RPSBLAST alignment for GI: 254780865 and conserved domain: MTH00151

>gnl|CDD|177208 MTH00151, ND5, NADH dehydrogenase subunit 5; Provisional. Length = 565
 Score =  246 bits (631), Expect = 1e-65
 Identities = 145/427 (33%), Positives = 220/427 (51%), Gaps = 44/427 (10%)

Query: 88  SVMFV-VVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWE 146
           S+ F  VV  IS  V ++S  YM +DP   RF   +  F  +M +L+   +L  +  GW+
Sbjct: 56  SLSFSGVVCLISGCVFLFSSSYMSEDPFLKRFMWLVMLFVLSMNLLIFIPSLPSLLLGWD 115

Query: 147 GVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNA 206
           G+G+ S+ L+ ++  K+S + A M   + NRIGD+ ++L+I                   
Sbjct: 116 GLGIVSFALVIYYQNKKS-LSAGMLTALTNRIGDVLILLSI------------------- 155

Query: 207 SHYWKIGNSVSSGMVSHRSFSFFGI-DVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPD 265
                      + +V    +S   + D         + LL  L AM KSAQ+    WLP 
Sbjct: 156 -----------ALLVLLGHWSILSMWDFKL---SGWLGLLLVLAAMTKSAQIPFSSWLPA 201

Query: 266 AMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQ 325
           AM  PTPVSAL+H++T+VTAGVFL+ R  P    S      +  +  +T   A      +
Sbjct: 202 AMAAPTPVSALVHSSTLVTAGVFLLIRFFPFLSSSSGFSSFLLFISLLTLLMAGISACYE 261

Query: 326 HDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQD 385
           +D+K++IA ST SQLG M  +LG      ++FHL+THA FKALLFL +GS+IH+ +G QD
Sbjct: 262 NDLKKIIALSTLSQLGVMMFSLGLGMPSLALFHLYTHALFKALLFLCAGSIIHSSSGTQD 321

Query: 386 MRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVF 445
           +R +G L+  LP T   + + +L+L G          SGF+SKD+ILE +  S     + 
Sbjct: 322 IRLLGSLFLSLPLTSGCLNISSLSLCGAP------FLSGFYSKDLILESSLMSPTSLLMV 375

Query: 446 FLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFI 505
            L+     LT+ YS RL F   +G M+     S K  E   V  +P+ +L++G++  G +
Sbjct: 376 LLMFVGVGLTALYSARLSFCLVWGSMKSSSLSS-KSDEDFYVS-LPMLLLSLGALIGGKL 433

Query: 506 FHDVFFG 512
              +F G
Sbjct: 434 LQSLFEG 440