RPSBLAST alignment for GI: 254780858 and conserved domain: COG1894

>gnl|CDD|32078 COG1894, NuoF, NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Energy production and conversion]. Length = 424
 Score =  647 bits (1671), Expect = 0.0
 Identities = 249/422 (59%), Positives = 303/422 (71%), Gaps = 6/422 (1%)

Query: 1   MLTDQDR-IFTNLYGLQGKSLSDSMSRGHWDNVDKIL-EKGRDWIINEVKASGLRGRGGA 58
            L +QDR  F NL      SL + ++RG ++ + K L E G D II EVK SGLRGRGGA
Sbjct: 5   FLKNQDRITFRNLGDPDPWSLDEYLARGGYEGLRKALTEMGPDEIIEEVKESGLRGRGGA 64

Query: 59  GFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGA 118
           GF TG+KWSFMPK  SD+  YLV NADE EPGT KDR IM  +PH LIEG +IA++A+GA
Sbjct: 65  GFPTGLKWSFMPKATSDQ-KYLVCNADEGEPGTFKDRLIMEGDPHLLIEGMIIAAYAVGA 123

Query: 119 HCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSK-LGYDVDIIVHHGAGAYICGEETA 177
              +IY+RGE+    E LQ A++E YA+GLLG N    G+D D+ VHHGAGAYICGEETA
Sbjct: 124 TKGYIYIRGEYPEAIERLQKAIEEAYAAGLLGKNILGSGFDFDLYVHHGAGAYICGEETA 183

Query: 178 LLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNR 237
           LLESLEGK+GQPRLKPPFPA  GLYG PT +NNVE++A VP I+RRGA W+   G+ N+R
Sbjct: 184 LLESLEGKRGQPRLKPPFPATSGLYGKPTVINNVETLANVPAIIRRGADWFRSIGKPNSR 243

Query: 238 GTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQ 297
           GTKLFS+SGHV  P   E  M  T  ELIE + GG+RGGW  L AV PGG S PCLP  +
Sbjct: 244 GTKLFSLSGHVKNPGLYEVPMGTTLRELIEDYAGGVRGGW-KLKAVQPGGPSGPCLPE-E 301

Query: 298 MRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGW 357
           +    MDYD L + GS LGT  +IVMD ST ++KA  RLS FYKHESCG+CTPCREGTGW
Sbjct: 302 LLDTPMDYDSLAKAGSMLGTGGIIVMDDSTCMVKAARRLSEFYKHESCGKCTPCREGTGW 361

Query: 358 MMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERID 417
           M+R++ERLV+G  Q  ++DLL ++   I+G+T CALGDAAAWP+Q  +++FR   E  I 
Sbjct: 362 MVRILERLVRGEGQPEDLDLLEDLCNQIKGKTFCALGDAAAWPVQSALRHFRDEFEAHIK 421

Query: 418 QY 419
             
Sbjct: 422 VG 423