RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780856|ref|YP_003065269.1| NADH-quinone oxidoreductase, E subunit [Candidatus Liberibacter asiaticus str. psy62] (218 letters) >gnl|CDD|144740 pfam01257, Complex1_24kDa, Respiratory-chain NADH dehydrogenase 24 Kd subunit. Length = 145 Score = 221 bits (567), Expect = 1e-58 Identities = 73/147 (49%), Positives = 101/147 (68%), Gaps = 3/147 (2%) Query: 26 VNEVISRYPPSRCQSAVIPLLMRAQEQEGWVSRAAIEVVANILDMAYIRVLEIATFYTQF 85 ++E+I++YP R +SA+IPLL AQEQ G++ AIE +A +L + RV E+ATFY+ F Sbjct: 1 IDEIIAKYP--RKRSALIPLLHLAQEQYGYLPDEAIEYIAELLGIPPARVYEVATFYSMF 58 Query: 86 QLSPVGTRAHVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACV 145 L PVG + H+QVC TTPC LRG ++L+E K+ KP DG + EEVEC GAC Sbjct: 59 NLKPVG-KYHIQVCTTTPCHLRGSDELLEALEEKLGIKPGETTPDGKFTLEEVECLGACG 117 Query: 146 NAPMVMIGKDTYEDLTPERLEEIIDAF 172 NAP++ I D Y DLTPE+++EI++A Sbjct: 118 NAPVMQINDDYYGDLTPEKVDEILEAL 144 >gnl|CDD|32089 COG1905, NuoE, NADH:ubiquinone oxidoreductase 24 kD subunit [Energy production and conversion]. Length = 160 Score = 205 bits (522), Expect = 1e-53 Identities = 74/163 (45%), Positives = 103/163 (63%), Gaps = 3/163 (1%) Query: 14 SSFSFSEESAIWVNEVISRYPPSRCQSAVIPLLMRAQEQEGWVSRAAIEVVANILDMAYI 73 ++F+FS E+ + +I++YP +SA+IPLL AQEQ GW+ AIE +A++L + Sbjct: 1 ATFAFSAENLELIEAIIAKYP--DKRSALIPLLHIAQEQFGWLPPEAIEEIADMLGIPRA 58 Query: 74 RVLEIATFYTQFQLSPVGTRAHVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTL 133 RV +ATFYTQF L PVG R H++VC T C L+G E L++ K+ KP +DG Sbjct: 59 RVYGVATFYTQFFLKPVG-RHHIRVCTGTACHLKGSEALLKALEKKLGIKPGETTADGKF 117 Query: 134 SWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQ 176 + E VEC GAC AP+VMI D Y LTPE+LEEI++ + Sbjct: 118 TLEPVECLGACGQAPVVMINDDVYGRLTPEKLEEILEKLKAKK 160 >gnl|CDD|38406 KOG3196, KOG3196, KOG3196, NADH:ubiquinone oxidoreductase, NDUFV2/24 kD subunit [Energy production and conversion]. Length = 233 Score = 173 bits (439), Expect = 3e-44 Identities = 89/201 (44%), Positives = 119/201 (59%), Gaps = 3/201 (1%) Query: 1 MSVRRLAEEEFQPSSFSFSEESAIWVNEVISRYPPSRCQSAVIPLLMRAQEQEGWVSRAA 60 + V R E F F+ E+ V +++ YP A+IPLL AQ Q GW+ +A Sbjct: 22 LFVHRDTPENNPDLPFEFTPENQKRVKAILAIYPEGHKAGALIPLLDLAQRQHGWLPISA 81 Query: 61 IEVVANILDMAYIRVLEIATFYTQFQLSPVGTRAHVQVCGTTPCMLRGCEKLIEVCRNKI 120 + VA +L++ +RV E+ATFYT F PVG + HVQVC TTPCMLRG + ++E C+ ++ Sbjct: 82 MNEVAEVLEVPPMRVYEVATFYTMFFRKPVG-KYHVQVCTTTPCMLRGSDDILEACKKQL 140 Query: 121 HQKPLHRNSDGTLSWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQGDTI 180 K DG + EEVEC GACVNAPM+ I D YEDLTP++L EI++ G Sbjct: 141 GIKVGETTKDGLFTLEEVECLGACVNAPMIAINDDYYEDLTPKKLVEILEDLK--AGKKP 198 Query: 181 RPGPQIDRISSAPAGGLTSLL 201 GP+ R +S P GGLTSL Sbjct: 199 PAGPRNGRFASEPKGGLTSLK 219 >gnl|CDD|48613 cd03064, TRX_Fd_NuoE, TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily; Nuo, also called respiratory chain Complex 1, is the entry point for electrons into the respiratory chains of bacteria and the mitochondria of eukaryotes. It is a multisubunit complex with at least 14 core subunits. It catalyzes the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane, providing the proton motive force required for energy-consuming processes. