RPSBLAST alignment for GI: 254780854 and conserved domain: pfam00329

>gnl|CDD|144062 pfam00329, Complex1_30kDa, Respiratory-chain NADH dehydrogenase, 30 Kd subunit. Length = 103
 Score =  138 bits (349), Expect = 1e-33
 Identities = 50/107 (46%), Positives = 68/107 (63%), Gaps = 5/107 (4%)

Query: 41  SLCSFLRDDPHCCFVNIIDLCGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAV-AEGKSV 99
            +  FL++D         DL GVD+     RF+VVYH  S     R+R+K+ +  +   +
Sbjct: 1   EVARFLKEDGFDRLS---DLTGVDYPEE-GRFEVVYHLASIGDGERVRLKVKLPRDDPEI 56

Query: 100 PSIVGIYPGADWFEREVWDMYGIFFEGHPDLRRILTDYGFEGHPLRK 146
           PSI  I+PGA+W+EREV+DM+GI FEGHPDLRR+L    + GHPLRK
Sbjct: 57  PSITDIFPGANWYEREVYDMFGIVFEGHPDLRRLLLPEDWPGHPLRK 103