HHsearch alignment for GI: 254780868 and conserved domain: COG0095

>COG0095 LplA Lipoate-protein ligase A [Coenzyme metabolism].
Probab=95.42  E-value=0.071  Score=31.24  Aligned_cols=134  Identities=19%  Similarity=0.170  Sum_probs=73.8

Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHCCCCCE-EEEEECCCEEEECCC
Q ss_conf             9998244678367998531663333413223532240002101377999999999974454210-246214650671022
Q gi|254780868|r   42 WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRK  120 (252)
Q Consensus        42 ~v~A~~Qt~GrGr~gr~W~s~~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~~l~~~~~~~~~-~~iKWPNDi~~~~kK  120 (252)
T Consensus        66 i~vvRR~sGGG-----aV~hd~g~l~~S~i~~~~~~~~~~~~~~~~~~~~~~~~l~~lg---v~~~~~~~~nDl~v~gkK  137 (248)
T COG0095          66 IPVVRRPSGGG-----AVFHDLGNLNYSVITPDEGGLESYETLYKFLLQPVIDALRALG---VEGAECPGRNDLVVDGKK  137 (248)
T ss_pred             CCEEEECCCCC-----EEEECCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHC---CCEECCCCCCCEEECCEE
T ss_conf             84799637997-----4895489789999978986433499999999999999999848---750016898757884789


Q ss_pred             CCCCCCCCCCCCCCCEE--EEEECCCC-----CCCCCCC--------CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             11222233232258326--76521544-----4446422--------336532100236778978999877799999999
Q gi|254780868|r  121 IAGILIETLNLKNGLQA--VVVGIGLN-----VKHCPVD--------TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD  185 (252)
Q Consensus       121 i~GIL~E~~~~~~~~~~--~viGiGiN-----i~~~~~~--------~~~~~tsL~~~~~~~~~~~l~~~l~~~l~~~~~  185 (252)
T Consensus       138 isG~Aq~-~~~~~~l~hgtll~~~d~~~l~~~l~~~~~k~~~k~~~s~~~rv~~l~~~-~~~~~~e~~~~l~~~f~~~~~  215 (248)
T COG0095         138 ISGSAQR-RTKGRILHHGTLLLDIDLELLARVLRVPKEKIKSKGIKSVRERVANLEEL-LKISVEEFLEALLEAFFKVLG  215 (248)
T ss_pred             EEEEHHH-HHCCCEEEEEEEEECCCHHHHHHHCCCCHHHCCCCCCCCHHHHCCHHHHC-CCCCHHHHHHHHHHHHHHHCC
T ss_conf             9883676-60890688889997388899998528870321343346678861015541-698999999999999987637