref|YP_169109.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110669683|ref|YP_666240.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC198]
 gi|254371429|ref|ZP_04987430.1| NADH dehydrogenase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373580|ref|ZP_04989066.1| NADH dehydrogenase I [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254874051|ref|ZP_05246761.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81598107|sp|Q5NIN3|NUOC_FRATT RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|123359659|sp|Q14K36|NUOC_FRAT1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|56603705|emb|CAG44666.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110320016|emb|CAL08049.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151569668|gb|EDN35322.1| NADH dehydrogenase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151571304|gb|EDN36958.1| NADH dehydrogenase I [Francisella novicida GA99-3549]
 gi|254840050|gb|EET18486.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
          Length = 216

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 100 NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNH 159

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 160 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 204


>gi|115315445|ref|YP_764168.1| NADH dehydrogenase (ubiquinone) [Francisella tularensis subsp.
           holarctica OSU18]
 gi|254368324|ref|ZP_04984342.1| hypothetical protein FTHG_01692 [Francisella tularensis subsp.
           holarctica 257]
 gi|254368967|ref|ZP_04984980.1| NADH dehydrogenase [Francisella tularensis subsp. holarctica
           FSC022]
 gi|122324570|sp|Q0BK53|NUOC_FRATO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|115130344|gb|ABI83531.1| NADH dehydrogenase (ubiquinone) [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134254132|gb|EBA53226.1| hypothetical protein FTHG_01692 [Francisella tularensis subsp.
           holarctica 257]
 gi|157121888|gb|EDO66058.1| NADH dehydrogenase [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 216

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 100 NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNH 159

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 160 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 204


>gi|89257088|ref|YP_514450.1| NADH dehydrogenase I [Francisella tularensis subsp. holarctica LVS]
 gi|167009480|ref|ZP_02274411.1| NADH dehydrogenase (ubiquinone) [Francisella tularensis subsp.
           holarctica FSC200]
 gi|122500211|sp|Q2A1F2|NUOC_FRATH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|89144919|emb|CAJ80267.1| NADH dehydrogenase I [Francisella tularensis subsp. holarctica LVS]
          Length = 214

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 98  NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNH 157

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 158 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 202


>gi|258593433|emb|CBE69772.1| NADH-quinone oxidoreductase [NC10 bacterium 'Dutch sediment']
          Length = 168

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLR 88
           E +L V  GDL+  C +L++DP   +  + DL  VD      RF+VVYH  S +Y +R+R
Sbjct: 33  ETTLLVRLGDLIRFCRYLKEDPGLLYDFLSDLTAVDRFGDHPRFEVVYHLYSLQYKQRIR 92

Query: 89  VKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           +K+ V EG++VPS+  ++  ADW EREV+DM+GI FEGHPDLRRIL   G+EG PLRKD+
Sbjct: 93  LKVHVEEGEAVPSVTTVWGVADWHEREVFDMFGIRFEGHPDLRRILMPEGWEGCPLRKDY 152

Query: 149 P 149
           P
Sbjct: 153 P 153


>gi|62257927|gb|AAX77754.1| unknown protein [synthetic construct]
          Length = 251

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++P A+W EREV+DM+GI+F  H
Sbjct: 126 NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNH 185

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 186 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 230


>gi|42524475|ref|NP_969855.1| NADH dehydrogenase I,D subunit [Bdellovibrio bacteriovorus HD100]
 gi|81616435|sp|Q6MIR5|NUOCD_BDEBA RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D; AltName: Full=NUO3/NUO4
 gi|39576684|emb|CAE80848.1| NADH dehydrogenase I,D subunit [Bdellovibrio bacteriovorus HD100]
          Length = 560

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 102/166 (61%), Gaps = 8/166 (4%)

Query: 2   VRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           + K+E+L   +   F        ++VG+  ++V   D  +L  FLR+     F  ++D+C
Sbjct: 1   MNKLENLKQLLAGKFKIENFKFTHAVGDDVIEVPKEDAPALLLFLRESGQFDF--LMDVC 58

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
           G D+ SR  RFDVVY+  + K + RLRVK  V EG+S+ + +  Y GADWFERE +DM+G
Sbjct: 59  GADYPSREKRFDVVYNLFNSKDSSRLRVKAQVGEGESIGTAIPAYRGADWFEREAYDMFG 118

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDF------PVTGFVELHYDDK 161
           I FEGHP+LR+ILT + F GHPLRKD+        T  + +H++++
Sbjct: 119 IIFEGHPNLRKILTHHQFVGHPLRKDYDANNQQACTNSLPIHFNNE 164


>gi|218534347|sp|B0U1W7|NUOC_XYLFM RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
          Length = 249

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 117/225 (52%), Gaps = 55/225 (24%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAV-NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIID 59
           M  +     D + + F  +VR +V    GE++LDV   +  ++C  LRD+    F  + D
Sbjct: 1   MAEQTLSFVDCLTSRFP-TVRVSVAQPRGEITLDVPVVEWCAVCKGLRDEFD--FEQLSD 57

Query: 60  LCGVDFLSRSN-----------------------------------------------RF 72
           LCGVD+L   N                                               RF
Sbjct: 58  LCGVDYLGYGNAEWDTTGVSAQGFSRGVAGKAVGRFAWGEFPSAGTNDGTQPWDVPQERF 117

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            V+ H +S ++NRRLRV+   A   ++P   S+  ++PG +WFERE +D++GI FEGH D
Sbjct: 118 AVLAHLISYRHNRRLRVR-CFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHLD 176

Query: 130 LRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQ 174
           LRRILTDYGF GHP RKDFP+TG VE+ YD++ K+VVY PV  ++
Sbjct: 177 LRRILTDYGFIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVE 221


>gi|121998542|ref|YP_001003329.1| NADH (or F420H2) dehydrogenase subunit C [Halorhodospira halophila
           SL1]
 gi|218534291|sp|A1WXW5|NUOC_HALHL RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|121589947|gb|ABM62527.1| NADH dehydrogenase subunit C [Halorhodospira halophila SL1]
          Length = 246

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 104/211 (49%), Gaps = 44/211 (20%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E L + +   F G +       GE++ DV   DL+++ + LRD     F  + D+ GVD+
Sbjct: 5   ESLLEQLRGHFGGRLTDCWLERGEVTADVRPADLLAVMTELRDGAEWRFEQLSDVAGVDY 64

Query: 66  LS------------------------------------------RSNRFDVVYHFLSPKY 83
            +                                             RF  VY  LS  +
Sbjct: 65  AAYGQDEWITESATGTGFSRGVTEPGFGRLGLTGIYGVQSIEEQTGRRFAAVYQLLSLTH 124

Query: 84  NRRLRVKIAVAEG--KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG 141
           N RLRV+    +     +PS+ GI+P A+W ERE +D+YGI FEGHPDLRRILTDYGF G
Sbjct: 125 NHRLRVRCFAEDDDLPVLPSVTGIWPCANWAEREAFDLYGIVFEGHPDLRRILTDYGFVG 184

Query: 142 HPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           HP RKDFP+ G VE  YD +  +VVY PVE+
Sbjct: 185 HPFRKDFPLIGNVEPRYDPEKGRVVYGPVEI 215


>gi|71275688|ref|ZP_00651973.1| NADH dehydrogenase [Xylella fastidiosa Dixon]
 gi|71897856|ref|ZP_00680082.1| NADH dehydrogenase (quinone) [Xylella fastidiosa Ann-1]
 gi|170729491|ref|YP_001774924.1| NADH dehydrogenase subunit C [Xylella fastidiosa M12]
 gi|71163579|gb|EAO13296.1| NADH dehydrogenase [Xylella fastidiosa Dixon]
 gi|71732411|gb|EAO34465.1| NADH dehydrogenase (quinone) [Xylella fastidiosa Ann-1]
 gi|167964284|gb|ACA11294.1| NADH dehydrogenase [Xylella fastidiosa M12]
          Length = 227

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 106/197 (53%), Gaps = 53/197 (26%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN----------------- 70
           GE++LDV   +  ++C  LRD+    F  + DLCGVD+L   N                 
Sbjct: 6   GEITLDVPVVEWCAVCKGLRDE--FDFEQLSDLCGVDYLGYGNAEWDTTGVSAQGFSRGV 63

Query: 71  ------------------------------RFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
                                         RF V+ H +S ++NRRLRV+   A   ++P
Sbjct: 64  AGKAVGRFAWGEFPSAGTNDGTQPWDVPQERFAVLAHLISYRHNRRLRVR-CFASNDALP 122

Query: 101 ---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELH 157
              S+  ++PG +WFERE +D++GI FEGH DLRRILTDYGF GHP RKDFP+TG VE+ 
Sbjct: 123 IVASLTDVWPGVNWFEREAFDLFGIVFEGHLDLRRILTDYGFIGHPFRKDFPLTGNVEVR 182

Query: 158 YDDKVKKVVYRPVELMQ 174
           YD++ K+VVY PV  ++
Sbjct: 183 YDEEKKRVVYVPVTSVE 199


>gi|118498239|ref|YP_899289.1| NADH dehydrogenase I, C subunit [Francisella tularensis subsp.
           novicida U112]
 gi|194324423|ref|ZP_03058196.1| NADH (or f420h2) dehydrogenase, subunit c family [Francisella
           tularensis subsp. novicida FTE]
 gi|218534281|sp|A0Q8H0|NUOC_FRATN RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|118424145|gb|ABK90535.1| NADH dehydrogenase I, C subunit [Francisella novicida U112]
 gi|194321488|gb|EDX18973.1| NADH (or f420h2) dehydrogenase, subunit c family [Francisella
           tularensis subsp. novicida FTE]
          Length = 214

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 109/204 (53%), Gaps = 34/204 (16%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIID 59
           M  K++D  D I    SG       S GE++  + D  D+  +   L+ +    F  + D
Sbjct: 1   MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKE--YLFEQLTD 58

Query: 60  LCGVDFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVK 90
           +  VD+L+                               NRF+++Y  LS   N R+RVK
Sbjct: 59  VTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVK 118

Query: 91  IAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             + + +   V S+  ++  A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDF
Sbjct: 119 CKLKDAQIILVDSVSDLWSSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDF 178

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P TG+VE+ YD+ + +VVY PVE+
Sbjct: 179 PQTGYVEMRYDENLGRVVYEPVEI 202


>gi|208780266|ref|ZP_03247608.1| respiratory-chain NADH dehydrogenase, 30 kd subunit domain
           [Francisella novicida FTG]
 gi|208743915|gb|EDZ90217.1| respiratory-chain NADH dehydrogenase, 30 kd subunit domain
           [Francisella novicida FTG]
          Length = 214

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 109/204 (53%), Gaps = 34/204 (16%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIID 59
           M  K++D  D I    SG       S GE++  + D  D+  +   L+ +    F  + D
Sbjct: 1   MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKE--YLFEQLTD 58

Query: 60  LCGVDFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVK 90
           +  VD+L+                               NRF+++Y  LS   N R+RVK
Sbjct: 59  VTAVDYLAYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVK 118

Query: 91  IAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             + + +   V S+  ++  A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDF
Sbjct: 119 CKLKDAQIILVDSVSDLWSSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDF 178

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P TG+VE+ YD+ + +VVY PVE+
Sbjct: 179 PQTGYVEMRYDENLGRVVYEPVEI 202


>gi|332678975|gb|AEE88104.1| NADH-ubiquinone oxidoreductase chain C [Francisella cf. novicida
           Fx1]
          Length = 214

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 109/204 (53%), Gaps = 34/204 (16%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDV-DCGDLVSLCSFLRDDPHCCFVNIID 59
           M  K++D  D I    SG       S GE++  + D  D+  +   L+ +    F  + D
Sbjct: 1   MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKE--YLFEQLTD 58

Query: 60  LCGVDFLSRS-----------------------------NRFDVVYHFLSPKYNRRLRVK 90
           +  VD+L+                               NRF+++Y  LS   N R+RVK
Sbjct: 59  VTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVK 118

Query: 91  IAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             + + +   V S+  ++  A+W EREV+DM+GI+F  HPDLRR+LTDYGF GHPLRKDF
Sbjct: 119 CKLKDARIILVDSVSDLWSSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDF 178

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P TG+VE+ YD+ + +VVY PVE+
Sbjct: 179 PQTGYVEMRYDENLGRVVYEPVEI 202


>gi|332184794|gb|AEE27048.1| NADH-ubiquinone oxidoreductase chain C [Francisella cf. novicida
           3523]
          Length = 214

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 57/106 (53%), Positives = 78/106 (73%), Gaps = 2/106 (1%)

Query: 69  SNRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEG 126
           +NRF+++Y  LS   N R+RVK  + + +   V S+  ++  A+W EREV+DM+GI+F  
Sbjct: 97  NNRFEIIYQLLSMANNVRVRVKCKLKDAQIILVDSVSDLWASANWAEREVYDMFGIYFNN 156

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           HPDLRR+LTDYGF GHPLRKDFP TG+VE+ YD  + +VVY PVE+
Sbjct: 157 HPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDQNLGRVVYEPVEI 202


>gi|269926647|ref|YP_003323270.1| NADH (or F420H2) dehydrogenase, subunit C [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269790307|gb|ACZ42448.1| NADH (or F420H2) dehydrogenase, subunit C [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 179

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 93/147 (63%), Gaps = 5/147 (3%)

Query: 12  IVNSFSGSVRFAVNSV----GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           I+N+    +  A+  V    GE ++ V    L+ +   LRD+P   F  ++D+  VD+L 
Sbjct: 22  IINTLQEIIPGAIEEVTVFRGETTIVVPVDRLIDIARTLRDNPAMQFNYLVDVTAVDWLG 81

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           R+ RFDVVYH  S   N  +R+K+ V +G+ VPS+ G++  A+W ERE +DM+GI FEGH
Sbjct: 82  RTPRFDVVYHLYSIPLNHAIRMKVRVDDGQHVPSLTGLWELANWGERETYDMFGIVFEGH 141

Query: 128 PDLRRILTDYGFE-GHPLRKDFPVTGF 153
           PDLRRIL    ++ G PLRKDFP+ G+
Sbjct: 142 PDLRRILLPEDWQDGFPLRKDFPIGGY 168


>gi|254375047|ref|ZP_04990527.1| NADH-quinone oxidoreductase chain C [Francisella novicida
           GA99-3548]
 gi|151572765|gb|EDN38419.1| NADH-quinone oxidoreductase chain C [Francisella novicida
           GA99-3548]
          Length = 216

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 78/105 (74%), Gaps = 2/105 (1%)

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGH 127
           NRF+++Y  LS   N R+RVK  + + +   V S+  ++  A+W EREV+DM+GI+F  H
Sbjct: 100 NRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWSSANWAEREVYDMFGIYFNNH 159

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVEL 172
           PDLRR+LTDYGF GHPLRKDFP TG+VE+ YD+ + +VVY PVE+
Sbjct: 160 PDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEI 204


>gi|197121691|ref|YP_002133642.1| NADH (or F420H2) dehydrogenase, subunit C [Anaeromyxobacter sp. K]
 gi|220916487|ref|YP_002491791.1| NADH (or F420H2) dehydrogenase, subunit C [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196171540|gb|ACG72513.1| NADH (or F420H2) dehydrogenase, subunit C [Anaeromyxobacter sp. K]
 gi|219954341|gb|ACL64725.1| NADH (or F420H2) dehydrogenase, subunit C [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 175

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 88/138 (63%), Gaps = 2/138 (1%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAV 93
           V+   +V +C FL++DP   F     +  VD+L  S RF+VVY+ LS  +N R+R+++ V
Sbjct: 32  VERSRIVDVCRFLKEDPSLAFNMSPYITAVDYLGASPRFEVVYNLLSTVHNTRVRLRVKV 91

Query: 94  AEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
            EG    VPS+ G++ GADWFER  WDMYGI F GHPD+RR+L    FEGHPLRKD+P+ 
Sbjct: 92  PEGPEGVVPSVTGLWRGADWFERYCWDMYGIPFSGHPDMRRLLMYDEFEGHPLRKDYPLR 151

Query: 152 GFVELHYDDKVKKVVYRP 169
           G   L  + +V  +   P
Sbjct: 152 GRQPLVVEREVHDIFRGP 169


>gi|86158990|ref|YP_465775.1| NADH (or F420H2) dehydrogenase subunit C [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775501|gb|ABC82338.1| NADH dehydrogenase subunit C [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 175

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 89/138 (64%), Gaps = 2/138 (1%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAV 93
           V+   +V +C FL+++P   F     +  VD+L  + RF+VVY+ LS  +N+R+R+++ V
Sbjct: 32  VERSRIVDVCRFLKEEPSLAFNMAPYITAVDYLGATPRFEVVYNLLSTVHNKRVRLRVKV 91

Query: 94  AEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
            EG    VPS+ G++ GADWFER  WDMYGI F GHPD+RR+L    FEGHPLRKD+P+ 
Sbjct: 92  PEGPEGVVPSVTGLWRGADWFERYCWDMYGIPFSGHPDMRRLLMYDEFEGHPLRKDYPLR 151

Query: 152 GFVELHYDDKVKKVVYRP 169
           G   L  + +V  +   P
Sbjct: 152 GRQPLVVEREVHDIFRGP 169


>gi|150375772|ref|YP_001312368.1| NADH (or F420H2) dehydrogenase subunit C [Sinorhizobium medicae
           WSM419]
 gi|150030319|gb|ABR62435.1| NADH (or F420H2) dehydrogenase, subunit C [Sinorhizobium medicae
           WSM419]
          Length = 182

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 83/142 (58%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I+ SF G+V     + G  +  V    +V  C FL++ P   F  + D+CGVD      R
Sbjct: 12  IIGSFVGAVEGLGAAHGIHAFAVPPEQIVEFCRFLKEHPALQFSFLSDICGVDHYPDLPR 71

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F+ VYH  S     R+R+K  + +   VPS+ G++  A+W ERE WDMYGI FEGHPDLR
Sbjct: 72  FETVYHLYSLNNKWRVRIKCRLGDPPHVPSVTGVWRTANWHEREAWDMYGIRFEGHPDLR 131

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI    GFEG P RKDFP+ G+
Sbjct: 132 RIYMWEGFEGFPQRKDFPLRGY 153


>gi|190575276|ref|YP_001973121.1| NADH dehydrogenase subunit C [Stenotrophomonas maltophilia K279a]
 gi|194366602|ref|YP_002029212.1| NADH dehydrogenase subunit C [Stenotrophomonas maltophilia R551-3]
 gi|254525186|ref|ZP_05137241.1| NADH-ubiquinone oxidoreductase Nqo5 subunit [Stenotrophomonas sp.
           SKA14]
 gi|218534323|sp|B4SQT4|NUOC_STRM5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|218534324|sp|B2FNX7|NUOC_STRMK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|190013198|emb|CAQ46831.1| putative respiratory-chain NADH dehydrogenase, 30 kDa subunit
           [Stenotrophomonas maltophilia K279a]
 gi|194349406|gb|ACF52529.1| NADH dehydrogenase (ubiquinone) [Stenotrophomonas maltophilia
           R551-3]
 gi|219722777|gb|EED41302.1| NADH-ubiquinone oxidoreductase Nqo5 subunit [Stenotrophomonas sp.
           SKA14]
          Length = 249

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 108/212 (50%), Gaps = 54/212 (25%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL--- 66
           D +   F+G+    V   GE++L+V   +  +    LRD+    F   +DLCGVD+L   
Sbjct: 9   DRLSARFAGAKVIVVEPRGEVTLEVPAAEWHATALALRDE--FGFEQAVDLCGVDYLGYG 66

Query: 67  --------------SR-------------------------------SNRFDVVYHFLSP 81
                         SR                               + RF VV    S 
Sbjct: 67  SDEWDTADVSSQGFSRGVEGKAQGRFAWGEFPTEENGADGARPQHMPTQRFAVVAQLRSY 126

Query: 82  KYNRRLRVKIAVAEGKSVP---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           ++N  + ++   A  +++P   S+ GI+PG +WFERE +D+YG+ FEGHPDLRRILTDYG
Sbjct: 127 QHNLMMHLRC-FAPDEALPVVSSLTGIWPGLNWFEREAFDLYGVIFEGHPDLRRILTDYG 185

Query: 139 FEGHPLRKDFPVTGFVELHYDDKVKKVVYRPV 170
           F GHP RKDFP+ G VE+ YD++ K+V+Y PV
Sbjct: 186 FVGHPFRKDFPLIGNVEVRYDEEKKRVIYEPV 217


>gi|297181762|gb|ADI17943.1| NADH:ubiquinone oxidoreductase 27 kd subunit [uncultured
           Desulfobacterales bacterium HF0200_07G10]
          Length = 161

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (68%), Gaps = 4/124 (3%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSPKYNRRLR 88
           +++  DCG+      FLRD+    F  ++D+  VD+LS+ + RF+VVYHF S K+N RLR
Sbjct: 30  ITVRKDCGN--EFFKFLRDESELSFNFLMDITAVDYLSKKDERFEVVYHFYSLKHNHRLR 87

Query: 89  VKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           VKI V AE  S  S+  ++  A+W+ERE+WDMYGI F  HP+LRRIL    F+GHPLRKD
Sbjct: 88  VKIPVSAEDCSTESVTPLWKTANWYEREIWDMYGIKFRNHPNLRRILLYEEFKGHPLRKD 147

Query: 148 FPVT 151
           +P+ 
Sbjct: 148 YPIN 151


>gi|284106848|ref|ZP_06386291.1| NADH-ubiquinone oxidoreductase, chain 49kDa [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830027|gb|EFC34303.1| NADH-ubiquinone oxidoreductase, chain 49kDa [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 583