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE core subunit, also called the 24 kD subunit of Complex 1. This subfamily also include formate dehydrogenases, NiFe hydrogenases and NAD-reducing hydrogenases, that contain a NuoE domain. A subset of these proteins contain both NuoE and NuoF in a single chain. NuoF, also called the 51 kD subunit of Complex 1, contains one [4Fe-4S] cluster and also binds the NADH substrate and FMN.. Length = 80 Score = 102 bits (256), Expect = 8e-23 Identities = 35/80 (43%), Positives = 48/80 (60%) Query: 93 RAHVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACVNAPMVMI 152 + ++VC T C LRG E L+E K+ KP DG + EEVEC GAC AP++MI Sbjct: 1 KHVIRVCTGTACHLRGAEALLEALEKKLGIKPGETTPDGRFTLEEVECLGACDLAPVMMI 60 Query: 153 GKDTYEDLTPERLEEIIDAF 172 D Y LTPE+++ I++A Sbjct: 61 NDDVYGRLTPEKVDAILEAL 80 >gnl|CDD|48529 cd02980, TRX_Fd_family, Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE). TRX-like Fds are soluble low-potential electron carriers containing a single [2Fe-2S] cluster. The exact role of TRX-like Fd is still unclear. It has been suggested that it may be involved in nitrogen fixation. Its homologous domains in large redox enzymes (such as Nuo and hydrogenases) function as electron carriers.. Length = 77 Score = 74.2 bits (182), Expect = 2e-14 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 6/80 (7%) Query: 94 AHVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACVNAPMVMI- 152 H+ VC T C LRG E+L+E ++ + DG ++ E V C GAC AP+V++ Sbjct: 1 HHILVCTGTACGLRGAEELLEALEKELGIRGG----DGRVTVERVGCLGACGLAPVVVVY 56 Query: 153 -GKDTYEDLTPERLEEIIDA 171 Y +TPE +EEI++ Sbjct: 57 PDGVWYGRVTPEDVEEIVEE 76 >gnl|CDD|48630 cd03081, TRX_Fd_NuoE_FDH_gamma, TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, NAD-dependent formate dehydrogenase (FDH) gamma subunit; composed of proteins similar to the gamma subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD+ to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH gamma subunit is closely related to NuoE, which is part of a multisubunit complex (Nuo) catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE. Similarly, the FDH gamma subunit is hypothesized to be involved in an electron transport chain involving other FDH subunits, upon the oxidation of formate.. Length = 80 Score = 52.2 bits (125), Expect = 1e-07 Identities = 18/79 (22%), Positives = 36/79 (45%) Query: 93 RAHVQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACVNAPMVMI 152 R +++C C G E L + ++ +DG+++ E V C G C +P MI Sbjct: 1 RHVLKLCRAEACQAMGAEALAAHIKARLGIDFHETTADGSVTLEPVYCLGLCACSPAAMI 60 Query: 153 GKDTYEDLTPERLEEIIDA 171 + + + PE+ + ++ Sbjct: 61 DGEVHGRVDPEKFDALLAE 79 >gnl|CDD|48632 cd03083, TRX_Fd_NuoE_hoxF, TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, hoxF; composed of proteins similar to the NAD-reducing hydrogenase (hoxS) alpha subunit of Alcaligenes eutrophus H16. HoxS is a cytoplasmic hydrogenase catalyzing the oxidation of molecular hydrogen accompanied by the reduction of NAD. It is composed of four structural subunits encoded by the genes hoxF, hoxU, hoxY and hoxH. The hoxF protein (or alpha subunit) is a fusion protein containing an N-terminal NuoE-like domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. HoxF may be involved in the electron transport chain during the NAD-dependent oxidation of hydrogen through its NuoF domain. The NuoE-like domain of hoxF contains only one conserved cysteine in its putative active site, compared to four cysteines in NuoE, and may have lost the ability to bind [2Fe-2S] clusters.. Length = 80 Score = 32.2 bits (73), Expect = 0.12 Identities = 12/42 (28%), Positives = 20/42 (47%) Query: 129 SDGTLSWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIID 170 DG + C G C P ++I + LTP R+++I + Sbjct: 37 EDGMVGLFFTSCTGLCDQGPALLINNRVFTRLTPGRIDQIAE 78 >gnl|CDD|30533 COG0184, RpsO, Ribosomal protein S15P/S13E [Translation, ribosomal structure and biogenesis]. Length = 89 Score = 28.6 bits (64), Expect = 1.3 