BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] (163 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Score = 337 bits (864), Expect = 6e-95, Method: Compositional matrix adjust. Identities = 163/163 (100%), Positives = 163/163 (100%) Query: 1 MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGE 60 MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGE Sbjct: 1 MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGE 60 Query: 61 ERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVE 120 ERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVE Sbjct: 61 ERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVE 120 Query: 121 GPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR 163 GPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR Sbjct: 121 GPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR 163 >gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 29.6 bits (65), Expect = 0.031, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 13/60 (21%) Query: 61 ERCIACKL--CEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAI 118 E CI CK C +CP ++G I +CI CG+C+ CPVDAI Sbjct: 7 ENCILCKHTDCVEVCPVDCF--------YEGENFLA---IHPDECIDCGVCEPECPVDAI 55 Score = 29.6 bits (65), Expect = 0.032, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Query: 47 FRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGP 84 + GE+ L +P+ CI C +CE CP AI ++ P Sbjct: 27 YEGENFLAIHPD---ECIDCGVCEPECPVDAIKPDTEP 61 Score = 24.6 bits (52), Expect = 0.98, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Query: 103 CIYCGL--CQEACPVDAIVEGPNF 124 CI C C E CPVD EG NF Sbjct: 9 CILCKHTDCVEVCPVDCFYEGENF 32 >gi|254781044|ref|YP_003065457.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 259 Score = 23.1 bits (48), Expect = 2.9, Method: Compositional matrix adjust. Identities = 12/63 (19%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Query: 15 EFVGAFFLCLRYFFKAKTTINYPFEKGSTSP--RFRGEHALRRYPNGEERCIACKLCEAI 72 + + + +F+ +I + S P H R+ +G C+ C C Sbjct: 120 SVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTS 179 Query: 73 CPA 75 CP+ Sbjct: 180 CPS 182 >gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] Length = 143 Score = 22.3 bits (46), Expect = 4.4, Method: Compositional matrix adjust. Identities = 7/20 (35%), Positives = 11/20 (55%) Query: 66 CKLCEAICPAQAITIESGPR 85 C +C CP + I++ PR Sbjct: 88 CAVCSMPCPVSLMAIKANPR 107 >gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 21.6 bits (44), Expect = 8.3, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 88 DGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVE 120 DG RTV D K ++ + C +DA++E Sbjct: 84 DGYPRTV----DQAKSLHAFISNMDCAIDAVIE 112 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.143 0.465 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,123 Number of Sequences: 1233 Number of extensions: 3972 Number of successful extensions: 14 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 8 length of query: 163 length of database: 328,796 effective HSP length: 67 effective length of query: 96 effective length of database: 246,185 effective search space: 23633760 effective search space used: 23633760 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 35 (18.1 bits)