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 84/127 (66%), Gaps = 2/127 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           G+LS  V   DLV +  FL DDP   F ++ D+C  D+     RF+V+YHFLS  +N R+
Sbjct: 26  GDLSAQVRAQDLVEVARFLHDDPGMAFDHLTDICSADYPDDLERFEVIYHFLSLPHNTRI 85

Query: 88  RVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF-EGHPLR 145
           R+K  V E + ++ ++  I+ GA++ EREV+D+ GI FEGHPDLRRIL    + EGHPLR
Sbjct: 86  RLKTRVTEEQPTLGTVTSIWKGANFLEREVYDLMGITFEGHPDLRRILLPEDYEEGHPLR 145

Query: 146 KDFPVTG 152
           KDFP  G
Sbjct: 146 KDFPTEG 152


>gi|289606895|emb|CBI60959.1| unnamed protein product [Sordaria macrospora]
          Length = 94

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 109 ADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYR 168
           A W EREV+DMYG+ F G+ DLRRILTDYGF GHPLRKDFP+TG+VE+ Y ++ K+VVY 
Sbjct: 15  AGWLEREVYDMYGVLFTGNADLRRILTDYGFRGHPLRKDFPLTGYVEMRYSEEAKRVVYE 74

Query: 169 PVELMQEHRDYDFLSPWEGV 188
           PV+L Q+ R +DF+SPWEG 
Sbjct: 75  PVKLAQDFRTFDFMSPWEGA 94


>gi|218460105|ref|ZP_03500196.1| NADH-ubiquinone oxidoreductase chain C protein [Rhizobium etli Kim
           5]
          Length = 178

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 81/142 (57%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I+  F  ++     + G  +  V    +V  C FL++ P   F  + D+CGVD      R
Sbjct: 12  IMERFGETIEDLGTAHGIEAFAVPPERIVEFCRFLKEHPALQFNFLSDVCGVDHYPEMPR 71

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F+ VYH  S    RR+R+K  + +   VPS+ G++  A+W ERE WDMYGI F GHPDLR
Sbjct: 72  FEAVYHLYSLPNRRRVRIKCRLGDPPEVPSVTGVWRTANWHEREAWDMYGIRFTGHPDLR 131

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI    GFEG P RKDFP+ GF
Sbjct: 132 RIYMWEGFEGFPQRKDFPLRGF 153


>gi|289207895|ref|YP_003459961.1| NADH (or F420H2) dehydrogenase, subunit C [Thioalkalivibrio sp.
           K90mix]
 gi|288943526|gb|ADC71225.1| NADH (or F420H2) dehydrogenase, subunit C [Thioalkalivibrio sp.
           K90mix]
          Length = 239

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 103/204 (50%), Gaps = 43/204 (21%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL--- 66
           D +      ++     +  E+++D+           LRD     F  +IDLCGVD+L   
Sbjct: 9   DALRAELGDALETVTEAYDEVTVDIRPQAWREAAEKLRD--AFGFEMLIDLCGVDYLEYG 66

Query: 67  -------SRSN-----------------------------RFDVVYHFLSPKYNRRLRVK 90
                  S +N                             RF V    LS ++NRRLR++
Sbjct: 67  QDEWGTESATNTGFSRGVEPATSGRFTFDDAPEDSLWDGPRFTVAVQLLSIQHNRRLRMR 126

Query: 91  IAVA--EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             +A  E   V S+V ++  A+WFERE +D++GI F GHPDLRRILTDYGF GHP RKDF
Sbjct: 127 AWLADDEFPEVESLVEVWASANWFEREAFDLFGILFSGHPDLRRILTDYGFVGHPFRKDF 186

Query: 149 PVTGFVELHYDDKVKKVVYRPVEL 172
           P+ G VE+ YD +  +VVY+PV +
Sbjct: 187 PLIGHVEMRYDAEQARVVYQPVTI 210


>gi|148657776|ref|YP_001277981.1| NADH (or F420H2) dehydrogenase subunit C [Roseiflexus sp. RS-1]
 gi|218534342|sp|A5UZH8|NUOC_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|148569886|gb|ABQ92031.1| NADH (or F420H2) dehydrogenase, subunit C [Roseiflexus sp. RS-1]
          Length = 174

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 92/147 (62%), Gaps = 5/147 (3%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +E L   + ++  GS  F     G+LS+ V    +V +  FLRDDP   F  + +LCGVD
Sbjct: 9   LERLRAALPDAILGSAEFR----GDLSVYVRPERIVDVARFLRDDPELRFNFLENLCGVD 64

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIF 123
           +L R  RF+VVYH +S     R+ +K+ V E   SVPS+ G++PGA++ ERE +DM+GI 
Sbjct: 65  YLGREPRFEVVYHLISFTNRSRICLKVGVDEHNPSVPSLTGLWPGANYHERETFDMFGII 124

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPV 150
           F GHP L RIL    +EGHPLRKD P+
Sbjct: 125 FTGHPCLERILMPEDWEGHPLRKDVPL 151


>gi|153004159|ref|YP_001378484.1| NADH (or F420H2) dehydrogenase subunit C [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027732|gb|ABS25500.1| NADH (or F420H2) dehydrogenase, subunit C [Anaeromyxobacter sp.
           Fw109-5]
          Length = 174

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 86/132 (65%), Gaps = 1/132 (0%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           +V +C FL+ DP   F     +  VD+L +  RF+VVY+ LS K NRR R+++ V E  +
Sbjct: 37  IVDVCRFLKSDPGMLFDMAPYITAVDYLGQEPRFEVVYNLLSLKTNRRARLRVKVPEQDA 96

Query: 99  V-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELH 157
           V PS+ G++ GADWFER  +DMYGI F GHPD+RR+L    F GHPLRKD+P+ G   L 
Sbjct: 97  VVPSVTGLWRGADWFERYCFDMYGIRFTGHPDMRRLLMYDEFVGHPLRKDYPLKGRQPLV 156

Query: 158 YDDKVKKVVYRP 169
            + +V+ +V  P
Sbjct: 157 QEREVRDIVRGP 168


>gi|149909803|ref|ZP_01898454.1| NuoC2 NADH I CHAIN C [Moritella sp. PE36]
 gi|149807135|gb|EDM67091.1| NuoC2 NADH  I CHAIN C [Moritella sp. PE36]
          Length = 180

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 86/144 (59%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           + +++SF+G +    N +    + V   DLV LC FLRDD    F  + D+ G+DF   +
Sbjct: 10  NQLIDSFNGRISIDPNVIDMPCVVVSPKDLVELCLFLRDDDAFKFNFMADIGGIDFHPNT 69

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            R+ +VYH  S     RLR+K  + +    P+I  ++  A+W ERE +DM+GI FEGHPD
Sbjct: 70  PRYQLVYHLYSISLGWRLRIKCPLKDPPKAPTITHLWTTANWHEREAYDMFGIVFEGHPD 129

Query: 130 LRRILTDYGFEGHPLRKDFPVTGF 153
           LRRI     FEG P+RKDFP+ G+
Sbjct: 130 LRRIYMWQEFEGWPMRKDFPLRGY 153


>gi|285017794|ref|YP_003375505.1| NADH-quinone oxidoreductase chain c (nadh dehydrogenaseI chain c)
           (ndh-1, chain c) (nuo3) oxidoreductase [Xanthomonas
           albilineans GPE PC73]
 gi|283473012|emb|CBA15517.1| probable nadh-quinone oxidoreductase chain c (nadh dehydrogenaseI
           chain c) (ndh-1, chain c) (nuo3). oxidoreductase protein
           [Xanthomonas albilineans]
          Length = 227

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 103/197 (52%), Gaps = 53/197 (26%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL-----------------SR-- 68
           GE++L+V      + C  LRD+    F  + DLCGVD+L                 SR  
Sbjct: 6   GEVTLEVAADAWHATCLVLRDE--FGFEQLTDLCGVDYLGYGSDEWDTSDVSSHGFSRGV 63

Query: 69  ----------------------------SNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVP 100
                                         R+ V+   +S ++N+RLRV+   A  + +P
Sbjct: 64  EGKAVGRFAWGEFPSGEADGGAQPLPVPQQRYAVLAQLMSYRHNQRLRVRC-YAPNEDLP 122

Query: 101 ---SIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELH 157
              S+  I+PGA+WFERE +D++G+ F GHPDLRRILTDYGF GHP RKDFP+ G VE+ 
Sbjct: 123 VVASVTDIWPGANWFEREAFDLFGVVFAGHPDLRRILTDYGFVGHPFRKDFPLIGNVEVR 182

Query: 158 YDDKVKKVVYRPVELMQ 174
           YD+  ++V+Y PV  ++
Sbjct: 183 YDEAKQRVIYEPVTSVE 199


>gi|227822751|ref|YP_002826723.1| NADH dehydrogenase subunit C1 [Sinorhizobium fredii NGR234]
 gi|227341752|gb|ACP25970.1| NADH dehydrogenase subunit C1 [Sinorhizobium fredii NGR234]
          Length = 187

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 81/142 (57%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           I   F  +V     S G     V    +V LC FL++ P   F  + D+CGVD    + R
Sbjct: 12  ISERFGEAVEELGVSHGLHGFAVPPDKIVELCRFLKEHPALRFDFLSDICGVDHFPEAPR 71

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           ++ VYH  S     R+R+K  + +   VPS+ G++  A+W ERE WDMYGI FEGHPDLR
Sbjct: 72  YEAVYHLYSLPNKWRIRIKCRLGDPPLVPSVTGVWRTANWHEREAWDMYGISFEGHPDLR 131

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI    GFEG P RKDFP+ G+
Sbjct: 132 RIYMWEGFEGFPQRKDFPLRGY 153


>gi|95928441|ref|ZP_01311189.1| NADH (or F420H2) dehydrogenase, subunit C [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135712|gb|EAT17363.1| NADH (or F420H2) dehydrogenase, subunit C [Desulfuromonas
           acetoxidans DSM 684]
          Length = 159

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (62%), Gaps = 3/140 (2%)

Query: 14  NSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFD 73
            +F+ SV       GE+++ V   D+V +C +L+++    F  + DLCGVD+L ++ RF 
Sbjct: 11  GTFAASVLEVKEHRGEVTVTVKKEDIVDICRYLKEEAGYNF--LCDLCGVDYLGQTPRFM 68

Query: 74  VVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRR 132
           VVY+  +     RLRVK+ V E    V ++ GI+  A+W ERE WD+ GI F GHPDLRR
Sbjct: 69  VVYNLYNITTKERLRVKVPVEEQDCCVDTVSGIWSTANWPERECWDLMGISFAGHPDLRR 128

Query: 133 ILTDYGFEGHPLRKDFPVTG 152
           IL    +EGHPLRKD+P+ G
Sbjct: 129 ILMPADWEGHPLRKDYPLQG 148


>gi|307069593|ref|YP_003878070.1| putative NADH:ubiquinone oxidoreductase, chain C [Candidatus
           Zinderia insecticola CARI]
 gi|306482853|gb|ADM89724.1| putative NADH:ubiquinone oxidoreductase, chain C [Candidatus
           Zinderia insecticola CARI]
          Length = 189

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 101/153 (66%), Gaps = 6/153 (3%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS----RSNRFDVVYHFLSPKYN 84
           ++++ V+  + + + S L+++    F  +ID   +D+L+    +  RF ++ + LS KYN
Sbjct: 28  QINILVNYINYLYILSILKNNKKFKFKTLIDFFCIDYLNYKSKKKFRFQIILNLLSIKYN 87

Query: 85  RRLRVKIAVAEGKS--VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGH 142
            R+R+KI +   K+  + +I  ++  ++W+ERE +DMYGI F+GH +L+RILTDY F G 
Sbjct: 88  MRIRIKIFLLNKKNPYLFTINNLWKSSNWYEREAYDMYGINFKGHYNLKRILTDYNFIGF 147

Query: 143 PLRKDFPVTGFVELHYDDKVKKVVYRPVELMQE 175
           P+RKDFP++GF EL Y++K K V Y+ + L ++
Sbjct: 148 PMRKDFPLSGFYELKYNNKKKNVFYKKINLKKK 180


>gi|298246352|ref|ZP_06970158.1| NADH (or F420H2) dehydrogenase, subunit C [Ktedonobacter racemifer
           DSM 44963]
 gi|297553833|gb|EFH87698.1| NADH (or F420H2) dehydrogenase, subunit C [Ktedonobacter racemifer
           DSM 44963]
          Length = 212

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 95/168 (56%), Gaps = 8/168 (4%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           MV       D +   F   V   V    E ++ +D G LV +C FL+      F+  +  
Sbjct: 1   MVITAASTVDVVREKFPQGVLETVEHRDEQTIILDPGSLVEVCQFLKAQLQYSFLETV-- 58

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS----VPSIVGIYPGADWFEREV 116
             VD+  R+ RFDVVY  LS ++   +R+K+ V + +     VPSI  ++ GA+W+EREV
Sbjct: 59  TAVDWPERTPRFDVVYQLLSIEHQCFIRLKVRVGQRREAHPEVPSITSVWAGANWYEREV 118

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF--VELHYDDKV 162
           +D++GI F GHPDLRRI+    +  HPLRKD+P++GF   E H+  +V
Sbjct: 119 YDLFGITFAGHPDLRRIMMPEDWTTHPLRKDYPISGFELPEPHWGGQV 166


>gi|291334204|gb|ADD93871.1| NADH/F420H2 dehydrogenase subunit C [uncultured marine bacterium
           MedDCM-OCT-S08-C1340]
          Length = 192

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 89/172 (51%), Gaps = 37/172 (21%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL----------------------- 66
           ++L VD  +L  +   LR+     F  + DLC VD +                       
Sbjct: 21  ITLTVDKLNLRKVLKTLRETKDLQFNQLTDLCAVDLIEYGESEWETKETTSKGYNRGINP 80

Query: 67  SRSNRFD-------------VVYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWF 112
              +R D             VVYH LS KYN R+RVK  ++ E   VPS+  I+  ADW+
Sbjct: 81  QSHSRIDFVNEDVDEEYKLCVVYHLLSIKYNMRIRVKCNLSNESLIVPSVTDIFASADWY 140

Query: 113 EREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKK 164
           ERE +D++G+ FEGH DLRRILTDYGF GHP RK FP+ G  ++ YD + KK
Sbjct: 141 EREAYDLFGVLFEGHQDLRRILTDYGFIGHPFRKKFPLIGNTQVTYDPEQKK 192


>gi|190893215|ref|YP_001979757.1| NADH-ubiquinone oxidoreductase, chain C [Rhizobium etli CIAT 652]
 gi|218528027|sp|B3PY58|NUOC2_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit C 2; AltName:
           Full=NADH dehydrogenase I subunit C 2; AltName:
           Full=NDH-1 subunit C 2
 gi|190698494|gb|ACE92579.1| NADH-ubiquinone oxidoreductase protein, chain C [Rhizobium etli
           CIAT 652]
          Length = 187

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 72/115 (62%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           +V  C FL++ P   F  + D+CGVD    + RF+ VYH  S     R+R+K  + +   
Sbjct: 39  IVEFCRFLKEHPAMQFNFLSDICGVDHYPETPRFEAVYHLYSLPNRWRVRIKCRLGDPPE 98

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           VPS+ G++  A+W ERE WDMYGI F GHPDLRRI    GFEG P RKDFP+ G+
Sbjct: 99  VPSVTGVWRTANWHEREAWDMYGIRFAGHPDLRRIYMWEGFEGFPQRKDFPLRGY 153


>gi|156741307|ref|YP_001431436.1| NADH (or F420H2) dehydrogenase subunit C [Roseiflexus castenholzii
           DSM 13941]
 gi|218534318|sp|A7NIW0|NUOC_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|156232635|gb|ABU57418.1| NADH (or F420H2) dehydrogenase, subunit C [Roseiflexus castenholzii
           DSM 13941]
          Length = 174

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 83/124 (66%), Gaps = 1/124 (0%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           G+LS+ V    +V +  FLRDDP   +  + +LCGVD+L R  RF+VVYH LS     R+
Sbjct: 28  GDLSVHVRPERIVDVARFLRDDPELRYHFLENLCGVDYLGREPRFEVVYHLLSFANRHRI 87

Query: 88  RVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
            +K+ V+E   SVPS+  ++PGA++ ERE +DM+GI F GHP L RIL    +EGHPLRK
Sbjct: 88  CLKVGVSERNPSVPSLTELWPGANYHERETFDMFGIVFTGHPCLDRILMPEDWEGHPLRK 147

Query: 147 DFPV 150
           D P+
Sbjct: 148 DVPL 151


>gi|86359328|ref|YP_471220.1| NADH-ubiquinone oxidoreductase chain C protein [Rhizobium etli CFN
           42]
 gi|86283430|gb|ABC92493.1| NADH-ubiquinone oxidoreductase chain C protein [Rhizobium etli CFN
           42]
          Length = 187

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 72/115 (62%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           +V  C FL++ P   F  + D+CGVD    + RF+ VYH  S     R+R+K  + +   
Sbjct: 39  IVEFCRFLKEHPALQFDFLSDVCGVDHYPETPRFEAVYHLYSLPNRWRVRIKCRLGDPPE 98

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           VPS+ G++  A+W ERE WDMYGI F GHPDLRRI    GFEG P RKDFP+ G+
Sbjct: 99  VPSVTGVWRTANWHEREAWDMYGIRFAGHPDLRRIYMWEGFEGFPQRKDFPLRGY 153


>gi|88606841|ref|YP_505106.1| NADH dehydrogenase I, C subunit, truncation [Anaplasma
           phagocytophilum HZ]
 gi|88597904|gb|ABD43374.1| NADH dehydrogenase I, C subunit, truncated [Anaplasma
           phagocytophilum HZ]
          Length = 91

 Score =  117 bits (294), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%)

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHY 158
           +PS+  ++  A WFEREV+DMYGI F  HPDLRRILTDYGF GHP+ KDFP+TG+ E+ Y
Sbjct: 1   MPSVTSVFGSAGWFEREVYDMYGIEFSDHPDLRRILTDYGFRGHPMLKDFPLTGYEEIRY 60

Query: 159 DDKVKKVVYRPVELMQEHRDYDFLSPWEG 187
           D +  KV Y+PV+L Q  R ++ +SPW+G
Sbjct: 61  DFRKGKVAYQPVDLQQNFRLFNSMSPWKG 89


>gi|302035989|ref|YP_003796311.1| NADH-quinone oxidoreductase subunits C and D [Candidatus Nitrospira
           defluvii]
 gi|300604053|emb|CBK40385.1| NADH-quinone oxidoreductase, subunits C and D [Candidatus
           Nitrospira defluvii]
          Length = 583

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 92/153 (60%), Gaps = 6/153 (3%)

Query: 5   IEDLGDYIVNSFSGSVRFAV--NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           ++ L + ++ +F  +VR      +  E++  V    +V +  +L D P   F +I D+C 
Sbjct: 1   MQPLLERLMTTFPDAVRGVEVDTARNEITARVAAARIVDVARWLHDTPEASFDHITDICS 60

Query: 63  VDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYG 121
           VD+ +   RF+VVY  LS  + RR+R+K  V E    + S+ GI+ GA++ EREV+D+ G
Sbjct: 61  VDYPNDPERFEVVYQLLSLAHRRRIRLKARVTEEAPQIASVTGIWKGAEFMEREVYDLMG 120

Query: 122 IFFEGHPDLRRILT--DYGFEGHPLRKDFPVTG 152
           I F GHPDLRRIL   DY  EGHPLRKDFP  G
Sbjct: 121 ITFVGHPDLRRILLPDDYE-EGHPLRKDFPAEG 152


>gi|330465204|ref|YP_004402947.1| NADH dehydrogenase subunit C [Verrucosispora maris AB-18-032]
 gi|328808175|gb|AEB42347.1| NADH dehydrogenase subunit C [Verrucosispora maris AB-18-032]
          Length = 243

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++ D  +    +F  ++   V   GEL+L +    +  +C  +RDDP   F     + GV
Sbjct: 73  EVRDALEEAYPAFGEAIEHVVVDRGELTLHIRPERIAEVCQVMRDDPALRFELCSSVSGV 132

Query: 64  DFL-SRSNRFDVVYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYG 121
           D+L + + R  VVY   S  Y RR+R+++AV+ E   +PS+  +YP ADW ERE +DM+G
Sbjct: 133 DYLGADARRLHVVYQLTSMTYRRRVRLEVAVSVEEPHLPSVTAVYPTADWQEREAYDMFG 192

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
           + F+GHP L RIL    +EGHP RKD+P+ G
Sbjct: 193 VIFDGHPALTRILMPDDWEGHPQRKDYPLGG 223


>gi|11466318|ref|NP_051146.1| NADH dehydrogenase subunit 9 [Cafeteria roenbergensis]
 gi|6180100|gb|AAF05797.1|AF193903_20 NADH dehydrogenase subunit 9 [Cafeteria roenbergensis]
          Length = 210

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 81/124 (65%)

Query: 56  NIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFERE 115
           +++D+   D++    RF + Y  LS  ++ R+ +     + + + S+  I+P A+W ERE
Sbjct: 76  SLVDVACADYIQTQERFLLFYPLLSHSFSLRVGIVTLAHDLEWLSSLCSIFPNANWAERE 135

Query: 116 VWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQE 175
            WDM+G+ F  HPDLRRILTDYGF+GHPLRKDFP+ G++E+ +++ V+ V Y PV +   
Sbjct: 136 AWDMFGVGFLSHPDLRRILTDYGFKGHPLRKDFPLLGYLEVSFNNLVEFVEYLPVSISLS 195

Query: 176 HRDY 179
            R +
Sbjct: 196 PRIF 199


>gi|84494928|ref|ZP_00994047.1| NADH dehydrogenase subunit C [Janibacter sp. HTCC2649]
 gi|84384421|gb|EAQ00301.1| NADH dehydrogenase subunit C [Janibacter sp. HTCC2649]
          Length = 251

