HHsearch alignment for GI: 254780861 and conserved domain: PRK09477

>PRK09477 napH quinol dehydrogenase membrane component; Provisional.
Probab=96.14  E-value=0.00077  Score=43.34  Aligned_cols=44  Identities=30%  Similarity=0.574  Sum_probs=29.8

Q ss_pred             CCHHHHHHCCCCCCCCCCCCCCCEEEEEE-EEEHHHCCCCCCCHHHCCCCE
Q ss_conf             22325330883210122454473357788-850555586887233378310
Q gi|254780861|r   68 LCEAICPAQAITIESGPRCHDGTRRTVRY-DIDMIKCIYCGLCQEACPVDA  117 (163)
Q Consensus        68 ~C~~~CP~~aI~i~~~~~~~~~~~~~~~~-~id~~~Ci~Cg~Cv~vCP~~A  117 (163)
T Consensus       196 wC~~lCP~Gaf~sl~------~~~s~~rv~~~~~~~C~~C~~C~~VCP~~~  240 (287)
T PRK09477        196 WCGHLCPLGAFYGLI------GKKSLIRVKAHDREKCTRCMDCFHVCPEPQ  240 (287)
T ss_pred             HHHCCCCHHHHHHHH------HHCCCEEECCCCCCCCCCCCHHHHHCCCCC
T ss_conf             997549689999998------405754752578875809235767579954