>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c

Probab=95.75 E-value=0.042 Score=35.71 Aligned_cols=73 Identities=16% Similarity=0.277 Sum_probs=57.4 Q ss_pred EEEECCCHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCEEEEC----CHHHCCCCHHHHHHHHH Q ss_conf 99961883587708924899999882756475177881899953245667788679985----83414588989999999 Q gi|254780856|r 95 HVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACVNAPMVMIG----KDTYEDLTPERLEEIID 170 (218) Q Consensus 95 ~I~VC~~~~C~l~G~~~l~~~l~~~Lgi~~gett~DG~ftLe~v~CLG~C~~AP~~~Vn----~~~y~~lt~e~~~~il~ 170 (218) T Consensus 2 kI~Vp~Ds~a~A~GAd~Va~ai~~~a~~r~l------~i~ivRnGsrGm~wLEPLvEV~t~~gRv~yGpV~~~dV~~L~d 75 (92) T cd03063 2 RIYVPRDAAALALGADEVAEAIEAEAAARGL------AATIVRNGSRGMYWLEPLVEVETPGGRVAYGPVTPADVASLLD 75 (92) T ss_pred EEEECCCHHHHHCCHHHHHHHHHHHHHHCCC------CEEEEECCCEEEEEECCEEEEECCCCEEEECCCCHHHHHHHHH T ss_conf 5995674887744869999999999997699------5489976760345414258997299758878999899999998 Q ss_pred HHH Q ss_conf 998 Q gi|254780856|r 171 AFS 173 (218) Q Consensus 171 ~Lr 173 (218) T Consensus 76 a~~ 78 (92) T cd03063 76 AGA 78 (92) T ss_pred HCC T ss_conf 165

HHsearch alignment for GI: 254780856 and conserved domain: cd03063