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LG     +++ +V   V   GEL+L V    L ++   LRDDP   F     + GV F +
Sbjct: 85  LGKSGDTAYAKAVERVVVDRGELTLHVAREALPTVARALRDDPALRFEICTGVSGVHFPN 144

Query: 68  RSNR-FDVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFE 125
              R    VYH LS  +NRR+R+++   +  + +PSIV  YP ADW ERE WDM+GI FE
Sbjct: 145 EIGRELHAVYHLLSITHNRRVRLEVTAPDDDARIPSIVETYPAADWHERETWDMFGIVFE 204

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           GHP L RIL    + GHP RKD+P+ G 
Sbjct: 205 GHPALTRILMPDDWPGHPQRKDYPLGGI 232


>gi|315501188|ref|YP_004080075.1| NADH (or f420h2) dehydrogenase, subunit c [Micromonospora sp. L5]
 gi|315407807|gb|ADU05924.1| NADH (or F420H2) dehydrogenase, subunit C [Micromonospora sp. L5]
          Length = 243

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 16  FSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL-SRSNRFDV 74
           F  ++   V   GEL+L V    +  +C  +RDD    F  +  + GVD+L ++  R  V
Sbjct: 85  FGDAIEKVVVDRGELTLHVRPERIAEVCQVMRDDLALRFELLSSVSGVDYLGAQERRLHV 144

Query: 75  VYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
           VYH  S  Y R +R+++AV+ E   VPS+  +YP ADW ERE +DM+G+ F+GHP L RI
Sbjct: 145 VYHLTSMTYRRSVRLEVAVSVEEPHVPSVTAVYPTADWQERETYDMFGVVFDGHPALTRI 204

Query: 134 LTDYGFEGHPLRKDFPVTG 152
           L    +EGHP RKD+P+ G
Sbjct: 205 LMPDDWEGHPQRKDYPLGG 223


>gi|218513797|ref|ZP_03510637.1| NADH-ubiquinone oxidoreductase protein, chain C [Rhizobium etli
           8C-3]
          Length = 177

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 71/115 (61%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS 98
           +V  C FL++ P   F  + D+CGVD    + RF+ VYH  S     R+R+K  + +   
Sbjct: 27  IVEFCRFLKEHPAMQFNFLSDICGVDHYPETLRFEAVYHLYSLPNRWRVRIKCRLGDPPE 86

Query: 99  VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           VPS+ G++  A+W ERE WDMYGI F  HPDLRRI    GFEG P RKDFP+ G+
Sbjct: 87  VPSVTGVWRTANWHEREAWDMYGIRFAEHPDLRRIYMWEGFEGFPQRKDFPLRGY 141


>gi|221633755|ref|YP_002522981.1| NADH-quinone oxidoreductase subunit C [Thermomicrobium roseum DSM
           5159]
 gi|221156590|gb|ACM05717.1| nadh-quinone oxidoreductase chain c [Thermomicrobium roseum DSM
           5159]
          Length = 204

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 82/128 (64%), Gaps = 3/128 (2%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD--FLSRSNRFDVVYHFLSPKYNRR 86
           E+++ V    L  +  FLR  P   + ++ D+  VD  +L    RFDVV H  S    +R
Sbjct: 53  EMTIRVARPALRDVVDFLRLHPELRYNHLTDITAVDLLYLRERPRFDVVVHLYSIPRRQR 112

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF-EGHPLR 145
           LRVK  V +G+ VPS+V I+ GA+W ERE +DM+GI FEGHPDLRRIL    + EGHPLR
Sbjct: 113 LRVKCGVDDGEMVPSLVPIFAGANWLERECYDMFGIVFEGHPDLRRILLPEDWDEGHPLR 172

Query: 146 KDFPVTGF 153
           KD+P+ G+
Sbjct: 173 KDYPLRGY 180


>gi|331699310|ref|YP_004335549.1| NAD(P)H-quinone oxidoreductase subunit J [Pseudonocardia
           dioxanivorans CB1190]
 gi|326953999|gb|AEA27696.1| NAD(P)H-quinone oxidoreductase subunit J [Pseudonocardia
           dioxanivorans CB1190]
          Length = 291

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 86/149 (57%), Gaps = 18/149 (12%)

Query: 19  SVRFAVNSV----GELSLDVDCGDLVSLCSFLRDDPH-----CCFVNIIDLCGVDFLSRS 69
             R A+  V    GE++  +    ++ +C  LRDDP      C  V+ +D  GVD     
Sbjct: 128 GTRGAIQQVTIDRGEITFYIAAERILEVCRTLRDDPSLRYELCSAVSAVDY-GVDV---P 183

Query: 70  NRFDVVYHFLSPKYNRRLRVKIAV-----AEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
            R  VVYH LS  Y RR+R+++A+     AE   +PS+V +YP ADW ERE WDM+GI F
Sbjct: 184 QRLHVVYHLLSMTYRRRIRLEVALDWAGGAENPHLPSVVEVYPTADWHERETWDMFGIVF 243

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           +GHP L RIL    ++GHP RKD+P+ G 
Sbjct: 244 DGHPALTRILMPDDWDGHPQRKDYPLGGI 272


>gi|291298800|ref|YP_003510078.1| NADH (or F420H2) dehydrogenase subunit C [Stackebrandtia
           nassauensis DSM 44728]
 gi|290568020|gb|ADD40985.1| NADH (or F420H2) dehydrogenase, subunit C [Stackebrandtia
           nassauensis DSM 44728]
          Length = 213

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 95/160 (59%), Gaps = 7/160 (4%)

Query: 10  DYIVNSFSGSVRF-AVNSV----GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           D +V+S S  V   A+ +V    GEL++ V    + ++C  LRD  +  F     + GVD
Sbjct: 44  DELVDSLSSEVDTDAIQAVVVDRGELTIHVAPNRVKAVCQALRDSENLRFELCNSVSGVD 103

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYGIF 123
           +  ++NR  V YH  S  + RR+RV+ AV+ E   V S+  +YP ADW ERE +DM+G+ 
Sbjct: 104 YPEQTNRLHVTYHLTSMTFRRRVRVETAVSIEDPHVDSVTEVYPTADWQERETYDMFGVV 163

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGF-VELHYDDKV 162
           F+GHP+L RIL    ++GHP RKD+P+ G  VE   D ++
Sbjct: 164 FDGHPNLTRILMPDDWQGHPQRKDYPLGGIPVEYKNDAEI 203


>gi|302864903|ref|YP_003833540.1| NADH (or F420H2) dehydrogenase subunit C [Micromonospora aurantiaca
           ATCC 27029]
 gi|302567762|gb|ADL43964.1| NADH (or F420H2) dehydrogenase, subunit C [Micromonospora
           aurantiaca ATCC 27029]
          Length = 243

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 16  FSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL-SRSNRFDV 74
           F  ++   V   GEL+L V    +  +C  +RDD    F     + GVD+L ++  R  V
Sbjct: 85  FGDAIEKVVVDRGELTLHVRPERIAEVCQVMRDDLALRFELCSSVSGVDYLGAQERRLHV 144

Query: 75  VYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
           VYH  S  Y R +R+++AV+ E   VPS+  +YP ADW ERE +DM+G+ F+GHP L RI
Sbjct: 145 VYHLTSMTYRRSVRLEVAVSVEEPHVPSVTAVYPTADWQERETYDMFGVVFDGHPALTRI 204

Query: 134 LTDYGFEGHPLRKDFPVTG 152
           L    +EGHP RKD+P+ G
Sbjct: 205 LMPDDWEGHPQRKDYPLGG 223


>gi|238062213|ref|ZP_04606922.1| NADH dehydrogenase subunit C [Micromonospora sp. ATCC 39149]
 gi|237884024|gb|EEP72852.1| NADH dehydrogenase subunit C [Micromonospora sp. ATCC 39149]
          Length = 243

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 16  FSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL-SRSNRFDV 74
           F  ++   V   GEL+L V    +  +C  +RDD    F     + GVD+L +   R  V
Sbjct: 85  FGDAIEKVVVDRGELTLHVRPERIAEVCQVMRDDLALRFELCSSVSGVDYLGADERRLHV 144

Query: 75  VYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
           VY   S  Y RR+R++ AV AE   +PS+  +YP ADW ERE +DM+GI F+GHP+L RI
Sbjct: 145 VYQLTSMTYRRRVRLETAVSAEAPHLPSVTAVYPTADWQERETYDMFGIVFDGHPNLTRI 204

Query: 134 LTDYGFEGHPLRKDFPVTG 152
           L    +EGHP RKD+P+ G
Sbjct: 205 LMPDDWEGHPQRKDYPLGG 223


>gi|330958157|gb|EGH58417.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 593

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F   S   G   L VD   LV + +FLR  P   +  + DL GVD   R++
Sbjct: 23  LNNRFGAEAFTAQSTRTGMPVLWVDRARLVEILTFLRQLPKP-YSMLYDLHGVDERLRTH 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I GI+P A+W+EREVWDM+GI
Sbjct: 82  RRDLPAADFTVFYHLLSVERNSDVMIKVALSERDLSVPTITGIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLTRIMMPPTWEGHPLRKDFPA 169


>gi|206891078|ref|YP_002248749.1| NADH-quinone oxidoreductase chain c [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206743016|gb|ACI22073.1| NADH-quinone oxidoreductase chain c [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 177

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS-RSN 70
           I + FS  V + +    E S+ V    +  + S L++ P   F  +IDL  VD+L  R  
Sbjct: 10  IRDKFSDEVLWFICFRDECSIVVKKEKIKDILSHLKNTPELEFDYLIDLTAVDYLGFREP 69

Query: 71  RFDVVYHFLSPKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
           RFDVVYH +S K+  R+R+K  V E G  + S+  ++  A+WFERE +DM+GI F GHPD
Sbjct: 70  RFDVVYHLMSIKHKHRIRIKAQVPEQGCCIDSVADLWATANWFERECYDMFGIEFTGHPD 129

Query: 130 LRRILTDYGFEGHPLRKDFPVTG 152
           LRRIL    + G PLRKD+PV  
Sbjct: 130 LRRILMPEDWNGFPLRKDYPVKS 152


>gi|317051069|ref|YP_004112185.1| NADH (or F420H2) dehydrogenase subunit C [Desulfurispirillum
           indicum S5]
 gi|316946153|gb|ADU65629.1| NADH (or F420H2) dehydrogenase, subunit C [Desulfurispirillum
           indicum S5]
          Length = 177

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 91/152 (59%), Gaps = 5/152 (3%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           ++++   + +SFS  ++      G+ ++ VD   +V + + L++DP   F  ++D+  VD
Sbjct: 1   MQEVISRLQSSFSSHIKEVTEYRGQKTVVVDSDAIVDVLALLKNDPELNFQFLLDITVVD 60

Query: 65  FL----SRSNRFDVVYHFLSPKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDM 119
           +L     +  RF VVY   S + N+ L VK  VA+  K VPS+ G++  A+W ERE +D 
Sbjct: 61  YLLYPQRKEARFAVVYMLRSWETNKLLVVKTYVADPQKGVPSVTGLWKSANWAEREAYDQ 120

Query: 120 YGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           YG+ F GHP L+R+L    F GHPLRKD+P+T
Sbjct: 121 YGVHFSGHPMLKRLLNHKEFIGHPLRKDYPIT 152


>gi|70731258|ref|YP_260999.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas fluorescens Pf-5]
 gi|123654429|sp|Q4K9T4|NUOCD_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|68345557|gb|AAY93163.1| NADH-quinone oxidoreductase, C/D subunit [Pseudomonas fluorescens
           Pf-5]
          Length = 593

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G   F   +   G   L V    LV + +FLR+ P   +V + DL GVD   R+ 
Sbjct: 23  LNNRFGPEAFTAQATRTGMPVLWVTRSKLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTK 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++EG  S+P++ GI+P A+W+EREVWDM+GI
Sbjct: 82  RQGLPGADFSVFYHLLSIERNSDVMIKVALSEGDLSLPTVTGIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFAGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|328953789|ref|YP_004371123.1| NAD(P)H-quinone oxidoreductase subunit J [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454113|gb|AEB09942.1| NAD(P)H-quinone oxidoreductase subunit J [Desulfobacca acetoxidans
           DSM 11109]
          Length = 152

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (59%), Gaps = 3/129 (2%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           G+ ++ V    LV +C FLRDDP   F  +  + GVD+   S RF   YH  S +   R+
Sbjct: 24  GDATVTVKPEKLVEICEFLRDDPETSFRYLSSVSGVDYHPASPRFAATYHLYSHQNRNRI 83

Query: 88  RVKIAVA--EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEG-HPL 144
            +K   A  +  ++PS+V ++  ADW ERE +D+ GI F GHPDLRRILT    EG HPL
Sbjct: 84  ALKAFCANDDAPALPSVVSVWSTADWHEREAYDLVGIKFSGHPDLRRILTPPECEGYHPL 143

Query: 145 RKDFPVTGF 153
           RKD+P  G+
Sbjct: 144 RKDYPQEGY 152


>gi|326572774|gb|EGE22760.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis BC7]
          Length = 582

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|326567655|gb|EGE17763.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis 12P80B1]
 gi|326569466|gb|EGE19526.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis BC8]
          Length = 582

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|261856548|ref|YP_003263831.1| NADH (or F420H2) dehydrogenase, subunit C [Halothiobacillus
           neapolitanus c2]
 gi|261837017|gb|ACX96784.1| NADH (or F420H2) dehydrogenase, subunit C [Halothiobacillus
           neapolitanus c2]
          Length = 244

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 107/207 (51%), Gaps = 50/207 (24%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           LGD +VN           ++ E++++V       +   L   P   F   +DLCG+D+L 
Sbjct: 19  LGDLLVN--------LTVALDEITIEVAAAHWQEVAKRLASAPETHFDQCVDLCGIDYLE 70

Query: 68  -----------------------------------RSN-----RFDVVYHFLSPKYNRRL 87
                                              RS      RF VV H LS K+N R+
Sbjct: 71  FGRQEWAGEESVSYAGYSRGVEPASNARLKFGDEMRSGNQDRPRFAVVAHLLSYKHNWRV 130

Query: 88  RVKIAV--AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           RV+I    AE  +VPS+V ++P  +WFERE +D++GI F+ HPD+RRILTDYGF GHP+R
Sbjct: 131 RVRIPCVDAELPTVPSVVSVWPVVNWFEREAFDLFGILFDDHPDMRRILTDYGFVGHPMR 190

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVEL 172
           KDFP+ G VE+ +D +  +VVY PV +
Sbjct: 191 KDFPLIGNVEVRFDPEKNRVVYEPVSI 217


>gi|296130549|ref|YP_003637799.1| NADH (or F420H2) dehydrogenase, subunit C [Cellulomonas flavigena
           DSM 20109]
 gi|296022364|gb|ADG75600.1| NADH (or F420H2) dehydrogenase, subunit C [Cellulomonas flavigena
           DSM 20109]
          Length = 309

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 79/142 (55%), Gaps = 2/142 (1%)

Query: 14  NSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-F 72
             F+ +V   V   GEL+L+V    LV +   LRDDP   F   + + GV F   + R  
Sbjct: 149 TGFANAVESVVVDRGELTLNVAREHLVEVVQQLRDDPDLRFELSLGVSGVHFPHDAGREL 208

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
             VY  +S  + RRLR+++AV EG   VPS   +YP  DW ERE WD +GI F+GHP L 
Sbjct: 209 HAVYQIVSVTHGRRLRLEVAVPEGDPHVPSTTAVYPANDWHERETWDFFGIVFDGHPGLA 268

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI     + GHP RKD+P+ G 
Sbjct: 269 RIQMPDDWPGHPQRKDYPLGGI 290


>gi|326561155|gb|EGE11520.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis 7169]
          Length = 582

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 80/128 (62%), Gaps = 8/128 (6%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLS 80
           G  ++ V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S
Sbjct: 30  GIPTIWVACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMS 88

Query: 81  PKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
            + N  +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +E
Sbjct: 89  LERNSDIRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWE 148

Query: 141 GHPLRKDF 148
           GHPLRK++
Sbjct: 149 GHPLRKEY 156


>gi|326567953|gb|EGE18050.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis BC1]
          Length = 582

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRRGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|326577450|gb|EGE27334.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis O35E]
          Length = 582

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|118579069|ref|YP_900319.1| NADH (or F420H2) dehydrogenase subunit C [Pelobacter propionicus
           DSM 2379]
 gi|118580048|ref|YP_901298.1| NADH (or F420H2) dehydrogenase subunit C [Pelobacter propionicus
           DSM 2379]
 gi|118581592|ref|YP_902842.1| NADH (or F420H2) dehydrogenase subunit C [Pelobacter propionicus
           DSM 2379]
 gi|118501779|gb|ABK98261.1| NADH dehydrogenase subunit C [Pelobacter propionicus DSM 2379]
 gi|118502758|gb|ABK99240.1| NADH dehydrogenase subunit C [Pelobacter propionicus DSM 2379]
 gi|118504302|gb|ABL00785.1| NADH dehydrogenase subunit C [Pelobacter propionicus DSM 2379]
          Length = 154

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 25  NSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYN 84
           +S G L L+ D G ++ L + L+      F  ++D+ GVD+  R  RFDVVYH  SP+ N
Sbjct: 19  DSHGMLVLETDAGRILPLITRLKRS--FYFDLLLDITGVDYPERDPRFDVVYHLYSPRNN 76

Query: 85  RRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHP 143
            R+R+K+ V E + +VP++ G+Y  A + EREV +MYGI   G+ DLR IL   GFEGHP
Sbjct: 77  VRVRIKVPVTEAEPNVPTLTGLYGSARYIEREVHEMYGIVSIGNDDLRPILLYEGFEGHP 136

Query: 144 LRKDFPV 150
           LRKD+P+
Sbjct: 137 LRKDYPI 143


>gi|326559971|gb|EGE10369.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis 46P47B1]
          Length = 522

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 80/128 (62%), Gaps = 8/128 (6%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLS 80
           G  ++ V C +L+ +  FLR  P   FV ++DL  +D   R  R       F V YH +S
Sbjct: 30  GIPTIWVACDELLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMS 88

Query: 81  PKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
            + N  +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +E
Sbjct: 89  LERNSDIRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWE 148

Query: 141 GHPLRKDF 148
           GHPLRK++
Sbjct: 149 GHPLRKEY 156


>gi|162448794|ref|YP_001611161.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
 gi|161159376|emb|CAN90681.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
          Length = 217

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 90/157 (57%), Gaps = 9/157 (5%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M +K+ +L   +   F G+V    +  G+ +  +D         FLR+DP       +DL
Sbjct: 1   MSKKVLEL---LTAQFPGAVLETHSQFGDDTAVLDPAVWRDAALFLRNDPRTLMNMFVDL 57

Query: 61  CGVDFLSRSN--RFDVVYHFLSPKYNRRLRVKIAVAE----GKSVPSIVGIYPGADWFER 114
             VD+L R +  RF+VV H  S + N R+R+K  V +    G  + SIV ++ GA+WFER
Sbjct: 58  TAVDYLWRGDVPRFEVVCHLRSLERNHRIRIKARVGDEEGNGAEIDSIVPVWKGANWFER 117

Query: 115 EVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           E +D+ GI F+GHPDLRRIL    FEGHPLRKD+P  
Sbjct: 118 ECYDLLGIVFKGHPDLRRILMYPEFEGHPLRKDYPAN 154


>gi|73989394|ref|XP_853570.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S protein
           3, 30kDa (NADH-coenzyme Q reductase) [Canis familiaris]
          Length = 209

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 82/145 (56%), Gaps = 1/145 (0%)

Query: 3   RKIEDLGDYIVNSFSGSVR-FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLC 61
           +++   G+Y+       V+   V    EL + +    ++ + +FLRD     F ++ DL 
Sbjct: 51  KQLSAFGEYVAEILPKYVQQVQVFCFNELEICIHPDGVIPVLTFLRDHTSAPFQSLADLT 110

Query: 62  GVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYG 121
            VD  +  N F++VY+ LS ++N  + V+    E   +   V +Y  A+W+ RE+WD++G
Sbjct: 111 AVDIPTWQNHFEIVYNLLSLRFNSWICVRTYTDELTPIEFTVSVYKAANWYVREIWDLFG 170

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRK 146
           +FF  HPDLRR LTDYGFEGHP R 
Sbjct: 171 VFFANHPDLRRTLTDYGFEGHPFRT 195


>gi|24213593|ref|NP_711074.1| NADH dehydrogenase (ubiquinone) chain C [Leptospira interrogans
           serovar Lai str. 56601]
 gi|24194385|gb|AAN48092.1| NADH dehydrogenase (ubiquinone) chain C [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 178

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 94/155 (60%), Gaps = 4/155 (2%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           M  K+E         F  S    +++V    L V+   +VS+ + L++DP   +  + DL
Sbjct: 1   MKEKVESFLKEKFPHFLDSQEEVISNVPVFFLKVEG--IVSVLTALKNDPTLHYNFLNDL 58

Query: 61  CGVDFLSRSN-RFDVVYHFLSP-KYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWD 118
             VD+L +   RF+V Y   S  K + ++R+K+ + +G+SVPSI  ++ GADW EREV+D
Sbjct: 59  TAVDWLGKKEPRFEVNYLLRSENKASSKIRIKVRLEDGESVPSITSVFKGADWPEREVYD 118

Query: 119 MYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           ++GI F GHP+L RIL    F+GHPLRKDFP+ GF
Sbjct: 119 LFGISFIGHPNLDRILMPDNFQGHPLRKDFPLEGF 153


