RPSBLAST alignment for GI: 254780858 and conserved domain: TIGR01945

>gnl|CDD|162617 TIGR01945, rnfC, electron transport complex, RnfABCDGE type, C subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the C subunit. Length = 435
 Score = 48.1 bits (115), Expect = 4e-06
 Identities = 58/264 (21%), Positives = 103/264 (39%), Gaps = 57/264 (21%)

Query: 36  LEKGRDW-------IINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESE 88
           LE   D+       I+ +++A+G+ G GGA F T +K +  P+    +   L++N  E E
Sbjct: 110 LEPIPDFENLSPEEILEKIRAAGIVGLGGATFPTHVKLNPPPE---KKIETLIINGAECE 166

Query: 89  PG-TCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASG 147
           P  TC DR +MR     +I G  I    +G     I +         +L+ A+       
Sbjct: 167 PYLTCDDR-LMRERAEEIIGGIRILLKILGVKKVVIGIEDNKPEAIAALKKALG------ 219

Query: 148 LLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGK---KGQPRLKPPFPANVGLYGC 204
                   GY++ + V      Y  G E  L+ +L G+    G        PA++G+   
Sbjct: 220 --------GYNIKVRVL--PTKYPQGGEKQLIYALTGREVPSGG------LPADIGV--- 260

Query: 205 PTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGH-VNYPCTVEESMSITFD 263
              V NV +   +   +  G               ++ +++G  +  P  +   +     
Sbjct: 261 --VVQNVGTAFAIYEAVVNGKPLIE----------RVVTVTGDAIRRPKNLWVLIGTPVS 308

Query: 264 ELIEKHCGGIRGGWDNLLAVIPGG 287
           +++   CGG R   +    +I GG
Sbjct: 309 DILA-FCGGFR---EKPERLIMGG 328