RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780864|ref|YP_003065277.1| NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|180218 PRK05715, PRK05715, NADH:ubiquinone oxidoreductase subunit K; Validated. Length = 100 Score = 93.3 bits (233), Expect = 1e-20 Identities = 41/68 (60%), Positives = 55/68 (80%) Query: 1 MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISV 60 MSIELML AVNLN ++FS+Y+ D+ GQ+F+ F++ VAAAE +IGLAIL+ YR G+I V Sbjct: 33 MSIELMLNAVNLNFVAFSSYLGDLDGQVFAFFVITVAAAEAAIGLAILLQLYRNRGTIDV 92 Query: 61 DDFNQMKG 68 DD N++KG Sbjct: 93 DDLNELKG 100 >gnl|CDD|131077 TIGR02022, hutF, formiminoglutamate deiminase. In some species, histidine utilization goes via urocanate to glutamate in four step, the last being removal of formamide. This model describes an alternate fourth step, formiminoglutamate hydrolase, which leads to N-formyl-L-glutamate. This product may be acted on by formylglutamate amidohydrolase (TIGR02017) and bypass glutamate as a product during its degradation. Alternatively, removal of formate (by EC 3.5.1.68) would yield glutamate. Length = 455 Score = 26.3 bits (58), Expect = 2.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 34 LLVAAAETSIGLAILVIFYRKCG 56 + AAA+ IGL +L +FY G Sbjct: 142 IAAAAADAGIGLTLLPVFYAHSG 164 >gnl|CDD|151313 pfam10864, DUF2663, Protein of unknown function (DUF2663). Some members in this family of proteins are annotated as YpbF however currently no function is known. Length = 131 Score = 24.2 bits (53), Expect = 7.4 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 5 LMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRK 54 + L A SF++++ I LF LL+AA S G A V F +K Sbjct: 36 IYLYAKVTGSYSFTSFLSAILASPVHLFWLLLAA--LSYGTA--VYFKKK 81 >gnl|CDD|184821 PRK14788, PRK14788, lipoprotein signal peptidase; Provisional. Length = 200 Score = 24.2 bits (53), Expect = 7.9 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 24 ISGQIFSLF--ILLVAAAETSIGLAILVIFYRKCGSISVD 61 G+ F F + +A + SIG+ +L++F +K +D Sbjct: 161 WGGEHFVFFKPVFNIADSAISIGVILLLLFNKKAFPEPLD 200 >gnl|CDD|181712 PRK09229, PRK09229, N-formimino-L-glutamate deiminase; Validated. Length = 456 Score = 24.0 bits (53), Expect = 9.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 34 LLVAAAETSIGLAILVIFY 52 ++ AA IGL +L + Y Sbjct: 142 IVAAARAAGIGLTLLPVLY 160 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.330 0.141 0.381 Gapped Lambda K H 0.267 0.0668 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,028,012 Number of extensions: 49896 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's gapped: 140 Number of HSP's successfully gapped: 21 Length of query: 68 Length of database: 5,994,473 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,151,761 Effective search space: 149401069 Effective search space used: 149401069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.2 bits)