>gi|226944920|ref|YP_002799993.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Azotobacter vinelandii DJ]
 gi|259514699|sp|C1DL16|NUOCD_AZOVD RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|226719847|gb|ACO79018.1| NADH-ubiquinone oxidoreductase, chain cd [Azotobacter vinelandii
           DJ]
          Length = 593

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 100/192 (52%), Gaps = 22/192 (11%)

Query: 13  VNSFSGSVRFAVNSVGE--LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +NS  G+  F V S       L V    L+ +  FLR+ P   +V + DL GVD   R+ 
Sbjct: 23  LNSRFGAETFTVQSTCTDMPVLWVAREKLIEVLRFLRNLPRP-YVMLYDLHGVDERLRTQ 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A+ EG   +PS  GI+P A+W+ERE+WDMYGI
Sbjct: 82  RRGLPEADFSVFYHLLSIERNSDVMIKVALKEGDLKLPSATGIWPNANWYEREIWDMYGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVELMQ- 174
             EGHP L RIL    +EGHPLRKD+P                D + + + ++P E    
Sbjct: 142 HIEGHPHLTRILMPPTWEGHPLRKDYPARATEFDPYSLSAAKQDLEQEALRFKPEEWGMK 201

Query: 175 ---EHRDYDFLS 183
              EH D+ FL+
Sbjct: 202 RGGEHEDFMFLN 213


>gi|284009322|emb|CBA76483.1| NADH-quinone oxidoreductase chain C/D [Arsenophonus nasoniae]
          Length = 614

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 68/191 (35%), Positives = 105/191 (54%), Gaps = 23/191 (12%)

Query: 14  NSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           N FS    F + S   G L + +    L+++  FL+  P   +V + DL GVD   R  R
Sbjct: 46  NQFSPDA-FTIQSTRTGMLVIWIKREQLLAVIEFLKKQPKP-YVMLFDLHGVDERQRVYR 103

Query: 72  -------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIF 123
                  F V YH +S + NR + +K+A++E   +VPS+V ++P A+W+EREVWDM+GI 
Sbjct: 104 HGLPDADFSVFYHLISIERNRDIMLKVALSEKDLNVPSLVSLFPNANWYEREVWDMFGIT 163

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVEL---- 172
           F GHP+LRR+L    ++GHPL KD+P            +   D +++ + ++P E     
Sbjct: 164 FTGHPNLRRLLMPVTWQGHPLCKDYPARATEFDPFVLTKQKLDLEMESLTFKPEEWGMAR 223

Query: 173 MQEHRDYDFLS 183
             EH D+ FL+
Sbjct: 224 GNEHEDFMFLN 234


>gi|159039973|ref|YP_001539226.1| NADH dehydrogenase subunit C [Salinispora arenicola CNS-205]
 gi|218534344|sp|A8M620|NUOC_SALAI RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|157918808|gb|ABW00236.1| NADH (or F420H2) dehydrogenase, subunit C [Salinispora arenicola
           CNS-205]
          Length = 245

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++ D  +    +F  ++   V   GEL+L +    +  +C  LRDD    F     + GV
Sbjct: 75  EVADALEEAYPAFGEAIEKVVVDRGELTLHIRPERIAEVCQVLRDDLALRFELCSSVSGV 134

Query: 64  DFL-SRSNRFDVVYHFLSPKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYG 121
           D+L + + R   VY   S  Y R++R++ AV+ E   +PS+ G+YP ADW ERE +DM+G
Sbjct: 135 DYLGADARRLHAVYQLTSMTYRRQIRLEAAVSVEDPHLPSVTGVYPTADWQEREAYDMFG 194

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
           I F+GHP L RIL    +EGHP RKD+P+ G
Sbjct: 195 IVFDGHPGLTRILMPDDWEGHPQRKDYPLGG 225


>gi|189218227|ref|YP_001938869.1| NADH dehydrogenase subunit C [Methylacidiphilum infernorum V4]
 gi|189185085|gb|ACD82270.1| NADH dehydrogenase subunit C [Methylacidiphilum infernorum V4]
          Length = 213

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (58%), Gaps = 3/146 (2%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           L + I   FS  +       GE +L +D   +  +  +L+++    F  ++D+ GVD   
Sbjct: 8   LAEEIQKVFSIKLLEVKEFRGEWTLVMDLSIIQQVARYLKEE--KGFGLLLDISGVDHWG 65

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFEG 126
              RF+VVYHF + +    LRVK  V+E    VP++  IYP A+W ERE +DM+GI FEG
Sbjct: 66  EEPRFEVVYHFYNLQKATLLRVKGRVSEANPIVPTLSFIYPTANWHEREAYDMFGIIFEG 125

Query: 127 HPDLRRILTDYGFEGHPLRKDFPVTG 152
           HPDLRRIL   G+  +PLRKDFPV G
Sbjct: 126 HPDLRRILMWEGYPYYPLRKDFPVEG 151


>gi|296112933|ref|YP_003626871.1| NADH-quinone oxidoreductase subunit C/D [Moraxella catarrhalis RH4]
 gi|295920626|gb|ADG60977.1| NADH-quinone oxidoreductase subunit C/D [Moraxella catarrhalis RH4]
          Length = 582

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V C +L+ +  FLR  P   F  ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VACDELLDVLLFLRTLPKP-FAMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|317123847|ref|YP_004097959.1| NADH dehydrogenase subunit C [Intrasporangium calvum DSM 43043]
 gi|315587935|gb|ADU47232.1| NADH dehydrogenase subunit C [Intrasporangium calvum DSM 43043]
          Length = 273

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 3/142 (2%)

Query: 15  SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR-SNRFD 73
           SF  +V   V   GE++++V    LV++   LRDDP   F     + GV +  R      
Sbjct: 113 SFGEAVAAVVIDRGEMTINVHREHLVAVARALRDDPALRFEICTGVSGVHYPDRVGEELH 172

Query: 74  VVYHFLSPKY-NRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
            VYHFLS  + +RR+RV+++  E  + +PSIV +YP  DW ERE WDM+GI F+GHP L 
Sbjct: 173 AVYHFLSITHGSRRIRVEVSCPEEDRHIPSIVEVYPANDWHERETWDMFGIEFDGHPALT 232

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           R+L    + GHP RKD+P+ G 
Sbjct: 233 RVLMPDDWPGHPQRKDYPLGGI 254


>gi|109140506|ref|XP_001118707.1| PREDICTED: NADH-quinone oxidoreductase subunit C/D-like, partial
           [Macaca mulatta]
          Length = 178

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 81/136 (59%), Gaps = 10/136 (7%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR--------FDVV 75
               G   L V    LV + SFLR+ P   +V + DL GVD   R+ R        F V 
Sbjct: 36  ATRTGMPVLWVARARLVEVLSFLRNLPKP-YVMLYDLHGVDERLRTKRQGLPSGADFTVF 94

Query: 76  YHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
           YH +S + N  + +K+A++E   SVP++ GI+P A+W+EREVWDM+GI F GHP L RI+
Sbjct: 95  YHLMSLERNSDVMIKVALSESDLSVPTVTGIWPNANWYEREVWDMFGIDFPGHPHLTRIM 154

Query: 135 TDYGFEGHPLRKDFPV 150
               +EGHPLRKDFP 
Sbjct: 155 MPPTWEGHPLRKDFPA 170


>gi|302130364|ref|ZP_07256354.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 189

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPQP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|330810465|ref|YP_004354927.1| NADH-quinone oxidoreductase subunit C/D [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327378573|gb|AEA69923.1| NADH-quinone oxidoreductase subunit C/D [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 593

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 81/132 (61%), Gaps = 9/132 (6%)

Query: 27  VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFL 79
            G   L V    LV + +FLR+ P   +V + DL GVD   R+ R       F V YH +
Sbjct: 39  TGMPVLWVARAKLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTKRQGLPDGVFTVFYHLM 97

Query: 80  SPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           S + N  + +K+A++E   SVP++ GI+P A+W+EREVWDM+GI F GHP L RI+    
Sbjct: 98  SIERNSDVMIKVALSESDLSVPTVTGIWPNANWYEREVWDMFGIDFPGHPHLTRIMMPPT 157

Query: 139 FEGHPLRKDFPV 150
           +EGHPLRKDFP 
Sbjct: 158 WEGHPLRKDFPA 169


>gi|269836327|ref|YP_003318555.1| NADH (or F420H2) dehydrogenase, subunit C [Sphaerobacter
           thermophilus DSM 20745]
 gi|269785590|gb|ACZ37733.1| NADH (or F420H2) dehydrogenase, subunit C [Sphaerobacter
           thermophilus DSM 20745]
          Length = 202

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (60%), Gaps = 3/130 (2%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS--RSNRFDVVYHFLSPKYNRR 86
           E+++ V+      +  FLRD P   +  + D   VD L      RFDV+    S +   R
Sbjct: 53  EMTIRVERPRFRDVIQFLRDHPDLQYTMLSDETAVDMLRLRPDPRFDVLAQLYSIRRRWR 112

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF-EGHPLR 145
           LRVK  V +G+ VPS+V ++  A W EREV+DM+GI FEGHPDLRRIL    + EGHPLR
Sbjct: 113 LRVKCGVNDGEVVPSLVPVFAAAGWLEREVYDMFGIVFEGHPDLRRILLPEDWDEGHPLR 172

Query: 146 KDFPVTGFVE 155
           KD+P+ G+ E
Sbjct: 173 KDYPLRGYRE 182


>gi|156363158|ref|XP_001625914.1| predicted protein [Nematostella vectensis]
 gi|156212769|gb|EDO33814.1| predicted protein [Nematostella vectensis]
          Length = 95

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 60/83 (72%)

Query: 109 ADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYR 168
            DW     WDMYG+FF  HPDLRRILTDYGFEGHP RKDFPV G+VE+ YDD++K++V  
Sbjct: 11  QDWICHPGWDMYGVFFSNHPDLRRILTDYGFEGHPFRKDFPVQGYVEVRYDDELKRLVCE 70

Query: 169 PVELMQEHRDYDFLSPWEGVNSL 191
           P+E+ QE+R +D    WE   + 
Sbjct: 71  PIEMAQEYRKFDISPTWEQFPTF 93


>gi|188026169|ref|ZP_02961127.2| hypothetical protein PROSTU_03121 [Providencia stuartii ATCC 25827]
 gi|188021886|gb|EDU59926.1| hypothetical protein PROSTU_03121 [Providencia stuartii ATCC 25827]
          Length = 599

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 95/165 (57%), Gaps = 20/165 (12%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ +  FL+  P   +V + DL GVD   R +R       F V YH +S   NR + +K
Sbjct: 56  QLLEVVDFLKKLPKP-YVMLFDLHGVDERQRIHRQGLPEADFSVFYHLISIDRNRDIMLK 114

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A+ E   +VPSIV ++P A+W+EREVWDM+GI F+GHP+LRR+L    +EGHPLRKD+P
Sbjct: 115 VALNEKDLNVPSIVSLFPNANWYEREVWDMFGITFQGHPNLRRLLMSPSWEGHPLRKDYP 174

Query: 150 VTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFLS 183
                       +   D +++ + ++P E       E+ D+ FL+
Sbjct: 175 ARATEFDPFELTKQKQDLEMEALTFKPEEWGMARGNENEDFMFLN 219


>gi|71735882|ref|YP_275281.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|123635949|sp|Q48H52|NUOCD_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|71556435|gb|AAZ35646.1| NADH-quinone oxidoreductase, C/D subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 593

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNTHFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|229591255|ref|YP_002873374.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas fluorescens SBW25]
 gi|259514715|sp|C3JY83|NUOCD_PSEFS RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|229363121|emb|CAY50140.1| NADH dehydrogenase I chain C/D [Pseudomonas fluorescens SBW25]
          Length = 594

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR--------FDVV 75
               G   L V    LV + +FLR+ P   +V + DL GVD   R+ R        F V 
Sbjct: 36  ATRTGMPVLWVARAKLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTKRQGLPSGADFTVF 94

Query: 76  YHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
           YH LS + N  + +K+A++E   SVP++ GI+P A W+EREVWDM+GI F GHP L RI+
Sbjct: 95  YHLLSIERNSDVMIKVALSESDLSVPTVTGIWPNASWYEREVWDMFGIDFPGHPHLTRIM 154

Query: 135 TDYGFEGHPLRKDFPV 150
               +EGHPLRKDFP 
Sbjct: 155 MPPTWEGHPLRKDFPA 170


>gi|320323790|gb|EFW79874.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327929|gb|EFW83934.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 593

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNTHFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|145596574|ref|YP_001160871.1| NADH dehydrogenase subunit C [Salinispora tropica CNB-440]
 gi|226737324|sp|A4XC36|NUOC_SALTO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|145305911|gb|ABP56493.1| NADH (or F420H2) dehydrogenase, subunit C [Salinispora tropica
           CNB-440]
          Length = 245

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 4   KIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGV 63
           ++ D  +    +F  ++   V   GEL+L +    +  +C  +RDD    F     + GV
Sbjct: 75  EVADALEEAYPAFGEAIEKVVVDRGELTLHIRPERIAEVCQVMRDDLSLRFELCSSVSGV 134

Query: 64  DFL-SRSNRFDVVYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYG 121
           D+L + + R  VVY   S  Y R++R++ AV AE   +PS+  +YP ADW ERE +DM+G
Sbjct: 135 DYLGADACRLHVVYQLTSMTYRRQVRLEAAVSAENPHLPSVTSVYPTADWQERETYDMFG 194

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTG 152
           + F+GHP L RIL    +EGHP RKD+P+ G
Sbjct: 195 VIFDGHPGLTRILMPDDWEGHPQRKDYPLGG 225


>gi|116619254|ref|YP_821410.1| NADH (or F420H2) dehydrogenase subunit C [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116222416|gb|ABJ81125.1| NADH (or F420H2) dehydrogenase, subunit C [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 157

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 84/134 (62%), Gaps = 3/134 (2%)

Query: 20  VRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFL 79
           VR    + GEL+L++    + S+C FL+ D    FV +  +  VD      RF++VYH  
Sbjct: 23  VRGGKVTFGELTLEIAVPKIASICGFLKYDQK--FVRVSTVTAVDRYPAEPRFEIVYHLH 80

Query: 80  SPKYNRRLRVKIAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYG 138
           S + N+R+R+K  +     V  S+ G++ GA W+EREV+D++G+ F  HPDLRRIL    
Sbjct: 81  SIERNQRVRLKALLPGADPVIESVTGVWRGAGWYEREVFDLFGVRFLNHPDLRRILMPDD 140

Query: 139 FEGHPLRKDFPVTG 152
           +EG+PLRKD+PVTG
Sbjct: 141 WEGYPLRKDYPVTG 154


>gi|284992923|ref|YP_003411477.1| NADH (or F420H2) dehydrogenase subunit C [Geodermatophilus obscurus
           DSM 43160]
 gi|284066168|gb|ADB77106.1| NADH (or F420H2) dehydrogenase, subunit C [Geodermatophilus
           obscurus DSM 43160]
          Length = 245

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 10/153 (6%)

Query: 15  SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN---- 70
           ++  +V+  +   GE++  V    L++L   LRDD    F     + GVD+L        
Sbjct: 79  TYDAAVQRVLVDRGEITYFVAREHLLTLVRALRDDEALRFELCSSVSGVDYLDSGGPAAG 138

Query: 71  ----RFDVVYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
               R  VV H  S  Y RR+R+++AV AE   VPS+  +YP ADW ERE WDM+GI F+
Sbjct: 139 PGRPRLHVVLHLTSMTYRRRIRLEVAVTAEDPHVPSVTSVYPTADWHERETWDMFGIVFD 198

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGF-VELH 157
           GHP L RIL    ++GHP RKD+P+ G  VE H
Sbjct: 199 GHPALTRILMPDDWDGHPQRKDYPLGGVPVEYH 231


>gi|213970033|ref|ZP_03398165.1| NADH dehydrogenase I, C/D subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|301381388|ref|ZP_07229806.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. tomato Max13]
 gi|302062159|ref|ZP_07253700.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. tomato K40]
 gi|213925137|gb|EEB58700.1| NADH dehydrogenase I, C/D subunit [Pseudomonas syringae pv. tomato
           T1]
          Length = 593

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPQP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|257485441|ref|ZP_05639482.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330987944|gb|EGH86047.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331010725|gb|EGH90781.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 593

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNTRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|330889658|gb|EGH22319.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. mori str. 301020]
          Length = 593

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNTRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|193215670|ref|YP_001996869.1| NADH (or F420H2) dehydrogenase subunit C [Chloroherpeton thalassium
           ATCC 35110]
 gi|193089147|gb|ACF14422.1| NADH (or F420H2) dehydrogenase, subunit C [Chloroherpeton
           thalassium ATCC 35110]
          Length = 177

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 87/142 (61%), Gaps = 3/142 (2%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           + ++F  ++        EL+  V   ++  +  FL+++    F   +D+CG D  +   R
Sbjct: 9   LQSAFPKALLETTKFRNELTFRVKKENIREISQFLKEE--LGFNLCVDICGADRFNEEPR 66

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIFFEGHPDL 130
           F+V+Y+ ++ ++N R+R+K+ + E K  +PS++ ++P ADW+ERE +DM+GI F  HPD+
Sbjct: 67  FEVIYNLMNLEHNTRIRLKVWLEEAKPHLPSVISVWPAADWYERETYDMFGIVFVNHPDM 126

Query: 131 RRILTDYGFEGHPLRKDFPVTG 152
           RRI     FE  P+RK+FP+ G
Sbjct: 127 RRIYMPEDFEYFPMRKEFPLVG 148


>gi|282600310|ref|ZP_05973799.2| NADH-quinone oxidoreductase, C/D subunit [Providencia rustigianii
           DSM 4541]
 gi|282565808|gb|EFB71343.1| NADH-quinone oxidoreductase, C/D subunit [Providencia rustigianii
           DSM 4541]
          Length = 600

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 94/165 (56%), Gaps = 20/165 (12%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ +  FL+  P   +V + DL GVD   R +R       F V YH +S   NR + +K
Sbjct: 57  QLLEVVDFLKKLPKP-YVMLFDLHGVDERQRIHRQGLPEADFSVFYHLISIDRNRDIMLK 115

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A+ E   +VPSIV ++P A+W EREVWDM+GI F+GHP+LRR+L    +EGHPLRKD+P
Sbjct: 116 VALNENDLNVPSIVSLFPNANWHEREVWDMFGITFQGHPNLRRLLMSPNWEGHPLRKDYP 175

Query: 150 VTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFLS 183
                       +   D +++ + ++P E       E+ D+ FL+
Sbjct: 176 ARATEFDPFVLTKQKQDLEMEALTFKPEEWGMSRGNENEDFMFLN 220


>gi|312961688|ref|ZP_07776186.1| NADH-quinone oxidoreductase subunit C/D [Pseudomonas fluorescens
           WH6]
 gi|311283947|gb|EFQ62530.1| NADH-quinone oxidoreductase subunit C/D [Pseudomonas fluorescens
           WH6]
          Length = 576

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR--------FDVV 75
               G   L V    LV + +FLR+ P   +V + DL GVD   R+ R        F V 
Sbjct: 18  ATRTGMPVLWVARARLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTKRQGLPSGADFTVF 76

Query: 76  YHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
           YH +S + N  + +K+A++E   SVP++ GI+P A W+EREVWDM+GI F GHP L RI+
Sbjct: 77  YHLMSLERNSDVMIKVALSESDLSVPTVTGIWPNASWYEREVWDMFGIDFPGHPHLTRIM 136

Query: 135 TDYGFEGHPLRKDFPV 150
               +EGHPLRKDFP 
Sbjct: 137 MPPTWEGHPLRKDFPA 152


>gi|77459827|ref|YP_349334.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas fluorescens Pf0-1]
 gi|123604055|sp|Q3KA61|NUOCD_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|77383830|gb|ABA75343.1| NADH dehydrogenase subunit D / NADH dehydrogenase subunit C
           [Pseudomonas fluorescens Pf0-1]
          Length = 594

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/149 (41%), Positives = 87/149 (58%), Gaps = 12/149 (8%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V    LV + +FLR+ P   +V + DL GVD   R+ 
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVARAKLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTK 81

Query: 71  R--------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYG 121
           R        F V YH +S + N  + +K+A++E   S+P++  I+P A+W+EREVWDMYG
Sbjct: 82  RQGLPSGADFTVFYHLMSLERNSDVMIKVALSESDLSLPTVTSIWPNANWYEREVWDMYG 141

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPV 150
           I F+GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 IDFKGHPHLSRIMMPPTWEGHPLRKDFPA 170


>gi|330940384|gb|EGH43488.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 377

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|331017273|gb|EGH97329.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|28870531|ref|NP_793150.1| NADH dehydrogenase I, subunit C/D [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|81730554|sp|Q87ZQ7|NUOCD_PSESM RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|28853779|gb|AAO56845.1| NADH dehydrogenase I, C/D subunit [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|330875771|gb|EGH09920.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|330965589|gb|EGH65849.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|312885501|ref|ZP_07745139.1| NADH dehydrogenase subunit C [Mucilaginibacter paludis DSM 18603]
 gi|311301969|gb|EFQ79000.1| NADH dehydrogenase subunit C [Mucilaginibacter paludis DSM 18603]
          Length = 165

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 84/150 (56%), Gaps = 7/150 (4%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVG-ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +D+ + +   F   V     + G + +L +    +  +C  LRD+P   F  +  L GVD
Sbjct: 4   DDIKNILTAKFGDGVIVGEETTGLQPALLIAPEMIAQVCLELRDNPETYFDFLSCLSGVD 63

