RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780860|ref|YP_003065273.1| NADH dehydrogenase subunit H [Candidatus Liberibacter asiaticus str. psy62] (348 letters) >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} (A:43-227,A:291-377) Length = 272 Score = 27.1 bits (59), Expect = 4.0 Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 262 MCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQ 317 + + +I F G W F+ K F+ + M V +PR++ ++ Sbjct: 143 LVLVNAIYFKGQWEKKFNKEDTKEEK-FWPNKNTYKSIQMMRQYVDLHLPRFKVEE 197 >2ex2_A Penicillin-binding protein 4; cephem, penem, D- alanyl-D-alanine-carboxypeptidase, D-alanyl-D-alanine- endopeptidase, hydrolase; 1.55A {Escherichia coli} (A:60-137,A:231-275) Length = 123 Score = 26.3 bits (58), Expect = 6.1 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Query: 91 SVILSLSAWAVVPVADGWIIADINVGILYILAI--SSLEIYGIIIGG 135 +V++ S +A A GW D++ G Y AI L+ GI G Sbjct: 56 NVLIDTSIFASHDKAPGWPWNDMD-GASYAGAILKYELKQAGITWSG 101 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 25.9 bits (57), Expect = 9.3 Identities = 6/16 (37%), Positives = 10/16 (62%), Gaps = 3/16 (18%) Query: 14 FMAIKS---IVFLVGL 26 M+I+S +VF G+ Sbjct: 5 VMSIESLVEVVFYRGM 20 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.332 0.146 0.455 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,648,868 Number of extensions: 115107 Number of successful extensions: 284 Number of sequences better than 10.0: 1 Number of HSP's gapped: 283 Number of HSP's successfully gapped: 19 Length of query: 348 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 259 Effective length of database: 1,947,404 Effective search space: 504377636 Effective search space used: 504377636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 55 (25.2 bits)