>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit. Indolepyruvate ferredoxin oxidoreductase (IOR) is an alpha 2/beta 2 tetramer related to ketoacid oxidoreductases for pyruvate (1.2.7.1, POR), 2-ketoglutarate (1.2.7.3, KOR), and 2-oxoisovalerate (1.2.7.7, VOR). These multi-subunit enzymes typically are found in anaerobes and are inactiviated by oxygen. IOR in Pyrococcus acts in fermentation of all three aromatic amino acids, following removal of the amino group by transamination. In Methanococcus maripaludis, by contrast, IOR acts in the opposite direction, in pathways of amino acid biosynthesis from phenylacetate, indoleacetate, and p-hydroxyphenylacetate. In M. maripaludis and many other species, iorA and iorB are found next to an apparent phenylacetate-CoA ligase.

Probab=98.50 E-value=4.5e-08 Score=69.29 Aligned_cols=46 Identities=48% Similarity=1.003 Sum_probs=35.3 Q ss_pred CCCCCEECCCCHH--HHHHCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCCCCHHHCCCCEE Q ss_conf 8742213452232--53308832101224544733577888505555868872333783103 Q gi|254780861|r 59 GEERCIACKLCEA--ICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAI 118 (163) Q Consensus 59 ~~ekCi~C~~C~~--~CP~~aI~i~~~~~~~~~~~~~~~~~id~~~Ci~Cg~Cv~vCP~~AI 118 (163) T Consensus 548 n~~vC~gCg~C~~~s~Cp--ai~~~------~~-k----~~id~-~Cngc~~C~~~CP~~AI 595 (595) T TIGR03336 548 DQDKCIGCKKCIKELGCP--AIEPE------DK-E----AVIDP-LCTGCGVCAQICPFDAI 595 (595) T ss_pred CHHHCCCCCCCCCCCCCC--EEEEC------CC-E----EEECC-CCCCCCCHHHHCCCCCC T ss_conf 353278840003343782--17735------99-0----78885-05497744654889879

HHsearch alignment for GI: 254780861 and conserved domain: TIGR03336