BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780862|ref|YP_003065275.1| NADH dehydrogenase subunit J [Candidatus Liberibacter asiaticus str. psy62] (199 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780862|ref|YP_003065275.1| NADH dehydrogenase subunit J [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 390 bits (1001), Expect = e-110, Method: Compositional matrix adjust. Identities = 199/199 (100%), Positives = 199/199 (100%) Query: 1 MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLV 60 MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLV Sbjct: 1 MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLV 60 Query: 61 VYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGE 120 VYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGE Sbjct: 61 VYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGE 120 Query: 121 LSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQL 180 LSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQL Sbjct: 121 LSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQL 180 Query: 181 ESNPDNSIVMVKVKSGKGI 199 ESNPDNSIVMVKVKSGKGI Sbjct: 181 ESNPDNSIVMVKVKSGKGI 199 >gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 23.1 bits (48), Expect = 3.9, Method: Compositional matrix adjust. Identities = 10/48 (20%), Positives = 24/48 (50%) Query: 9 YLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAM 56 +L+ +I+ F + R P ++ ++ F+N + ++G FV + Sbjct: 87 FLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQI 134 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 22.7 bits (47), Expect = 4.9, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 25 VRNPIYSVFSLIFAFVNAAGLFL 47 +NPI+ ++SLI V AA L L Sbjct: 67 TQNPIFPMWSLITLAVYAANLSL 89 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.147 0.408 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,147 Number of Sequences: 1233 Number of extensions: 4346 Number of successful extensions: 19 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 7 length of query: 199 length of database: 328,796 effective HSP length: 70 effective length of query: 129 effective length of database: 242,486 effective search space: 31280694 effective search space used: 31280694 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 36 (18.5 bits)