BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780863|ref|YP_003065276.1| hypothetical protein CLIBASIA_03790 [Candidatus Liberibacter asiaticus str. psy62] (33 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780863|ref|YP_003065276.1| hypothetical protein CLIBASIA_03790 [Candidatus Liberibacter asiaticus str. psy62] gi|254040540|gb|ACT57336.1| hypothetical protein CLIBASIA_03790 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 34.5 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY 33 MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY Sbjct: 1 MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY 33 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.337 0.154 0.425 Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 497,815,889 Number of Sequences: 14124377 Number of extensions: 15100239 Number of successful extensions: 101277 Number of sequences better than 10.0: 206 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 101072 Number of HSP's gapped (non-prelim): 207 length of query: 33 length of database: 4,842,793,630 effective HSP length: 8 effective length of query: 25 effective length of database: 4,729,798,614 effective search space: 118244965350 effective search space used: 118244965350 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 76 (33.6 bits)