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIA------VAEGKSVPSIVGIYPGADWFEREVWD 118
           + +  NRF VVYH  S  YN RL +KI+      + E  S PSI  +Y  ADW ERE +D
Sbjct: 64  YGTAENRFGVVYHLSSIPYNFRLTLKISKLSSRLLNELPSFPSISSVYKAADWHEREAYD 123

Query: 119 MYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           M GIFFE HPDLRRIL    +EG PLRKD+
Sbjct: 124 MTGIFFENHPDLRRILLPDDWEGFPLRKDY 153


>gi|302185025|ref|ZP_07261698.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. syringae 642]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|289625428|ref|ZP_06458382.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649289|ref|ZP_06480632.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|289679198|ref|ZP_06500088.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. syringae FF5]
 gi|298487550|ref|ZP_07005592.1| NADH-ubiquinone oxidoreductase chain C / NADH-ubiquinone
           oxidoreductase chain D [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157934|gb|EFH99012.1| NADH-ubiquinone oxidoreductase chain C / NADH-ubiquinone
           oxidoreductase chain D [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866836|gb|EGH01545.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330954561|gb|EGH54821.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae Cit 7]
 gi|330981369|gb|EGH79472.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|148266252|ref|YP_001232958.1| NADH (or F420H2) dehydrogenase, subunit C [Geobacter uraniireducens
           Rf4]
 gi|218534289|sp|A5G9B7|NUOC_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|146399752|gb|ABQ28385.1| NADH dehydrogenase subunit C [Geobacter uraniireducens Rf4]
          Length = 164

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 15  SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDV 74
            F+ S+       GE+++ V   D+V+LC FL+++    +  + D+  VD+L +  RF V
Sbjct: 17  KFASSILEVKEFRGEVTVIVRKEDIVALCKFLKEELR--YNLLTDVTAVDYLGKDPRFMV 74

Query: 75  VYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
           VY+  S     RLR+K  V EG+ ++ ++ G++  A+W ERE +D+ GI F+ HPDLRRI
Sbjct: 75  VYNIYSIPNKDRLRIKAPVTEGECTIDTVCGVWTTANWLEREAYDLMGIIFKNHPDLRRI 134

Query: 134 LTDYGFEGHPLRKDFPVTG 152
           +    + GHPLRKD+P+ G
Sbjct: 135 MMTDDWVGHPLRKDYPLQG 153


>gi|237800543|ref|ZP_04589004.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023403|gb|EGI03460.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 431

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|66046428|ref|YP_236269.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. syringae B728a]
 gi|75501521|sp|Q4ZRJ1|NUOCD_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|63257135|gb|AAY38231.1| NADH (or F420H2) dehydrogenase, subunit C:NADH dehydrogenase I, D
           subunit [Pseudomonas syringae pv. syringae B728a]
          Length = 593

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R+N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRTN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|300782453|ref|YP_003762744.1| NADH dehydrogenase I subunit C [Amycolatopsis mediterranei U32]
 gi|299791967|gb|ADJ42342.1| NADH dehydrogenase I subunit C [Amycolatopsis mediterranei U32]
          Length = 249

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 76/128 (59%), Gaps = 2/128 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF-LSRSNRFDVVYHFLSPKYNRR 86
           GE++  V    L S+   LRDD    F  +  + GVD+ +    R   VYHF S  Y RR
Sbjct: 103 GEITFYVAREHLPSIAKTLRDDGGLRFELLSSVSGVDYGVDVPQRLHAVYHFTSLTYRRR 162

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++ +  E   VPS+V  YP ADW ERE WDM+GI F+GHP L RIL    ++GHP R
Sbjct: 163 IRLEVTLDVEDAHVPSLVETYPTADWQEREAWDMFGIVFDGHPALTRILMPDDWDGHPQR 222

Query: 146 KDFPVTGF 153
           KD+P+ G 
Sbjct: 223 KDYPLGGI 230


>gi|291326665|ref|ZP_06125358.2| NADH-quinone oxidoreductase, C/D subunit [Providencia rettgeri DSM
           1131]
 gi|291313439|gb|EFE53892.1| NADH-quinone oxidoreductase, C/D subunit [Providencia rettgeri DSM
           1131]
          Length = 600

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 104/191 (54%), Gaps = 23/191 (12%)

Query: 14  NSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           N F G   F+V +   G   L V    L+ +  FL+  P   +V + DL GVD   R +R
Sbjct: 32  NQF-GPDAFSVQATRTGMPVLWVRREQLLEVVDFLKKLPKP-YVMLFDLHGVDERQRIHR 89

Query: 72  -------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIF 123
                  F V YH +S   NR + +K+A+ E   +VPSIV ++P A+W EREVWDM+GI 
Sbjct: 90  QGLPEADFSVFYHLISIDRNRDIMLKVALNEKDLNVPSIVSLFPNANWHEREVWDMFGIT 149

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVEL---- 172
           F+GHP+LRR+L    +EGHPLRKD+P            +   D +++ + ++P E     
Sbjct: 150 FQGHPNLRRLLMSPSWEGHPLRKDYPARATEFDPFVLTKQKQDLEMEALTFKPEEWGMAR 209

Query: 173 MQEHRDYDFLS 183
             E+ D+ FL+
Sbjct: 210 GNENEDFMFLN 220


>gi|212712278|ref|ZP_03320406.1| hypothetical protein PROVALCAL_03364 [Providencia alcalifaciens DSM
           30120]
 gi|212685024|gb|EEB44552.1| hypothetical protein PROVALCAL_03364 [Providencia alcalifaciens DSM
           30120]
          Length = 600

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 94/165 (56%), Gaps = 20/165 (12%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ +  FL+  P   +V + DL GVD   R +R       F V YH +S   NR + +K
Sbjct: 57  QLLEIVDFLKKLPKP-YVMLFDLHGVDERQRIHRQGLPEADFSVFYHIISIDRNRDIMLK 115

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A+ E   +VPS+V ++P A+W EREVWDM+GI F+GHP+LRR+L    +EGHPLRKD+P
Sbjct: 116 VALNENDLNVPSVVSLFPNANWHEREVWDMFGITFQGHPNLRRLLMSPSWEGHPLRKDYP 175

Query: 150 VTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFLS 183
                       +   D +++ + ++P E       E+ D+ FL+
Sbjct: 176 ARATEFDPFVLTKQKQDLEMEALTFKPEEWGMSRGNENEDFMFLN 220


>gi|332296566|ref|YP_004438489.1| NAD(P)H-quinone oxidoreductase subunit J [Thermodesulfobium
           narugense DSM 14796]
 gi|332179669|gb|AEE15358.1| NAD(P)H-quinone oxidoreductase subunit J [Thermodesulfobium
           narugense DSM 14796]
          Length = 178

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +E++   + + F   +     + G+LS+ V   D   +  FL++  +  F ++ DLCGVD
Sbjct: 3   VEEILKVVKDEFKERILSEEINFGQLSISVPKDDNTEVILFLKEHENLKFDHLADLCGVD 62

Query: 65  FLS-RSNRFDVVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGI 122
           +   R  R++VVY+  S K+  R+RVKI V E    V S+  I+ GA+W E E +DM+GI
Sbjct: 63  YYKLRDVRYEVVYNLYSIKFKHRIRVKIQVPEDDMEVNSLTCIFKGANWHECECYDMFGI 122

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
            F GHP+LRR+     + GHPLRKD+P+ G 
Sbjct: 123 KFRGHPNLRRVFMPDNWVGHPLRKDYPLKGI 153


>gi|304311497|ref|YP_003811095.1| NADH dehydrogenase I, chain CD [gamma proteobacterium HdN1]
 gi|301797230|emb|CBL45450.1| NADH dehydrogenase I, chain CD [gamma proteobacterium HdN1]
          Length = 600

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 89/141 (63%), Gaps = 9/141 (6%)

Query: 18  GSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR------ 71
           G+  F  N     +L V+   LV++  FLR+ P   +V ++DL  +D   R +R      
Sbjct: 37  GAFVFQTNRDRLPTLWVERSQLVAVLKFLREAPKP-YVMLLDLSAIDERLRQHREGQPKS 95

Query: 72  -FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPD 129
            F V YH +S + N  +R+K+A++E   ++P+I+ I+P A+W+EREV+D++GI FEGHP 
Sbjct: 96  DFTVFYHLVSIERNSDVRIKVALSESDLNLPTIISIWPNANWYEREVFDLFGIKFEGHPH 155

Query: 130 LRRILTDYGFEGHPLRKDFPV 150
           ++RIL    +EGHPLRKD+P 
Sbjct: 156 MQRILLPRYWEGHPLRKDYPA 176


>gi|159899600|ref|YP_001545847.1| NADH (or F420H2) dehydrogenase subunit C [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|218534278|sp|A9B4Z6|NUOC_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|159892639|gb|ABX05719.1| NADH (or F420H2) dehydrogenase, subunit C [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 171

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 85/141 (60%), Gaps = 3/141 (2%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHF 78
           +VR    S G+L L V+   L +L  +LRD+P   F  +  LCGVD+L R  RF+VV H 
Sbjct: 17  TVRIGDES-GDLCLTVERQQLPALAGWLRDEPDLAFTFLNQLCGVDYLGRDPRFEVVVHL 75

Query: 79  LSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
            S +   R+ + I V E   ++P++  ++P A++ ERE +DM+GI F GHP L RIL   
Sbjct: 76  TSFQNKMRVTLHIEVPEADPTIPTLARLFPTANFQERETYDMFGIIFTGHPGLERILMPE 135

Query: 138 GFEGHPLRKDFPVTGFVELHY 158
            + GHP RKD P+ G+ E+ +
Sbjct: 136 DWLGHPQRKDHPL-GYEEVAF 155


>gi|291004453|ref|ZP_06562426.1| NADH dehydrogenase subunit C [Saccharopolyspora erythraea NRRL
           2338]
          Length = 252

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 79/128 (61%), Gaps = 2/128 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR-SNRFDVVYHFLSPKYNRR 86
           GE++  VD   L+ +C  LRDDP   F     + GVD+      R   VYH LS  Y RR
Sbjct: 106 GEITFYVDRDHLLEICRSLRDDPALRFEMCASVSGVDYGPEVPQRLHSVYHLLSMTYRRR 165

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++A+  +   VPS+V +YP AD+ ERE +DM+GI ++GHP L RIL    ++GHP R
Sbjct: 166 IRLEVALDVDDPHVPSVVEVYPTADYQERETYDMFGIVYDGHPALTRILMPDDWDGHPQR 225

Query: 146 KDFPVTGF 153
           KD+P+ G 
Sbjct: 226 KDYPLGGI 233


>gi|134103328|ref|YP_001108989.1| NADH dehydrogenase subunit C [Saccharopolyspora erythraea NRRL
           2338]
 gi|218534330|sp|A4FPT9|NUOC_SACEN RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|133915951|emb|CAM06064.1| putative NADH dehydrogenase chain C [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 249

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 79/128 (61%), Gaps = 2/128 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSR-SNRFDVVYHFLSPKYNRR 86
           GE++  VD   L+ +C  LRDDP   F     + GVD+      R   VYH LS  Y RR
Sbjct: 103 GEITFYVDRDHLLEICRSLRDDPALRFEMCASVSGVDYGPEVPQRLHSVYHLLSMTYRRR 162

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++A+  +   VPS+V +YP AD+ ERE +DM+GI ++GHP L RIL    ++GHP R
Sbjct: 163 IRLEVALDVDDPHVPSVVEVYPTADYQERETYDMFGIVYDGHPALTRILMPDDWDGHPQR 222

Query: 146 KDFPVTGF 153
           KD+P+ G 
Sbjct: 223 KDYPLGGI 230


>gi|327398401|ref|YP_004339270.1| NAD(P)H-quinone oxidoreductase subunit J [Hippea maritima DSM
           10411]
 gi|327181030|gb|AEA33211.1| NAD(P)H-quinone oxidoreductase subunit J [Hippea maritima DSM
           10411]
          Length = 176

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 81/150 (54%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           E+L + I + F   +        ELS+ +    L     FL DD    F  ++ +  VDF
Sbjct: 4   EELFEKIQSKFGEYIVEHDTFRNELSVTIKKEKLHEFMQFLHDDSELKFDYLVMMTAVDF 63

Query: 66  LSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
             R  RFD+VY   S  +   +RVK    E ++V S+  I+  A+W ERE +DM+GI F 
Sbjct: 64  PKREERFDLVYELRSIPHKMIMRVKTRTKEDEAVDSVCDIWHSANWDERETYDMFGIKFN 123

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPVTGFVE 155
            HPDLRRIL    +EG+PLRKD+P+ G  E
Sbjct: 124 NHPDLRRILMPEDWEGYPLRKDYPLKGKPE 153


>gi|45658577|ref|YP_002663.1| NADH dehydrogenase subunit I C [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45601821|gb|AAS71300.1| NADH dehydrogenase I subunit C [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 178

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 80/117 (68%), Gaps = 2/117 (1%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSP-KYNRRLRVKIAVAEG 96
           +V + + L++DP   +  + DL  VD+L +   RF+V Y   S  K + ++R+K+ + +G
Sbjct: 37  IVPVLTALKNDPTLHYNFLNDLTAVDWLGKKEPRFEVNYLLRSENKASSKIRIKVRLEDG 96

Query: 97  KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           +SVPSI  ++ GA+W EREV+D++GI F GHP+L RIL    F+GHPLRKDFP+ GF
Sbjct: 97  ESVPSITSVFKGANWPEREVYDLFGISFIGHPNLDRILMPDNFQGHPLRKDFPLEGF 153


>gi|326577025|gb|EGE26920.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis 101P30B1]
          Length = 582

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           VD   ++ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VDKRAVLDVLLFLRTLPKP-FVMLVDLSAIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|320160241|ref|YP_004173465.1| NADH-quinone oxidoreductase subunit C [Anaerolinea thermophila
           UNI-1]
 gi|319994094|dbj|BAJ62865.1| NADH-quinone oxidoreductase chain C [Anaerolinea thermophila UNI-1]
          Length = 170

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 92/149 (61%), Gaps = 8/149 (5%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSPKYNRR 86
           GE++L V    +V++   LRD+    F  ++D+  VD+  +   RF VVYH  S      
Sbjct: 25  GEVTLIVPPEQIVAVAQTLRDE--HGFEQLVDVTAVDYFPQQEPRFHVVYHIRSLAQTLI 82

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           + +++ +     SV ++  +YPGA+W+EREV+DM+GI FEGH DLRRIL  Y ++GHPLR
Sbjct: 83  ICLRVPLNGNFPSVSTVEKVYPGANWYEREVYDMFGITFEGHSDLRRILMPYDWQGHPLR 142

Query: 146 KDFPVTGFVELHYD---DKVKKVVYRPVE 171
           KD+P+ G+ E+ +    D+V K   RP E
Sbjct: 143 KDYPL-GYEEVQFSFNIDEVLKRKLRPRE 170


>gi|282891848|ref|ZP_06300328.1| hypothetical protein pah_c198o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498281|gb|EFB40620.1| hypothetical protein pah_c198o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 173

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 92/147 (62%), Gaps = 8/147 (5%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           IE+L ++   +     +F    +GE +L+V   +L+ + S+L+ D    +  ++DL GVD
Sbjct: 7   IENLKNHCPEAILAQKQF----LGETTLEVQKENLIKVLSYLKHD----YEVLMDLTGVD 58

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFF 124
           ++  +    VVY   +PK   R+RV + V   + +PS+  ++ GA W+ERE++D++G+  
Sbjct: 59  YVDPTPYTKVVYWLHNPKNFERIRVIVFVEREEPIPSVTCLWDGAAWYERELFDLFGVPI 118

Query: 125 EGHPDLRRILTDYGFEGHPLRKDFPVT 151
           EGHPDL+RIL    ++GHPLR+D+P+T
Sbjct: 119 EGHPDLKRILMPDDWKGHPLRRDYPLT 145


>gi|66219964|gb|AAY42997.1| Nqo5 [Rhodothermus marinus]
          Length = 230

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 80/127 (62%), Gaps = 3/127 (2%)

Query: 27  VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRR 86
            GE ++ V    +V +C FL+++    F  + DL G+D  +   RF+V Y+ +S +  +R
Sbjct: 60  AGEHTVRVRADKIVEVCRFLKEE--QGFNYLADLGGIDRFTDEGRFEVFYNLVSIERRKR 117

Query: 87  LRVKIAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+K+ V E   V PS+  +Y  A+W ERE +DM+GI FEGHPDLRR+     FE HPLR
Sbjct: 118 IRLKVRVEEDNPVVPSVTSVYRAANWNERECYDMFGIRFEGHPDLRRMYMPEDFEYHPLR 177

Query: 146 KDFPVTG 152
           K+FP+ G
Sbjct: 178 KEFPLLG 184


>gi|238784998|ref|ZP_04628996.1| NADH-quinone oxidoreductase subunit C/D [Yersinia bercovieri ATCC
           43970]
 gi|238714114|gb|EEQ06128.1| NADH-quinone oxidoreductase subunit C/D [Yersinia bercovieri ATCC
           43970]
          Length = 598

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 77/121 (63%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEIMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPEADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E +  VP+   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKELHVPTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|311744394|ref|ZP_07718196.1| NADH-quinone oxidoreductase subunit C [Aeromicrobium marinum DSM
           15272]
 gi|311312360|gb|EFQ82275.1| NADH-quinone oxidoreductase subunit C [Aeromicrobium marinum DSM
           15272]
          Length = 240

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 17  SGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FDVV 75
           +G+V   V   GE++  V    L+ + + LR+DP   F     L  V + + + R   VV
Sbjct: 83  TGAVEKVVVDRGEITFHVTRQALLEVVTHLRNDPGLRFEFCSSLSAVHYPAETGRELHVV 142

Query: 76  YHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRIL 134
            H LS  + RR+RV+    +    VPS+V IYP ADW ERE WDM+G+ F+GHP L RIL
Sbjct: 143 LHLLSMTHRRRIRVEATAPDTDPHVPSVVSIYPTADWHEREAWDMFGLVFDGHPALTRIL 202

Query: 135 TDYGFEGHPLRKDFPVTGF 153
               + GHP RKD+P+ G 
Sbjct: 203 MPDDWPGHPQRKDYPLGGI 221


>gi|256422833|ref|YP_003123486.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Chitinophaga pinensis DSM 2588]
 gi|256037741|gb|ACU61285.1| NADH dehydrogenase I, D subunit [Chitinophaga pinensis DSM 2588]
          Length = 580

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (57%), Gaps = 20/172 (11%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLS 80
           G L+L +   D+V+   FL+ +    ++++ DLCG+D   R+ +       F VVY  LS
Sbjct: 29  GLLTLWIGKADIVNTVQFLQQN---AYLSLYDLCGIDERDRARKEQLPVADFSVVYLLLS 85

Query: 81  PKYNRRLRVKIAVA-EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
            K N  +R+K+ +  E  S+PSI  I+P A+W+ERE++DM+GI FEGHP L+RIL    +
Sbjct: 86  FKDNSFIRLKVPLTGEYPSLPSITAIFPNANWYEREIYDMFGIRFEGHPHLQRILMPQSW 145

Query: 140 EGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVEL-MQEHR-DYDFL 182
           +GHPLRK+ P            +   D + + + ++P E  MQ H  D DF+
Sbjct: 146 QGHPLRKEHPARATEIGPFRLWDEKQDAEQEALRFKPEEWGMQTHNDDVDFM 197


>gi|242239966|ref|YP_002988147.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Dickeya
           dadantii Ech703]
 gi|242132023|gb|ACS86325.1| NADH dehydrogenase I, D subunit [Dickeya dadantii Ech703]
          Length = 599

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 99/177 (55%), Gaps = 19/177 (10%)

Query: 12  IVNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           + N F GS  F V +   G   + V    L+ + +FL+  P   +V ++DL GVD   R+
Sbjct: 28  LCNRF-GSEAFTVQATRTGMPVVWVKREQLLEVVAFLKKQPKP-YVMLLDLHGVDERLRT 85

Query: 70  NR-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYG 121
           +R       F V YH +S + N+ + +K+A+ E   ++P++  ++P A+W+EREVWDMYG
Sbjct: 86  HRQGLPDADFTVFYHLISIERNKDIMLKVALVEKDLNMPTLTKLFPNANWYEREVWDMYG 145

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVE 171
           I F GHP L RI+    +EGHPLRKDFP            +   D +++ + ++P E
Sbjct: 146 ITFNGHPHLTRIMMPQTWEGHPLRKDFPARATEFDPFVLTKQREDMEMEALTFKPEE 202


>gi|268317702|ref|YP_003291421.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodothermus marinus DSM
           4252]
 gi|262335236|gb|ACY49033.1| NADH (or F420H2) dehydrogenase, subunit C [Rhodothermus marinus DSM
           4252]
          Length = 230

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 80/127 (62%), Gaps = 3/127 (2%)

Query: 27  VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRR 86
            GE ++ V    +V +C FL+++    F  + DL G+D  +   RF+V Y+ +S +  +R
Sbjct: 60  AGEHTVRVRADKIVEVCRFLKEE--QGFNYLADLGGIDRFTDEGRFEVFYNLVSIERRKR 117

Query: 87  LRVKIAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+K+ V E   V PS+  +Y  A+W ERE +DM+GI FEGHPDLRR+     FE HPLR
Sbjct: 118 IRLKVRVEEDNPVVPSVTSVYRAANWNERECYDMFGICFEGHPDLRRMYMPEDFEYHPLR 177

Query: 146 KDFPVTG 152
           K+FP+ G
Sbjct: 178 KEFPLLG 184


>gi|91203916|emb|CAJ71569.1| strongly similar to to proton-translocating NADH dehydrogenase I
           chain C (NuoC) [Candidatus Kuenenia stuttgartiensis]
          Length = 166