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Query: 160 LTPERLEEIIDAFSTGQGDTIRPGPQIDRISSAPAGGLTSLLDNNSK----KRGKKKKDD 215 LT E +E+ D + + DT Q+ + + LT L + K +RG Sbjct: 3 LTSEIKQELRDEYGIPEVDTGSGEVQL-ALLTERINNLTEHLKEHKKDHHSRRGLLLLVS 61 Query: 216 KI 217 K Sbjct: 62 KR 63 >gnl|CDD|48631 cd03082, TRX_Fd_NuoE_W_FDH_beta, TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E family, Tungsten-containing formate dehydrogenase (W-FDH) beta subunit; composed of proteins similar to the W-FDH beta subunit of Methylobacterium extorquens. W-FDH is a heterodimeric NAD-dependent enzyme catalyzing the conversion of formate to carbon dioxide. The beta subunit is a fusion protein containing an N-terminal NuoE domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. Similarly, the beta subunit of W-FDH is most likely involved in the electron transport chain during the NAD-dependent oxidation of formate.. Length = 72 Score = 27.6 bits (61), Expect = 3.0 Identities = 16/76 (21%), Positives = 30/76 (39%), Gaps = 8/76 (10%) Query: 96 VQVCGTTPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWEEVECQGACVNAPMVMIGKD 155 V+VC + C + G E+L+ + + C G C AP ++G+ Sbjct: 4 VRVCDSLSCAMAGAEELLAALEAGL--------GPEGVRVVRAPCVGRCERAPAALVGQR 55 Query: 156 TYEDLTPERLEEIIDA 171 + TP + ++A Sbjct: 56 PVDGATPAAVAAAVEA 71 >gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription]. Length = 1640 Score = 26.5 bits (58), Expect = 6.4 Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 134 SWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFST 174 W E++ + AC + + D Y E+ + ID F Sbjct: 1081 MWFELDKKIACPDPVLAKYNPDKYLGSVSEKFRKKIDDFDD 1121 >gnl|CDD|29278 cd00227, CPT, Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.. Length = 175 Score = 26.5 bits (58), Expect = 6.5 Identities = 8/66 (12%), Positives = 23/66 (34%) Query: 138 VECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQGDTIRPGPQIDRISSAPAGGL 197 + + P + G D++ + P + ++ + PGP+ + A + Sbjct: 19 ARALQSVLAEPWLHFGVDSFIEALPLKCQDAEGGIEFDGDGGVSPGPEFRLLEGAWYEAV 78 Query: 198 TSLLDN 203 ++ Sbjct: 79 AAMARA 84 >gnl|CDD|31633 COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]. Length = 758 Score = 26.1 bits (57), Expect = 6.9 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 155 DTYEDLTPERLEEIIDAFSTGQGDTIR-PGPQIDRISSAPAGGLT 198 DTY DL PE +++ + D G Q+DR+ +G + Sbjct: 635 DTYRDLEPELARLLLENATLSDDDWPELTGFQLDRLELYASGPVL 679 >gnl|CDD|147007 pfam04637, Herpes_pp85, Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV UL25). This family includes UL25 proteins from HCMV, as well as U14 proteins from HHV 6 and HHV7. These 85 kD phosphoproteins appear to act as structural antigens, but their precise function is otherwise unknown. Length = 502 Score = 25.8 bits (57), Expect = 8.6 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Query: 129 SDGTLSWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQGDTIRPGPQID 187 +DG ++ E Q +V+ G LTPE+LEE +D G P D Sbjct: 401 TDGQITVEHYPLQSTYE---LVLEGAARQTGLTPEQLEEYLDRAPLGAEVEDGLEPPAD 456 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.393 Gapped Lambda K H 0.267 0.0685 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,656,949 Number of extensions: 132802 Number of successful extensions: 291 Number of sequences better than 10.0: 1 Number of HSP's gapped: 284 Number of HSP's successfully gapped: 17 Length of query: 218 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 128 Effective length of database: 4,318,927 Effective search space: 552822656 Effective search space used: 552822656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.1 bits)