BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780854|ref|YP_003065267.1| NADH dehydrogenase subunit C
[Candidatus Liberibacter asiaticus str. psy62]
         (202 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780854|ref|YP_003065267.1| NADH dehydrogenase subunit C [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 202

 Score =  410 bits (1055), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/202 (100%), Positives = 202/202 (100%)

Query: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60
           MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL
Sbjct: 1   MVRKIEDLGDYIVNSFSGSVRFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCFVNIIDL 60

Query: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120
           CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY
Sbjct: 61  CGVDFLSRSNRFDVVYHFLSPKYNRRLRVKIAVAEGKSVPSIVGIYPGADWFEREVWDMY 120

Query: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180
           GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD
Sbjct: 121 GIFFEGHPDLRRILTDYGFEGHPLRKDFPVTGFVELHYDDKVKKVVYRPVELMQEHRDYD 180

Query: 181 FLSPWEGVNSLFAKEDSKDDMS 202
           FLSPWEGVNSLFAKEDSKDDMS
Sbjct: 181 FLSPWEGVNSLFAKEDSKDDMS 202


>gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 598

 Score = 30.0 bits (66), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 21  RFAVNSVGELSLDVDCGDLVSLCSFLRDDPHCCF 54
           ++   SVG + L+V  G+++S+ S    DPH  F
Sbjct: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAF 311


>gi|254780905|ref|YP_003065318.1| glutamate racemase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 271

 Score = 25.8 bits (55), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 105 IYPGADWFEREVWDMYGIFFEGHPD--LRRILTDYGFEG 141
           + P  +  +  V+D + +F  G PD  +RR++  +G + 
Sbjct: 233 LLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS 271


>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 421

 Score = 23.9 bits (50), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%)

Query: 141 GHPLRKDFPVT--GFVELHYDDKVKKVVYR 168
           G P  KDF V+  G+V++ YDD  +  +YR
Sbjct: 304 GKP--KDFSVSKDGYVDIIYDDGTRVPIYR 331


>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 252

 Score = 21.9 bits (45), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 54  FVNIIDLCGVDFLSRSNRFDVVYHFLSPKY 83
            V   + C    L++ +R++V+Y+F  P Y
Sbjct: 104 LVKATEACAC--LTQYDRYEVIYNFGGPMY 131


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.325    0.144    0.457 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,276
Number of Sequences: 1233
Number of extensions: 6515
Number of successful extensions: 21
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 6
length of query: 202
length of database: 328,796
effective HSP length: 70
effective length of query: 132
effective length of database: 242,486
effective search space: 32008152
effective search space used: 32008152
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 36 (18.5 bits)