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 79/126 (62%), Gaps = 1/126 (0%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GEL+  +    ++ +  F + +       + D+CGVD +  +  F+VVYH  S +   R+
Sbjct: 26  GELTFVIKKEHIMQVAEFFKKNEELECDYLSDVCGVDKIETNGVFEVVYHLYSMQKKHRV 85

Query: 88  RVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           R+K+ V ++  ++ ++  I+  A+W ERE +DM+GI F+GHPDLR+IL    FEGHPLRK
Sbjct: 86  RLKVPVPSDNPTISTVTHIWKTANWHERETYDMFGIQFQGHPDLRKILMPEDFEGHPLRK 145

Query: 147 DFPVTG 152
           D+P+ G
Sbjct: 146 DYPIDG 151


>gi|284034167|ref|YP_003384098.1| NADH (or F420H2) dehydrogenase subunit C [Kribbella flavida DSM
           17836]
 gi|283813460|gb|ADB35299.1| NADH (or F420H2) dehydrogenase, subunit C [Kribbella flavida DSM
           17836]
          Length = 235

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 18  GSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FDVVY 76
           G++   V   GEL+L V    LV +   LRDD    F     + GV + + + R    VY
Sbjct: 79  GAIEKVVVDRGELTLHVVPERLVEVAQHLRDDEALRFEFCSGVNGVHYPNETGRELHAVY 138

Query: 77  HFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           H LS  +NRR+R++++V +    +PSIV +YP  DW ERE WD +GI F+GHP L RI  
Sbjct: 139 HLLSITHNRRIRLEVSVPDADPHIPSIVSVYPANDWHERETWDFFGIVFDGHPALTRIQM 198

Query: 136 DYGFEGHPLRKDFPVTGF 153
              + GHP RKD+P+ G 
Sbjct: 199 PDDWPGHPQRKDYPLGGI 216


>gi|326574006|gb|EGE23955.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis CO72]
          Length = 582

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           VD   ++ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VDKRAVLDVLLFLRTLPKP-FVMLVDLSTIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|163848442|ref|YP_001636486.1| NADH (or F420H2) dehydrogenase subunit C [Chloroflexus aurantiacus
           J-10-fl]
 gi|222526370|ref|YP_002570841.1| NADH (or F420H2) dehydrogenase subunit C [Chloroflexus sp.
           Y-400-fl]
 gi|163669731|gb|ABY36097.1| NADH (or F420H2) dehydrogenase, subunit C [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450249|gb|ACM54515.1| NADH (or F420H2) dehydrogenase, subunit C [Chloroflexus sp.
           Y-400-fl]
          Length = 172

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 81/131 (61%), Gaps = 2/131 (1%)

Query: 22  FAVNSV-GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLS 80
            AVN   G+LSL       ++   FLRDDP   +  + +LCGVD+L R  RF+VV H  S
Sbjct: 19  LAVNEFRGDLSLTFTPKGYLAAAQFLRDDPDLAYTFLENLCGVDYLGRKPRFEVVAHLTS 78

Query: 81  PKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
            ++  R+ +K+   E + +VPS+  ++P A++ ERE +D+ GI F+GHP L RIL    +
Sbjct: 79  MRHRHRVCLKVGCDEPEPTVPSLTPLFPTANYQERETFDLLGIRFDGHPSLTRILLPDDW 138

Query: 140 EGHPLRKDFPV 150
            GHPLRKD P+
Sbjct: 139 VGHPLRKDHPL 149


>gi|330972909|gb|EGH72975.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 593

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 85/148 (57%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +N+  G+  F       G   L V+   L  + +FLR+ P   +  + DL GVD   R N
Sbjct: 23  LNNRFGAEAFTAQPTRTGMPVLWVERARLFEILTFLRNVPKP-YSMLYDLHGVDERLRIN 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH LS + N  + +K+A++E   SVP+I  I+P A+W+EREVWDM+GI
Sbjct: 82  RRGLPGADFTVFYHLLSIERNSDVMIKVALSESDLSVPTITSIWPNANWYEREVWDMFGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L RI+    +EGHPLRKDFP 
Sbjct: 142 DFPGHPHLSRIMMPPTWEGHPLRKDFPA 169


>gi|326565200|gb|EGE15386.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Moraxella
           catarrhalis 103P14B1]
          Length = 522

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           VD   ++ +  FLR  P   FV ++DL  +D   R  R       F V YH +S + N  
Sbjct: 36  VDKRAVLDVLLFLRTLPKP-FVMLVDLSTIDERLRQYRHGLPDSDFTVFYHLMSLERNSD 94

Query: 87  LRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           +R+K+A+ EG+ VPS   IYP A+W+EREVWDM+G+ F+GHP L RIL    +EGHPLRK
Sbjct: 95  IRIKVALKEGEHVPSATKIYPNANWYEREVWDMFGVVFDGHPHLTRILLPKYWEGHPLRK 154

Query: 147 DF 148
           ++
Sbjct: 155 EY 156


>gi|222053572|ref|YP_002535934.1| NADH (or F420H2) dehydrogenase, subunit C [Geobacter sp. FRC-32]
 gi|221562861|gb|ACM18833.1| NADH (or F420H2) dehydrogenase, subunit C [Geobacter sp. FRC-32]
          Length = 164

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 79/126 (62%), Gaps = 3/126 (2%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRL 87
           GE+++ V   D+VS+CSFL++        + D+  VD+L    RF VVY+  S     R+
Sbjct: 30  GEVTVTVKKEDIVSICSFLKEQQRYNL--LTDITAVDYLGSDPRFMVVYNLYSIPNKDRI 87

Query: 88  RVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           R+K  V++   ++ ++ G++  A+W EREV+D+ GI F  HPDLRRIL    + GHPLRK
Sbjct: 88  RIKAPVSDSDCTIDTVYGVWKTANWLEREVYDLMGILFNNHPDLRRILMTDDWVGHPLRK 147

Query: 147 DFPVTG 152
           D+P+ G
Sbjct: 148 DYPLQG 153


>gi|300771675|ref|ZP_07081550.1| NADH-quinone oxidoreductase subunit C [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300761664|gb|EFK58485.1| NADH-quinone oxidoreductase subunit C [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 167

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 85/145 (58%), Gaps = 1/145 (0%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
            L + +   F   V+ A  S G L+++    D++ + +F++DD    F+ + D+  V + 
Sbjct: 8   QLWERLQEHFGAKVKNASESYGLLTIETSKADIIDVLAFIKDDTILQFIYLTDITAVHYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
           ++   F VVYH  S  +N R+R+K+ +  +  ++PS   ++ GA+W ERE +D +GI FE
Sbjct: 68  NQEEAFAVVYHVHSLVHNVRIRIKVFIDGQHPAIPSATVLWNGANWMERETYDFFGIQFE 127

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPV 150
           GHPDLRRIL        P+RK++P+
Sbjct: 128 GHPDLRRILNVDEMTVFPMRKEYPL 152


>gi|271501266|ref|YP_003334291.1| NADH dehydrogenase I subunit D [Dickeya dadantii Ech586]
 gi|270344821|gb|ACZ77586.1| NADH dehydrogenase I, D subunit [Dickeya dadantii Ech586]
          Length = 599

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 90/149 (60%), Gaps = 16/149 (10%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ +  FL+  P   +V ++DL GVD   R++R       F V YHF+S + NR + +K
Sbjct: 55  QLLDVVVFLKKQPKP-YVMLLDLHGVDERLRTHRQGLPDADFTVFYHFISIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E   ++P++  ++P A+W+EREVWDM+GI F+GHP L RI+    ++GHPLRKDFP
Sbjct: 114 VALSENDLNMPTLTKLFPNANWYEREVWDMFGITFKGHPHLTRIMMPQTWQGHPLRKDFP 173

Query: 150 VTG-------FVELHYDDKVKKVVYRPVE 171
                       +   D +++ + ++P E
Sbjct: 174 ARATEFDPFVLTKQREDMEMESLTFKPEE 202


>gi|238798406|ref|ZP_04641887.1| NADH-quinone oxidoreductase subunit C/D [Yersinia mollaretii ATCC
           43969]
 gi|238717720|gb|EEQ09555.1| NADH-quinone oxidoreductase subunit C/D [Yersinia mollaretii ATCC
           43969]
          Length = 598

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 76/121 (62%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEIMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPEADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    VP+   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDLHVPTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|297625730|ref|YP_003687493.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921495|emb|CBL56049.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 255

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 2/150 (1%)

Query: 6   EDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF 65
           +D+ D +     G     +   GE++  VD   L+ L   LRDD    F   + + GV +
Sbjct: 86  DDVADRMAELVPGFATRVMVHRGEITFFVDRDKLLELAKHLRDDEALRFEICVSVSGVHY 145

Query: 66  LSRS-NRFDVVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIF 123
             ++ +    V+H LS  YNRR+R+++ V+E    +PS+V +YP A++ ERE WDM+GI 
Sbjct: 146 PEQTGHELHAVFHLLSMTYNRRIRLEVEVSEDDPHLPSLVPVYPMANFHERETWDMFGII 205

Query: 124 FEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           F+GHP L RIL    + GHP RKD+P+ G 
Sbjct: 206 FDGHPALTRILMPDDWVGHPQRKDYPLGGI 235


>gi|219847964|ref|YP_002462397.1| NADH (or F420H2) dehydrogenase subunit C [Chloroflexus aggregans
           DSM 9485]
 gi|219542223|gb|ACL23961.1| NADH (or F420H2) dehydrogenase, subunit C [Chloroflexus aggregans
           DSM 9485]
          Length = 172

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 23  AVNSV-GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSP 81
           AVN   G++S+ +     ++    LRDDP   +  + +LCGVD+L R  RF+VV H  S 
Sbjct: 20  AVNEFRGDVSVTLTPSGYLAAAQLLRDDPELAYTFLENLCGVDYLGRKPRFEVVAHLTSM 79

Query: 82  KYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
           ++  R+ +K+   E   +VPS+  ++P A++ ERE +D+ GI F GHP L RIL    + 
Sbjct: 80  RHRHRVCLKVGCDEPNPTVPSLTPLFPTANYQERETFDLLGITFTGHPSLTRILLPEDWI 139

Query: 141 GHPLRKDFPV 150
           GHPLRKD+P+
Sbjct: 140 GHPLRKDYPL 149


>gi|189426185|ref|YP_001953362.1| NADH (or F420H2) dehydrogenase, subunit C [Geobacter lovleyi SZ]
 gi|218534275|sp|B3E9W7|NUOC_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|189422444|gb|ACD96842.1| NADH (or F420H2) dehydrogenase, subunit C [Geobacter lovleyi SZ]
          Length = 162

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 4/145 (2%)

Query: 10  DYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           + +   F  S+       G+  + V   D+V++ +FL+ +  C F  + D+  VD+L ++
Sbjct: 9   EKLQGKFEASILEVKQDRGDWIVTVKKEDIVAVLAFLKQE--CKFDMLTDVTAVDYLGKA 66

Query: 70  -NRFDVVYHFLSPKYNRRLRVKIAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEGH 127
            +RF +VY   S  +  RLR+K  VAE   V  S   +Y  A+W EREV+D++GI F+ H
Sbjct: 67  ADRFMMVYQLTSVPFKDRLRIKAPVAEADCVIGSATQVYGSANWLEREVFDLFGIRFDKH 126

Query: 128 PDLRRILTDYGFEGHPLRKDFPVTG 152
           PDLRRIL    +EGHPLRKD+P+ G
Sbjct: 127 PDLRRILMTPDWEGHPLRKDYPLQG 151


>gi|229821707|ref|YP_002883233.1| NADH (or F420H2) dehydrogenase, subunit C [Beutenbergia cavernae
           DSM 12333]
 gi|229567620|gb|ACQ81471.1| NADH (or F420H2) dehydrogenase, subunit C [Beutenbergia cavernae
           DSM 12333]
          Length = 240

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 79/141 (56%), Gaps = 2/141 (1%)

Query: 15  SFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FD 73
           +F  +V   V    EL+LDV    LV +   LRDDP   F   + + GV + + + R   
Sbjct: 81  AFDDAVEKVVVDRDELTLDVRREHLVLVALSLRDDPDLRFDLSLGVSGVHYPADTGRELH 140

Query: 74  VVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRR 132
            VYH  S  +NRRLR+++AV +    VPS   +YP  DW ERE WD +GI F+GHP L R
Sbjct: 141 AVYHLHSITHNRRLRLEVAVPDADPHVPSTTAVYPANDWHERETWDFFGIVFDGHPALAR 200

Query: 133 ILTDYGFEGHPLRKDFPVTGF 153
           I     + GHP RKD+P+ G 
Sbjct: 201 IEMPDDWVGHPQRKDYPLGGI 221


>gi|256380663|ref|YP_003104323.1| NADH dehydrogenase subunit C [Actinosynnema mirum DSM 43827]
 gi|255924966|gb|ACU40477.1| NADH (or F420H2) dehydrogenase, subunit C [Actinosynnema mirum DSM
           43827]
          Length = 252

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS-NRFDVVYHFLSPKYNRR 86
           GE++  +    LV +   LRDDP   F     L GVD+   +  R   V H  S  Y RR
Sbjct: 106 GEITFFLRREHLVDVARLLRDDPALRFELCSSLSGVDYGPEAPQRLHSVVHLTSMTYRRR 165

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++AV  +   VPS+V +YP  DW ERE WDM+GI ++GHP L RIL    ++GHP R
Sbjct: 166 IRLEVAVDVDDAHVPSLVSVYPTTDWQEREAWDMFGIVYDGHPGLTRILMPDDWDGHPQR 225

Query: 146 KDFPVTGF 153
           KD+P+ G 
Sbjct: 226 KDYPLGGI 233


>gi|119714786|ref|YP_921751.1| NADH dehydrogenase subunit C [Nocardioides sp. JS614]
 gi|218534312|sp|A1SE29|NUOC_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|119535447|gb|ABL80064.1| NADH dehydrogenase subunit C [Nocardioides sp. JS614]
          Length = 250

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 76/127 (59%), Gaps = 2/127 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FDVVYHFLSPKYNRR 86
           GE++  +   DL+ +   LRDD    F     + GV +   + R    VYH LS  +NRR
Sbjct: 104 GEITFHLRREDLLPVAQVLRDDERLRFEFCAGVSGVHYPDETGRELHAVYHLLSMTHNRR 163

Query: 87  LRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++AV +    +PSIV +YP  DW ERE +DM+GI F+GHP L RIL    + GHP R
Sbjct: 164 IRLEVAVPDADPHIPSIVPVYPTNDWHERETYDMFGIIFDGHPALTRILMPDDWPGHPQR 223

Query: 146 KDFPVTG 152
           KD+P+ G
Sbjct: 224 KDYPLGG 230


>gi|257054394|ref|YP_003132226.1| NADH dehydrogenase subunit C [Saccharomonospora viridis DSM 43017]
 gi|256584266|gb|ACU95399.1| NADH dehydrogenase subunit C [Saccharomonospora viridis DSM 43017]
          Length = 253

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 77/128 (60%), Gaps = 2/128 (1%)

Query: 28  GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDF-LSRSNRFDVVYHFLSPKYNRR 86
           GE++  V    LV +C  LRDD    F     + GVD+ +    R   VYH  S  Y RR
Sbjct: 107 GEITFYVQREYLVDICRTLRDDEGLRFELCNSVSGVDYGVDVPQRLHSVYHLTSMTYRRR 166

Query: 87  LRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           +R+++AV  +   +PSIV +YP ADW ERE +DM+GI ++GHP L RIL    +EGHP R
Sbjct: 167 IRLEVAVDVDDPHIPSIVDVYPTADWQEREAYDMFGIIYDGHPALTRILMPDDWEGHPQR 226

Query: 146 KDFPVTGF 153
           KD+P+ G 
Sbjct: 227 KDYPLGGI 234


>gi|307169817|gb|EFN62343.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Camponotus floridanus]
          Length = 87

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 57/68 (83%)

Query: 119 MYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRD 178
           M+GIFF  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD+ K+VV  P+EL QE R 
Sbjct: 1   MFGIFFLNHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDDEQKRVVIEPLELTQEFRK 60

Query: 179 YDFLSPWE 186
           ++  +PWE
Sbjct: 61  FELSAPWE 68


>gi|92115245|ref|YP_575173.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Chromohalobacter salexigens DSM 3043]
 gi|122419106|sp|Q1QST4|NUOCD_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|91798335|gb|ABE60474.1| NADH dehydrogenase subunit C / NADH dehydrogenase subunit D
           [Chromohalobacter salexigens DSM 3043]
          Length = 592

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 75/120 (62%), Gaps = 9/120 (7%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVKI 91
           L+ + +FLRD P   F  + DL G+D   RS+R       F V Y  +S   NR + +K+
Sbjct: 50  LLEVLNFLRDMPEP-FEMLFDLHGIDERLRSHREDLPPADFTVFYQLMSISRNRDIMLKV 108

Query: 92  AVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPV 150
           A++E    VPS+ G+YP A+W+EREVWDM+GI F GHP L R+L    + GHPLRKD+P 
Sbjct: 109 ALSERDLEVPSVAGVYPNANWYEREVWDMFGIDFRGHPHLTRLLMPPTWNGHPLRKDYPA 168


>gi|307131812|ref|YP_003883828.1| NADH:ubiquinone oxidoreductase subunit C,D [Dickeya dadantii 3937]
 gi|306529341|gb|ADM99271.1| NADH:ubiquinone oxidoreductase, chain C,D [Dickeya dadantii 3937]
          Length = 599

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 90/149 (60%), Gaps = 16/149 (10%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + +FL+  P   +V + DL GVD   R++R       F V YH +S + NR + +K
Sbjct: 55  QLLDVVAFLKKQPKP-YVMLHDLHGVDERLRTHRQGLPDADFTVFYHLISIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E   ++P+++ ++P A+W+EREVWDM+GI F+GHP L RI+    ++GHPLRKDFP
Sbjct: 114 VALSENDLNMPTLIKLFPNANWYEREVWDMFGITFKGHPHLTRIMMPQTWQGHPLRKDFP 173

Query: 150 VTG-------FVELHYDDKVKKVVYRPVE 171
                       +   D +++ + ++P E
Sbjct: 174 ARATEFDPFVLTKQREDMEMESLTFKPEE 202


>gi|251789016|ref|YP_003003737.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Dickeya
           zeae Ech1591]
 gi|247537637|gb|ACT06258.1| NADH dehydrogenase I, D subunit [Dickeya zeae Ech1591]
          Length = 599

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 89/149 (59%), Gaps = 16/149 (10%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ +  FL+  P   +V ++DL GVD   R++R       F V YH +S + NR + +K
Sbjct: 55  QLLDVVVFLKKQPKP-YVMLLDLHGVDERLRTHRQGLPDADFTVFYHLISIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E   ++P++  ++P A+W+EREVWDM+GI F+GHP L RI+    ++GHPLRKDFP
Sbjct: 114 VALSENDLTMPTLTKLFPNANWYEREVWDMFGITFKGHPHLTRIMMPQTWQGHPLRKDFP 173

Query: 150 VTG-------FVELHYDDKVKKVVYRPVE 171
                       +   D +++ + ++P E
Sbjct: 174 ARATEFDPFVLTKQREDMEMESLTFKPEE 202


>gi|183220688|ref|YP_001838684.1| NADH-quinone oxidoreductase subunit C [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189910789|ref|YP_001962344.1| NADH dehydrogenase subunit C [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775465|gb|ABZ93766.1| NADH dehydrogenase (ubiquinone), C chain [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779110|gb|ABZ97408.1| NADH-quinone oxidoreductase, chain C [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 173

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 76/125 (60%), Gaps = 2/125 (1%)

Query: 30  LSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL-SRSNRFDVVYHFLSPKYNR-RL 87
           L   +    L  +   L+D P   F  + DL  +D+L  R  RF+V+Y   SPK    RL
Sbjct: 28  LYFSIQKEKLPEVVRTLKDHPEFAFSFLNDLTSIDWLGKREPRFEVIYLLRSPKLGHFRL 87

Query: 88  RVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
           ++++ V EG+SVPS+  I+P A+W EREV+D+ GI F GHP + R++    F GHPLRKD
Sbjct: 88  QLRVPVGEGESVPSLSEIFPAANWPEREVFDLMGIPFSGHPRMERLIMPDNFVGHPLRKD 147

Query: 148 FPVTG 152
           +P+ G
Sbjct: 148 YPLEG 152


>gi|322831986|ref|YP_004212013.1| NADH dehydrogenase I, D subunit [Rahnella sp. Y9602]
 gi|321167187|gb|ADW72886.1| NADH dehydrogenase I, D subunit [Rahnella sp. Y9602]
          Length = 599

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+   +FLR  P   +V + DL G D   R++R       F V YH +S + NR + +K
Sbjct: 55  QLLEAITFLRKQPKP-YVMLFDLHGFDERLRTHRDGLPAADFSVFYHLISVERNRDIMIK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A+AE    VP+I  ++P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALAENDLHVPTITKVFPNANWYERETWEMFGITFDGHPHLTRIMMPQTWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|227535969|ref|ZP_03966018.1| NADH dehydrogenase I chain C [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227244212|gb|EEI94227.1| NADH dehydrogenase I chain C [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 167

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 84/145 (57%), Gaps = 1/145 (0%)

Query: 7   DLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFL 66
            L + +   F   V+ A  S G L++     D++ + +F++DD    F+ + D+  V + 
Sbjct: 8   QLWERLQEHFGTKVKNASESYGLLTIQTSKTDIIDVLAFIKDDTILQFIYLTDITAVHYP 67

