BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780863|ref|YP_003065276.1| hypothetical protein
CLIBASIA_03790 [Candidatus Liberibacter asiaticus str. psy62]
         (33 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780863|ref|YP_003065276.1| hypothetical protein CLIBASIA_03790 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040540|gb|ACT57336.1| hypothetical protein CLIBASIA_03790 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 33

 Score = 34.5 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 1  MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY 33
          MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY
Sbjct: 1  MNIGLSHYLIVSAVIFIIGSSGVFLIVKVLLRY 33


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.337    0.154    0.425 

Lambda     K      H
   0.267   0.0499    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 497,815,889
Number of Sequences: 14124377
Number of extensions: 15100239
Number of successful extensions: 101277
Number of sequences better than 10.0: 206
Number of HSP's better than 10.0 without gapping: 204
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 101072
Number of HSP's gapped (non-prelim): 207
length of query: 33
length of database: 4,842,793,630
effective HSP length: 8
effective length of query: 25
effective length of database: 4,729,798,614
effective search space: 118244965350
effective search space used: 118244965350
T: 11
A: 40
X1: 16 ( 7.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 76 (33.6 bits)