Query: 67  SRSNRFDVVYHFLSPKYNRRLRVKIAV-AEGKSVPSIVGIYPGADWFEREVWDMYGIFFE 125
           ++   F VVYH  S  +N R+R+K+ +  +  ++PS   ++ GA+W ERE +D +GI FE
Sbjct: 68  NQEEAFAVVYHVHSLVHNVRIRIKVFIDGQHPAIPSATVLWNGANWMERETYDFFGIQFE 127

Query: 126 GHPDLRRILTDYGFEGHPLRKDFPV 150
           GHPDLRRIL        P+RK++P+
Sbjct: 128 GHPDLRRILNVDEMTVFPMRKEYPL 152


>gi|315445431|ref|YP_004078310.1| NADH dehydrogenase subunit C [Mycobacterium sp. Spyr1]
 gi|315263734|gb|ADU00476.1| NADH dehydrogenase subunit C [Mycobacterium sp. Spyr1]
          Length = 226

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           R  E +GD   ++F+ S+   V    EL+L+V    LV +   LRDDP   F   + + G
Sbjct: 58  RLAEAVGD---DAFTESIERVVIHRDELTLEVHRDRLVEVAQALRDDPALRFELCLGVSG 114

Query: 63  VDFLSRSNR-FDVVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMY 120
           V +   + R     Y  +S  +NRR+RV++AV +    +PS+ G+YP  DW ERE +D +
Sbjct: 115 VHYPDDTGRELHAAYPLMSITHNRRIRVEVAVPDDDPHIPSLFGVYPTVDWHERETYDFF 174

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF-VELH 157
           GI F+GHP L RI     + GHP RKD+P+ G  VE H
Sbjct: 175 GIIFDGHPSLTRIEMPDDWVGHPQRKDYPLGGIPVEYH 212


>gi|111220501|ref|YP_711295.1| NADH dehydrogenase subunit C [Frankia alni ACN14a]
 gi|111148033|emb|CAJ59699.1| NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, chain C)
           (NDH-1, chain C) [Frankia alni ACN14a]
          Length = 250

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 80/138 (57%), Gaps = 3/138 (2%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS--RSNRFDVVY 76
           +V  AV   GEL+L V    L +L   LRDDP   F  +  L GVD+       R   V 
Sbjct: 94  AVERAVVDRGELTLHVRREGLPALAQTLRDDPGLRFELLSSLSGVDYPDDVTGRRLHSVV 153

Query: 77  HFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           H  S  + RRLR++++VA+   ++PS+  ++P ADW ERE +D++GI + GHP L RI+ 
Sbjct: 154 HLTSMTHRRRLRLEVSVADADPTLPSLTSVWPTADWHEREAYDLFGIIYTGHPGLTRIMM 213

Query: 136 DYGFEGHPLRKDFPVTGF 153
              + GHP RKD+P+ G 
Sbjct: 214 PDDWIGHPQRKDYPLGGI 231


>gi|307205388|gb|EFN83729.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 3,
           mitochondrial [Harpegnathos saltator]
          Length = 87

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 57/68 (83%)

Query: 119 MYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRD 178
           M+G+FF  HPDLRRILTDYGFEGHPLRKDFP++G+VE+ YDD+ K++V  P+EL QE R 
Sbjct: 1   MFGVFFSNHPDLRRILTDYGFEGHPLRKDFPLSGYVEVRYDDEHKRIVIEPLELTQEFRK 60

Query: 179 YDFLSPWE 186
           ++  +PWE
Sbjct: 61  FELAAPWE 68


>gi|304413373|ref|ZP_07394846.1| NADH:ubiquinone oxidoreductase, chain C,D [Candidatus Regiella
           insecticola LSR1]
 gi|304284216|gb|EFL92609.1| NADH:ubiquinone oxidoreductase, chain C,D [Candidatus Regiella
           insecticola LSR1]
          Length = 599

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 106/193 (54%), Gaps = 22/193 (11%)

Query: 12  IVNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRS 69
           +++ F G+  F + +   G   L +    L+ +  +L+  P   +V + DL GVD   R+
Sbjct: 27  LLSLFFGAEAFVLQATRTGMPVLWIKKEKLLDVMLWLKKQPQP-YVMLFDLHGVDERQRT 85

Query: 70  NR-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYG 121
            R       F V YH LS + NR + +K+A++E    +PS+  I+P A+W+ERE W+M+G
Sbjct: 86  YRQDLPAADFSVFYHLLSIERNRDIMLKVALSEKALQLPSVQQIFPNANWYERETWEMFG 145

Query: 122 IFFEGHPDLRRILTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRP----V 170
           I FEGHP L RI+    ++GHPLRKD+P            +   D +++ + ++P    +
Sbjct: 146 ITFEGHPHLTRIMMPQSWQGHPLRKDYPARATEFDPFILTKQKQDLEMESLTFKPEDWGM 205

Query: 171 ELMQEHRDYDFLS 183
           +  +E+ D+ FL+
Sbjct: 206 KRGRENEDFMFLN 218


>gi|293395172|ref|ZP_06639458.1| NADH dehydrogenase I subunit D [Serratia odorifera DSM 4582]
 gi|291422349|gb|EFE95592.1| NADH dehydrogenase I subunit D [Serratia odorifera DSM 4582]
          Length = 598

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 94/169 (55%), Gaps = 20/169 (11%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V    L+ + +FLR  P   +V + DL GVD   R++R       F V YH +S + NR 
Sbjct: 50  VKAEQLLEVMTFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPAADFSVFYHLISIERNRD 108

Query: 87  LRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           + +K+A++E    VP+   ++P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLR
Sbjct: 109 IMLKVALSEKDLHVPTATKVFPNANWYERETWEMFGITFDGHPHLSRIMMPQTWEGHPLR 168

Query: 146 KDFPVTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFLS 183
           KD+P            +   D +++ + ++P E       E+ D+ FL+
Sbjct: 169 KDYPARATEFDPFVLTKQKEDLEMESLTFKPEEWGMKRGTENEDFMFLN 217


>gi|9719439|gb|AAF97799.1|AF281148_3 NADH dehydrogenase I subunit C [Pseudomonas fluorescens]
          Length = 200

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 79/130 (60%), Gaps = 10/130 (7%)

Query: 27  VGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR--------FDVVYHF 78
            G   L V    LV + +FLR+ P   +V + DL GVD   R+ R        F V YH 
Sbjct: 39  TGMPVLWVARAKLVEVLTFLRNLPKP-YVMLYDLHGVDERLRTKRQGLPDGVDFTVFYHL 97

Query: 79  LSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDY 137
           +S + N  + +K+A++E   SVP++ GI+P A+W+EREVWDM+GI F GHP L RI+   
Sbjct: 98  MSIERNSDVMIKVALSESDLSVPTVTGIWPNANWYEREVWDMFGIDFPGHPHLTRIMMPP 157

Query: 138 GFEGHPLRKD 147
            +EGHPLRKD
Sbjct: 158 TWEGHPLRKD 167


>gi|167630266|ref|YP_001680765.1| proton-translocating NADH-ubiquinone oxidoreductase, chain c
           [Heliobacterium modesticaldum Ice1]
 gi|167593006|gb|ABZ84754.1| proton-translocating NADH-ubiquinone oxidoreductase, chain c
           [Heliobacterium modesticaldum Ice1]
          Length = 149

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKI-AVAEG 96
            L+++   LR +P   F  + DL  VD   +   F+VVY   S K+   LRVK    AE 
Sbjct: 34  QLLAVMEKLRREPDFAFDMLSDLTAVD--RKDAGFEVVYQLFSLKHRLDLRVKTRTAAEE 91

Query: 97  KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             VPS+ GI+PGADW EREV+D+ G+ F GHP++ R+L    FEGHPLRKDF
Sbjct: 92  AQVPSVTGIWPGADWMEREVFDLMGVTFAGHPNMARLLLPDEFEGHPLRKDF 143


>gi|15597835|ref|NP_251329.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas aeruginosa PAO1]
 gi|107102159|ref|ZP_01366077.1| hypothetical protein PaerPA_01003209 [Pseudomonas aeruginosa PACS2]
 gi|116050626|ref|YP_790555.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891200|ref|YP_002440066.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas aeruginosa LESB58]
 gi|296388900|ref|ZP_06878375.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas aeruginosa PAb1]
 gi|313107677|ref|ZP_07793859.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa 39016]
 gi|81622299|sp|Q9I0J9|NUOCD_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|122259749|sp|Q02ND1|NUOCD_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|9948707|gb|AAG06027.1|AE004692_6 NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa PAO1]
 gi|115585847|gb|ABJ11862.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218771425|emb|CAW27192.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa LESB58]
 gi|310880361|gb|EFQ38955.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa 39016]
          Length = 593

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +NS  G+  F V     G   L V    L+ + +FLR  P   +V + DL GVD   R++
Sbjct: 23  LNSRFGAETFTVQPTRTGMPVLWVPRERLIEVLTFLRQVPKP-YVMLYDLHGVDERLRTH 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH +S + N  + +K+A++E   ++P+   I+P A+W+EREVWDMYGI
Sbjct: 82  RRGLPSADFSVFYHLMSLERNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L R+L    ++GHPLRKD+P 
Sbjct: 142 TFTGHPHLTRMLMPPTWQGHPLRKDYPA 169


>gi|152985448|ref|YP_001347932.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Pseudomonas aeruginosa PA7]
 gi|218528052|sp|A6V4E7|NUOCD_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|150960606|gb|ABR82631.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa PA7]
          Length = 593

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +NS  G+  F V     G   L V    L+ + +FLR  P   +V + DL GVD   R++
Sbjct: 23  LNSRFGAETFTVQPTRTGMPVLWVPRERLIEVLTFLRQVPKP-YVMLYDLHGVDERLRTH 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH +S + N  + +K+A++E   ++P+   I+P A+W+EREVWDMYGI
Sbjct: 82  RRGLPNADFSVFYHLMSLERNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L R+L    ++GHPLRKD+P 
Sbjct: 142 TFTGHPHLTRMLMPPTWQGHPLRKDYPA 169


>gi|254241071|ref|ZP_04934393.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa 2192]
 gi|126194449|gb|EAZ58512.1| NADH dehydrogenase I chain C,D [Pseudomonas aeruginosa 2192]
          Length = 593

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 86/148 (58%), Gaps = 11/148 (7%)

Query: 13  VNSFSGSVRFAVNSV--GELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN 70
           +NS  G+  F V     G   L V    L+ + +FLR  P   +V + DL GVD   R++
Sbjct: 23  LNSRFGAETFTVQPTHTGMPVLWVPRERLIEVLTFLRQVPKP-YVMLYDLHGVDERLRTH 81

Query: 71  R-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGI 122
           R       F V YH +S + N  + +K+A++E   ++P+   I+P A+W+EREVWDMYGI
Sbjct: 82  RRGLPSADFSVFYHLMSLERNSDVMIKVALSERDLNLPTATRIWPNANWYEREVWDMYGI 141

Query: 123 FFEGHPDLRRILTDYGFEGHPLRKDFPV 150
            F GHP L R+L    ++GHPLRKD+P 
Sbjct: 142 TFTGHPHLTRMLMPPTWQGHPLRKDYPA 169


>gi|238897507|ref|YP_002923186.1| NADH dehydrogenase I chain C, D [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229465264|gb|ACQ67038.1| NADH dehydrogenase I chain C, D [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 599

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 88/156 (56%), Gaps = 21/156 (13%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V    LV +  FLR +    +V + DL GVD   R++R       F V YH LS + NR 
Sbjct: 51  VKADQLVEVILFLRQESQP-YVMLFDLHGVDERLRTHREGLPEADFCVFYHLLSIERNRD 109

Query: 87  LRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           + +K+A++E K  +P+I  I+  A+W+ERE W+M+GI FEGHP L+RIL    ++GHPLR
Sbjct: 110 ILLKVALSEKKLCLPTITSIFSNANWYERETWEMFGITFEGHPHLKRILMPDTWKGHPLR 169

Query: 146 KDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYDF 181
           KD+P             +   + P EL ++ +D + 
Sbjct: 170 KDYP------------ARATEFDPFELTKQKQDLEM 193


>gi|270262812|ref|ZP_06191083.1| NADH-quinone oxidoreductase subunit C/D [Serratia odorifera 4Rx13]
 gi|270043496|gb|EFA16589.1| NADH-quinone oxidoreductase subunit C/D [Serratia odorifera 4Rx13]
          Length = 598

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 94/169 (55%), Gaps = 20/169 (11%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V    L+ + +FLR  P   +V + DL GVD   R++R       F V YH +S + NR 
Sbjct: 50  VKPDQLLEVMTFLRKQPKP-YVMLFDLHGVDERLRTHRDGLPAADFSVFYHLISIERNRD 108

Query: 87  LRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           + +K+A++E    VP+   ++P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLR
Sbjct: 109 IMLKVALSEKDLHVPTATKVFPNANWYERETWEMFGITFDGHPHLTRIMMPQTWEGHPLR 168

Query: 146 KDFPVTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFLS 183
           KD+P            +   D +++ + ++P E       E+ D+ FL+
Sbjct: 169 KDYPARATEFDPFVLTKQKEDLEMESLTFKPEEWGMKRGTENEDFMFLN 217


>gi|320354160|ref|YP_004195499.1| NADH dehydrogenase subunit D; NADH dehydrogenase subunit C
           [Desulfobulbus propionicus DSM 2032]
 gi|320122662|gb|ADW18208.1| NADH dehydrogenase subunit D; NADH dehydrogenase subunit C
           [Desulfobulbus propionicus DSM 2032]
          Length = 571

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 5/146 (3%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS----RSNRFDVVYHFLSP 81
           ++  + L V    L    S L++DP   F  ++D+  VD+L+       RF VVY   + 
Sbjct: 21  TIDSVVLTVQPEYLEKTLSRLKNDPTLNFSLLLDVTAVDYLNYPEWHEARFFVVYTLRNW 80

Query: 82  KYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFE 140
           + NR ++V++ VA+ +  +P+  G++  A+W ERE +D YGI F+GHPDLRRIL  + F+
Sbjct: 81  EQNRLVQVRVPVADPEVGIPTATGLWDSANWGERETYDQYGIVFQGHPDLRRILNHWQFQ 140

Query: 141 GHPLRKDFPVTGFVELHYDDKVKKVV 166
           GHPLRKD+P+      +  D ++K +
Sbjct: 141 GHPLRKDYPIEQGQICYESDSLEKEI 166


>gi|145225062|ref|YP_001135740.1| NADH dehydrogenase subunit C [Mycobacterium gilvum PYR-GCK]
 gi|218534313|sp|A4TDC0|NUOC_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|145217548|gb|ABP46952.1| NADH dehydrogenase subunit C [Mycobacterium gilvum PYR-GCK]
          Length = 226

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 3   RKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCG 62
           R  E +GD   ++F+ S+   V    EL+L+V    LV +   LRDDP   F   + + G
Sbjct: 58  RLAEAVGD---DAFTESIERVVIHRDELTLEVHRDRLVEVAQALRDDPALRFELCLGVSG 114

Query: 63  VDFLSRSNR-FDVVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMY 120
           V +   + R     Y  +S  +NRR+R+++AV +    +PS+ G+YP  DW ERE +D +
Sbjct: 115 VHYPDDTGRELHAAYPLMSITHNRRIRLEVAVPDDDPHIPSLFGVYPTVDWHERETYDFF 174

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF-VELH 157
           GI F+GHP L RI     + GHP RKD+P+ G  VE H
Sbjct: 175 GIIFDGHPSLTRIEMPDDWVGHPQRKDYPLGGIPVEYH 212


>gi|332669451|ref|YP_004452459.1| NADH (or F420H2) dehydrogenase, subunit C [Cellulomonas fimi ATCC
           484]
 gi|332338489|gb|AEE45072.1| NADH (or F420H2) dehydrogenase, subunit C [Cellulomonas fimi ATCC
           484]
          Length = 265

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (54%), Gaps = 2/142 (1%)

Query: 14  NSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-F 72
             F+ +V   V    EL+L V    +V++ S LRDDP   F   + + GV +     R  
Sbjct: 105 TGFANAVESVVVDREELTLHVAREHVVAVASALRDDPDLRFELSLGVSGVHYPHEQGREL 164

Query: 73  DVVYHFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
             VYH +S  + RRLR ++A+ +    VPS V +YP  DW ERE +D +GI F+GHP L 
Sbjct: 165 HAVYHVVSVTHGRRLRFEVAIPDADPHVPSTVSVYPANDWHERETYDFFGIVFDGHPGLA 224

Query: 132 RILTDYGFEGHPLRKDFPVTGF 153
           RI     + GHP RKD+P+ G 
Sbjct: 225 RIEMPDDWPGHPQRKDYPLGGI 246


>gi|206602058|gb|EDZ38540.1| NADH dehydrogenase (quinone), chain C [Leptospirillum sp. Group II
           '5-way CG']
          Length = 184

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 88/148 (59%), Gaps = 4/148 (2%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           + + +   FSG+   +  S+G+LS+ +   + + +   L D+P   +  I+D+  VD+  
Sbjct: 4   VAESLEKRFSGTFLGSRESLGDLSVYIRPENALDVFRALHDEPEYDYDYIVDVTSVDYPM 63

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEG 126
              RF+VVY   S     R+ VKI V E    V S+VGI+ GA++ EREV+DM GI F G
Sbjct: 64  DPERFEVVYILYSISRRHRVMVKIRVTEDAPVVDSVVGIWKGAEFMEREVYDMMGIQFRG 123

Query: 127 HPDLRRILT--DYGFEGHPLRKDFPVTG 152
           HPDLRRIL   DY  EG PLRKDFP+ G
Sbjct: 124 HPDLRRILMPDDYE-EGFPLRKDFPLVG 150


>gi|182412308|ref|YP_001817374.1| NADH (or F420H2) dehydrogenase, subunit C [Opitutus terrae PB90-1]
 gi|177839522|gb|ACB73774.1| NADH (or F420H2) dehydrogenase, subunit C [Opitutus terrae PB90-1]
          Length = 209

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 85/143 (59%), Gaps = 5/143 (3%)

Query: 31  SLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSPKYNRRLRV 89
           +++V   +LV+    LRD+ H   V ++D+  +D+   S+ RF VVYH  S  ++  +RV
Sbjct: 27  AVNVAVTELVAALKTLRDE-HGYDV-LMDVTAIDWSETSSPRFTVVYHVYSTTHHDYVRV 84

Query: 90  KIAVAE--GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKD 147
               A+      PSIV ++P A+W ERE +DM+GI FEGHPDLRRIL   G+ G PLRK+
Sbjct: 85  AADCADDVAPVAPSIVSLWPAANWHERECYDMFGIKFEGHPDLRRILMWEGYPGWPLRKE 144

Query: 148 FPVTGFVELHYDDKVKKVVYRPV 170
           FP+ G      D ++  V   PV
Sbjct: 145 FPLAGVETALPDPEISAVTGTPV 167


>gi|302035621|ref|YP_003795943.1| NADH-quinone oxidoreductase subunit C [Candidatus Nitrospira
           defluvii]
 gi|300603685|emb|CBK40016.1| NADH-quinone oxidoreductase, subunit C [Candidatus Nitrospira
           defluvii]
          Length = 165

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 84/150 (56%), Gaps = 2/150 (1%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           +  L   I ++F G     V   G++S+ V    L  +  FL DDP   F  I+ +  VD
Sbjct: 1   MSQLAKRIEDTFPGVCTKVVEWRGDVSVTVKREALHDIGKFLHDDPAMRFDYIVHVSSVD 60

Query: 65  FLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKS-VPSIVGIYPGADWFEREVWDMYGIF 123
           +     RF+VVY   S +  +R+R+K  V E    V S+  I+ GAD+ EREV+DM GI 
Sbjct: 61  WPDDEERFEVVYEVYSIRTRQRIRLKTRVPESDCIVDSLTDIWKGADFMEREVYDMMGIR 120

Query: 124 FEGHPDLRRILT-DYGFEGHPLRKDFPVTG 152
           F  HPDLRRIL  D   EG+PLRKDFP+ G
Sbjct: 121 FRNHPDLRRILMPDEYEEGYPLRKDFPLRG 150


>gi|157371543|ref|YP_001479532.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Serratia
           proteamaculans 568]
 gi|218534243|sp|A8GH14|NUOCD_SERP5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|157323307|gb|ABV42404.1| NADH dehydrogenase I, D subunit [Serratia proteamaculans 568]
          Length = 598

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 77/125 (61%), Gaps = 9/125 (7%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRR 86
           V    L+ + +FLR  P   +V + DL GVD   R++R       F V YH +S + NR 
Sbjct: 50  VKPDQLLEVMTFLRKQPKP-YVMLFDLHGVDERLRTHRDGLPAADFSVFYHLISIERNRD 108

Query: 87  LRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           + +K+A++E    VP+   ++P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLR
Sbjct: 109 IMLKVALSEKDLHVPTATKVFPNANWYERETWEMFGITFDGHPHLSRIMMPQTWEGHPLR 168

Query: 146 KDFPV 150
           KD+P 
Sbjct: 169 KDYPA 173


>gi|197285618|ref|YP_002151490.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Proteus
           mirabilis HI4320]
 gi|227356121|ref|ZP_03840511.1| NADH-quinone oxidoreductase chain C/D [Proteus mirabilis ATCC
           29906]
 gi|218528051|sp|B4EZC8|NUOCD_PROMH RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|194683105|emb|CAR43664.1| NADH-quinone oxidoreductase chain C/D [Proteus mirabilis HI4320]
 gi|227163766|gb|EEI48678.1| NADH-quinone oxidoreductase chain C/D [Proteus mirabilis ATCC
           29906]
          Length = 598

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 99/181 (54%), Gaps = 20/181 (11%)

Query: 22  FAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDV 74
           F     G   + V    L+ +  +L+  P   +V + DL GVD   R++R       F V
Sbjct: 39  FQPTRTGMPVVWVKREQLIEVMQYLKSLPKP-YVMLYDLHGVDERVRTHRQGLPAADFSV 97

Query: 75  VYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRI 133
            YH +S   N+ + +K+A++E   ++P++  I+P ++W+EREVWDM+GI F GHP+LRRI
Sbjct: 98  FYHLISLDRNKDIMLKVALSEKDLNLPTLTSIFPNSNWYEREVWDMFGIVFNGHPNLRRI 157

Query: 134 LTDYGFEGHPLRKDFPVTG-------FVELHYDDKVKKVVYRPVEL----MQEHRDYDFL 182
           +    +EGHPLRKD+P            +   D +++ + ++P E       E+ D+ FL
Sbjct: 158 MMLPNWEGHPLRKDYPARATEFDPYVLTKQKEDLEMESLTFKPEEWGMKRGTENEDFMFL 217

Query: 183 S 183
           +
Sbjct: 218 N 218


>gi|37526975|ref|NP_930319.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|81418914|sp|Q7N2I9|NUOCD_PHOLL RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|36786408|emb|CAE15461.1| NADH dehydrogenase I chain C/D (NADH-ubiquinone oxidoreductase
           chain 3/4) (NUO3/NUO4) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 599

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 79/121 (65%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + +FL+  P   +V + DL G+D   R++R       F V YH LS + NR + +K
Sbjct: 56  QLLEVMTFLKKLPKP-YVMLFDLHGMDERQRTHRQGLPAADFSVFYHLLSIERNRDIMLK 114

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E + ++P+   ++P A+W+ERE W+M+G+ F GHP+LRRI+    +EGHPLRKD+P
Sbjct: 115 VALSEKELNLPTATPLFPNANWYERETWEMFGVVFNGHPNLRRIMLPPTWEGHPLRKDYP 174

Query: 150 V 150
            
Sbjct: 175 A 175


>gi|78778021|ref|YP_394336.1| NADH dehydrogenase subunit C [Sulfurimonas denitrificans DSM 1251]
 gi|78498561|gb|ABB45101.1| NADH (or F420H2) dehydrogenase, subunit C [Sulfurimonas
           denitrificans DSM 1251]
          Length = 268

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 26  SVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNR 85
            VG++ + ++  D   +   LRD+  C +  + ++  +D+L+    F+V Y  LS    +
Sbjct: 56  QVGQMVVYINPADNYKVLELLRDE--CEYTQLSEMSAIDWLAAKGEFEVFYQMLSMNKRK 113

Query: 86  RLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLR 145
           RLR+K+ + +G+++ S+  ++  ADW ERE++DM+GI   GHP ++RIL  Y ++GHPL 
Sbjct: 114 RLRIKMFIKKGEAINSVEKLFRSADWSEREMFDMFGIEANGHPFMKRILMPYDWQGHPLL 173

Query: 146 KDFPVTG 152
           K +P+ G
Sbjct: 174 KTYPLQG 180


>gi|313895797|ref|ZP_07829351.1| NADH dehydrogenase, C subunit [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975222|gb|EFR40683.1| NADH dehydrogenase, C subunit [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 162

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 34  VDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAV 93
           +   +L+S  ++LR D    F  + +L  VD+    +RF+ VYH  +P     L VK+ +
Sbjct: 34  IGADELISFLTYLRSDAALAFTRLENLTAVDW---KDRFETVYHLFAPASGHWLTVKVTL 90

Query: 94  A-EGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
             +   VPS   ++PGA++ EREV+D+ GI F GHPDLRR+     F GHPLRKDF
Sbjct: 91  PHDAPRVPSATAVFPGAEFEEREVYDLMGIAFTGHPDLRRVFLPENFAGHPLRKDF 146


>gi|238788652|ref|ZP_04632444.1| NADH-quinone oxidoreductase subunit C/D [Yersinia frederiksenii
           ATCC 33641]
 gi|238723247|gb|EEQ14895.1| NADH-quinone oxidoreductase subunit C/D [Yersinia frederiksenii
           ATCC 33641]
          Length = 598

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDMHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|124515814|gb|EAY57323.1| NADH dehydrogenase (quinone), chain C [Leptospirillum rubarum]
          Length = 184

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 88/148 (59%), Gaps = 4/148 (2%)

Query: 8   LGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS 67
           + + +   FSG+   +  S+G+LS+ +   + + +   L D+P   +  I+D+  VD+  
Sbjct: 4   VAESLEKRFSGTFLGSRESLGDLSVYIRPENALDVFRALHDEPEYDYDYIVDVTSVDYPM 63

Query: 68  RSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSV-PSIVGIYPGADWFEREVWDMYGIFFEG 126
              RF+VVY   S     R+ VKI V E   V  S+VGI+ GA++ EREV+DM GI F G
Sbjct: 64  DPERFEVVYILYSISRRHRVMVKIRVTEDSPVVDSVVGIWKGAEFMEREVYDMMGIQFRG 123

Query: 127 HPDLRRILT--DYGFEGHPLRKDFPVTG 152
           HPDLRRIL   DY  EG PLRKDFP+ G
Sbjct: 124 HPDLRRILMPDDYE-EGFPLRKDFPLVG 150


>gi|238759964|ref|ZP_04621117.1| NADH-quinone oxidoreductase subunit C/D [Yersinia aldovae ATCC
           35236]
 gi|238701791|gb|EEP94355.1| NADH-quinone oxidoreductase subunit C/D [Yersinia aldovae ATCC
           35236]
          Length = 598

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|261416513|ref|YP_003250196.1| NADH (or F420H2) dehydrogenase, subunit C [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|261372969|gb|ACX75714.1| NADH (or F420H2) dehydrogenase, subunit C [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|302325864|gb|ADL25065.1| NADH-quinone oxidoreductase, C subunit [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 200

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 75/119 (63%), Gaps = 6/119 (5%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN----RFDVVYHFLSPKY-NRRLRVKIAV 93
           L +   FL+++    F  ++D+ G+D+L+  N    RF V Y F S K    R+R+K+ V
Sbjct: 35  LHNAVQFLKEESGIKFDMLVDIAGIDYLTYPNHEGPRFAVSYAFKSMKNPGARIRLKVLV 94

Query: 94  AEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVT 151
           +E    VP+I  +Y  A+W+EREV+D +G+ FEGHPDLRR+L    F GHPLRKD+P  
Sbjct: 95  SEESLKVPTISDLYANANWYEREVYDQFGVIFEGHPDLRRLLNHVEFVGHPLRKDYPAQ 153


>gi|238753752|ref|ZP_04615113.1| NADH-quinone oxidoreductase subunit C/D [Yersinia ruckeri ATCC
           29473]
 gi|238707988|gb|EEQ00345.1| NADH-quinone oxidoreductase subunit C/D [Yersinia ruckeri ATCC
           29473]
          Length = 598

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDMHVSTATQIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|116330240|ref|YP_799958.1| NADH dehydrogenase (ubiquinone), C chain [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116123929|gb|ABJ75200.1| NADH dehydrogenase (ubiquinone), C chain [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 177

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 78/117 (66%), Gaps = 2/117 (1%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN-RFDVVYHFLSP-KYNRRLRVKIAVAEG 96
           +V + + L+  P   +  + DL  VD+L +   RF+V Y   S  + + ++R+K+ + +G
Sbjct: 37  IVPVLNALKGHPTLNYNFLNDLTAVDWLGKKEPRFEVNYLLRSANQSSSKIRIKVRLEDG 96

Query: 97  KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGF 153
           +++PS+  +Y GA+W ERE++D++GI F GHP+L RIL    F+GHPLRKDFP+ GF
Sbjct: 97  EAIPSVTNVYKGANWPEREIYDLFGISFIGHPNLNRILMPDNFQGHPLRKDFPLEGF 153


>gi|317048937|ref|YP_004116585.1| NADH dehydrogenase I subunit D [Pantoea sp. At-9b]
 gi|316950554|gb|ADU70029.1| NADH dehydrogenase I, D subunit [Pantoea sp. At-9b]
          Length = 599

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (62%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            ++ +  FLR  P   +V + DL G+D   R+NR       F V YH LS + NR + +K
Sbjct: 55  QILEVIEFLRKLPKP-YVMLYDLHGMDERLRTNRAGLPAADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    +P+I  I+P A+W+ERE W+M+G+ F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSENDMHLPTITKIFPNANWYERETWEMFGMTFDGHPHLTRIMMPQTWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|229838095|ref|ZP_04458254.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229694461|gb|EEO84508.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis biovar
           Orientalis str. PEXU2]
          Length = 598

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|332971176|gb|EGK10140.1| NADH-quinone oxidoreductase subunit C/D [Psychrobacter sp.
           1501(2011)]
          Length = 596

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (56%), Gaps = 13/152 (8%)

Query: 5   IEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVD 64
           + +LG      F+    F     G  ++ V   DL+ +  FLR  P   +V ++DL  +D
Sbjct: 24  LRELGHKFAGKFTEQFTFD----GIPTIWVSRNDLLEILMFLRTLPKP-YVMLLDLSAID 78

Query: 65  FLSRSNR-------FDVVYHFLSPKYNRRLRVKIAVAEGK-SVPSIVGIYPGADWFEREV 116
              R +R       F V YH +S + N  +R+K+A++E    VP+   I+P A+W+EREV
Sbjct: 79  ERLRKHRDGLPASDFTVFYHLMSLERNSDIRIKVALSEDDLKVPTATKIWPNANWYEREV 138

Query: 117 WDMYGIFFEGHPDLRRILTDYGFEGHPLRKDF 148
           WDM+GI F+GHP L RIL    +EGHPLRK++
Sbjct: 139 WDMFGITFDGHPHLTRILLPKYWEGHPLRKEY 170


>gi|118462470|ref|YP_883187.1| NADH dehydrogenase subunit C [Mycobacterium avium 104]
 gi|218534287|sp|A0QJU9|NUOC_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName:
           Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1
           subunit C
 gi|118163757|gb|ABK64654.1| NADH-quinone oxidoreductase chain c [Mycobacterium avium 104]
          Length = 235

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 73/127 (57%), Gaps = 2/127 (1%)

Query: 29  ELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-FDVVYHFLSPKYNRRL 87
           EL+L VD   L  +   LRDDP   F   + + GV +   + R    VY   S  +NRR+
Sbjct: 90  ELTLHVDRAALPHVAQHLRDDPRLRFEMCLGVSGVHYPHETGRELHAVYPLQSITHNRRV 149

Query: 88  RVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           R+++AV +G   +PS+  IYP  DW ERE +D +GI F+GHP L RI     + GHP RK
Sbjct: 150 RLEVAVPDGDPHIPSLYRIYPTTDWHERETYDFFGIIFDGHPSLTRIEMPDDWHGHPQRK 209

Query: 147 DFPVTGF 153
           D+P+ G 
Sbjct: 210 DYPLGGI 216


>gi|171910633|ref|ZP_02926103.1| NuoC2 NADH I CHAIN C [Verrucomicrobium spinosum DSM 4136]
          Length = 191

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 77/141 (54%), Gaps = 2/141 (1%)

Query: 12  IVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR 71
           +V  F   V       GE SL V    L     + RD+    F  +ID+  VD      R
Sbjct: 10  LVEKFGSQVTGNTEFRGETSLTVTLESLKPFLRYCRDE--MGFDYLIDVSSVDHFETDPR 67

Query: 72  FDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLR 131
           F++VY   S  ++  LRVK  + E +  P++  ++  A+W EREV+DM GI F+GHPDLR
Sbjct: 68  FEMVYELYSLSHHHHLRVKSLLTEEQEAPTVSDLWATAEWHEREVFDMMGIRFDGHPDLR 127

Query: 132 RILTDYGFEGHPLRKDFPVTG 152
           RIL   G+  +PLRK+FP+ G
Sbjct: 128 RILMWEGYPFYPLRKEFPLAG 148


>gi|22125527|ref|NP_668950.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis KIM 10]
 gi|45442153|ref|NP_993692.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51596904|ref|YP_071095.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808040|ref|YP_651956.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis Antiqua]
 gi|108812310|ref|YP_648077.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis Nepal516]
 gi|145599243|ref|YP_001163319.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis Pestoides F]
 gi|149365541|ref|ZP_01887576.1| NADH dehydrogenase I chain C/D [Yersinia pestis CA88-4125]
 gi|153949467|ref|YP_001400435.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pseudotuberculosis IP 31758]
 gi|165925594|ref|ZP_02221426.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937704|ref|ZP_02226266.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008272|ref|ZP_02229170.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213850|ref|ZP_02239885.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399692|ref|ZP_02305216.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422320|ref|ZP_02314073.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424577|ref|ZP_02316330.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170023803|ref|YP_001720308.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pseudotuberculosis YPIII]
 gi|186895985|ref|YP_001873097.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pseudotuberculosis PB1/+]
 gi|218929639|ref|YP_002347514.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           pestis CO92]
 gi|229895294|ref|ZP_04510468.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis
           Pestoides A]
 gi|229898655|ref|ZP_04513800.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902654|ref|ZP_04517771.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis
           Nepal516]
 gi|270490164|ref|ZP_06207238.1| NADH dehydrogenase subunit D [Yersinia pestis KIM D27]
 gi|294504367|ref|YP_003568429.1| NADH dehydrogenase I chain C/D [Yersinia pestis Z176003]
 gi|81639044|sp|Q669A2|NUOCD_YERPS RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|123073346|sp|Q1CHQ3|NUOCD_YERPN RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|123372335|sp|Q1C6B1|NUOCD_YERPA RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|123777025|sp|Q7CJ92|NUOCD_YERPE RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|218534240|sp|A7FGQ7|NUOCD_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|218534241|sp|B2K819|NUOCD_YERPB RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|218534247|sp|A4TM34|NUOCD_YERPP RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|218534346|sp|B1JGL5|NUOCD_YERPY RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|21958426|gb|AAM85201.1|AE013766_4 NADH dehydrogenase I chain C, D [Yersinia pestis KIM 10]
 gi|45437017|gb|AAS62569.1| NADH dehydrogenase I chain C/D [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590186|emb|CAH21823.1| NADH dehydrogenase I chain C/D [Yersinia pseudotuberculosis IP
           32953]
 gi|108775958|gb|ABG18477.1| NADH dehydrogenase I chain C/D [Yersinia pestis Nepal516]
 gi|108779953|gb|ABG14011.1| NADH dehydrogenase I chain C/D [Yersinia pestis Antiqua]
 gi|115348250|emb|CAL21178.1| NADH dehydrogenase I chain C/D [Yersinia pestis CO92]
 gi|145210939|gb|ABP40346.1| NADH dehydrogenase I chain C/D [Yersinia pestis Pestoides F]
 gi|149291954|gb|EDM42028.1| NADH dehydrogenase I chain C/D [Yersinia pestis CA88-4125]
 gi|152960962|gb|ABS48423.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia
           pseudotuberculosis IP 31758]
 gi|165914454|gb|EDR33069.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922703|gb|EDR39854.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992654|gb|EDR44955.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205024|gb|EDR49504.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958826|gb|EDR55847.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167052196|gb|EDR63604.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056459|gb|EDR66228.1| NADH-quinone oxidoreductase, C/D subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750337|gb|ACA67855.1| NADH dehydrogenase I, D subunit [Yersinia pseudotuberculosis YPIII]
 gi|186699011|gb|ACC89640.1| NADH dehydrogenase I, D subunit [Yersinia pseudotuberculosis PB1/+]
 gi|229680101|gb|EEO76200.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis
           Nepal516]
 gi|229688203|gb|EEO80274.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229701780|gb|EEO89805.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis
           Pestoides A]
 gi|262362644|gb|ACY59365.1| NADH dehydrogenase I chain C/D [Yersinia pestis D106004]
 gi|270338668|gb|EFA49445.1| NADH dehydrogenase subunit D [Yersinia pestis KIM D27]
 gi|294354826|gb|ADE65167.1| NADH dehydrogenase I chain C/D [Yersinia pestis Z176003]
 gi|320014609|gb|ADV98180.1| NADH:ubiquinone oxidoreductase, chain C,D [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 598

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQSWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|115378562|ref|ZP_01465717.1| NADH-quinone oxidoreductase chain 5 [Stigmatella aurantiaca
           DW4/3-1]
 gi|115364434|gb|EAU63514.1| NADH-quinone oxidoreductase chain 5 [Stigmatella aurantiaca
           DW4/3-1]
          Length = 181

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 76/129 (58%), Gaps = 4/129 (3%)

Query: 24  VNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSN---RFDVVYHFLS 80
           V+  G     +    L ++ +FL++DP   F   +   GVD L  +    RF+VVY   S
Sbjct: 26  VDRAGGAWAVIHAQHLPAVVAFLKNDPELNFKLFVSADGVDRLHLAENDPRFEVVYFLRS 85

Query: 81  PKYNRRLRVKIAVAE-GKSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGF 139
              N  +R+K+ V E    VPS+V ++ GA+W+ER VWD YGI F GHPDLRRIL    F
Sbjct: 86  LTLNEHVRLKVRVTETNPEVPSLVPLFKGANWWERFVWDFYGIRFTGHPDLRRILMYEEF 145

Query: 140 EGHPLRKDF 148
           +GHPLRKD+
Sbjct: 146 QGHPLRKDY 154


>gi|332162387|ref|YP_004298964.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606466|emb|CBY27964.1| NADH-ubiquinone oxidoreductase chain C; NADH-ubiquinone
           oxidoreductase chain D [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666617|gb|ADZ43261.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330860334|emb|CBX70647.1| NADH-quinone oxidoreductase subunit C/D [Yersinia enterocolitica
           W22703]
          Length = 598

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 9/121 (7%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + SFLR  P   +V + DL GVD   R++R       F V YH LS + NR + +K
Sbjct: 55  QLLEVMSFLRKQPKP-YVMLFDLHGVDERLRTHRQGLPDADFSVFYHLLSIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A++E    V +   I+P A+W+ERE W+M+GI F+GHP L RI+    +EGHPLRKD+P
Sbjct: 114 VALSEKDLHVSTATKIFPNANWYERETWEMFGITFDGHPHLTRIMMPQTWEGHPLRKDYP 173

Query: 150 V 150
            
Sbjct: 174 A 174


>gi|288917185|ref|ZP_06411554.1| NADH (or F420H2) dehydrogenase, subunit C [Frankia sp. EUN1f]
 gi|288351376|gb|EFC85584.1| NADH (or F420H2) dehydrogenase, subunit C [Frankia sp. EUN1f]
          Length = 229

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 81/139 (58%), Gaps = 3/139 (2%)

Query: 19  SVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDLCGVDFLS--RSNRFDVVY 76
           +V   V + GEL++ V    L+ +   LRDDP   F  +  L GVD+       R   V 
Sbjct: 73  AVERVVFAYGELTIHVRRERLLDVAWTLRDDPGLRFELLSSLSGVDYPDDLTGRRLHSVV 132

Query: 77  HFLSPKYNRRLRVKIAVAEG-KSVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILT 135
           H  S  + RRLRV+++VA+G   +PS+  ++P ADW ERE +D++G+ +EGHP L RI+ 
Sbjct: 133 HLTSMTHRRRLRVEVSVADGDPHLPSLTPVWPTADWHEREAYDLFGLVYEGHPGLARIMM 192

Query: 136 DYGFEGHPLRKDFPVTGFV 154
              + GHP RKD+P+ G  
Sbjct: 193 PDDWVGHPQRKDYPLGGIA 211


>gi|310768163|gb|ADP13113.1| bifunctional NADH:ubiquinone oxidoreductase subunit C/D [Erwinia
           sp. Ejp617]
          Length = 616

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 56/153 (36%), Positives = 85/153 (55%), Gaps = 21/153 (13%)

Query: 39  LVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVKI 91
           L+ +  FLR  P   +V + DL G+D   R++R       F V YHF+S + NR + +K+
Sbjct: 73  LLEIVEFLRKLPKP-YVMLYDLHGMDERLRTHRAGLPAADFSVFYHFISIERNRDIMLKV 131

Query: 92  AVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFPV 150
           A++E    VP++  I+P A+W+ERE W+M+GI   GHP L RI+    +EGHPLRKD+P 
Sbjct: 132 ALSENDLHVPTLTKIFPNANWYERETWEMFGIDIVGHPHLTRIMMPQTWEGHPLRKDYP- 190

Query: 151 TGFVELHYDDKVKKVVYRPVELMQEHRDYDFLS 183
                       +   + P EL ++  D +  S
Sbjct: 191 -----------ARATEFDPFELTKQKEDLEMES 212


>gi|253689146|ref|YP_003018336.1| NADH dehydrogenase I, D subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259514705|sp|C6DA44|NUOCD_PECCP RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltName:
           Full=NADH dehydrogenase I subunit C/D; AltName:
           Full=NDH-1 subunit C/D
 gi|251755724|gb|ACT13800.1| NADH dehydrogenase I, D subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 599

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 94/165 (56%), Gaps = 20/165 (12%)

Query: 38  DLVSLCSFLRDDPHCCFVNIIDLCGVDFLSRSNR-------FDVVYHFLSPKYNRRLRVK 90
            L+ + +FL+  P   +V + DL G+D   R++R       + V YH +S + NR + +K
Sbjct: 55  QLLDVVAFLKKQPKP-YVMLFDLHGMDERLRTHREGLPAADYSVFYHIISIERNRDIMLK 113

Query: 91  IAVAEGK-SVPSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRKDFP 149
           +A+AE    VP++  ++P A+W+ERE W+M+GI F GHP L RI+  + +EGHPLRKD+P
Sbjct: 114 VALAESDLHVPTVTKLFPNANWYERETWEMFGITFNGHPHLT