HHsearch alignment for GI: 254780868 and conserved domain: PRK06955

>PRK06955 biotin--protein ligase; Provisional.
Probab=100.00  E-value=0  Score=413.47  Aligned_cols=238  Identities=30%  Similarity=0.443  Sum_probs=206.8

Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHC------CCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHCCC
Q ss_conf             9970499981648568999999973------99997899982446783679985316633-3341322353224000210
Q gi|254780868|r   11 PYSFRYEFFDTISSTNDECMKRALS------GDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTL   83 (252)
Q Consensus        11 p~~~~i~~~~~~~STn~~~~~~~~~------~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G-~l~~S~~~~~~~~~~~~~~   83 (252)
T Consensus        30 ~~~~~~~v~~~~~STN~~l~~~~~~~~~~~~~~~~g~vvvAe~QTaGRGR~GR~W~Sp~g~~L~~Sl~l~~~~~~~~~~~  109 (300)
T PRK06955         30 ARAWPLEIVEETGSTNADLMARLKALPRSADALPAPIVRVAYEQTAGRGRQGRPWFAQPGNALLFSVACVLPRPVAALAG  109 (300)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHH
T ss_conf             68855999946587599999987633234458997659998854668899979054989998899998459989677522


Q ss_pred             HHHHHHHHHHHHHHHHCC-CCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCC---C-----
Q ss_conf             137799999999997445-4210246214650671022112222332322583267652154444464223---3-----
Q gi|254780868|r   84 LSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDT---P-----  154 (252)
Q Consensus        84 l~~~~~~ai~~~l~~~~~-~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~~~---~-----  154 (252)
T Consensus       110 Lsl~~glAv~~al~~~~~~~~~~v~LKWPNDIlv~gkKlaGIL~E~~~~~~~~~~vVIGIGINv~~~~~~~~~~~~~~~~  189 (300)
T PRK06955        110 LSLAVGVALAEALAALPAALGGRIALKWPNDLLIAGRKLAGILIETVWATPDATAVVIGIGLNVRRADALAAAVGALRAG  189 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHEECCCEEEEEEEEEECCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             69999999999999865204861001177442466834368853421157886189999999617786421111321235


Q ss_pred             -------CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECC-EEEEEEEEE
Q ss_conf             -------653210023677897899987779999999987303556488999998752389779999799-389999998
Q gi|254780868|r  155 -------YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSY-GSILGRFVG  226 (252)
Q Consensus       155 -------~~~tsL~~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~gk~V~i~~~~-~~~~G~~~g  226 (252)
T Consensus       190 ~~~~~~~~~~~~~~~~~~~~~~~~ll~~ll~~l~~~~~~~~~-~g~~~~~~~w~~~~~~~G~~V~v~~~g~~~~~G~a~G  268 (300)
T PRK06955        190 VATLASGLPPAALSAACAGANLTDTLAAALNALAPALAAFGA-DGLAPFAARWHALHAYAGREVVLLEDGVELARGVARG  268 (300)
T ss_pred             CCHHCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCHHHHHHHHHHCCCCCCEEEEEECCCEEEEEEEEE
T ss_conf             400025677055553025489999999999999999999885-6819999999985032798699997898089999988


Q ss_pred             ECCCCCEEEECCCCCEEEEEEEEE
Q ss_conf             769874899969998999996311
Q gi|254780868|r  227 VDDFGYLLLEEKKGCVRQIFTGDI  250 (252)
Q Consensus       227 Id~~G~L~i~~~~G~~~~i~sGeI  250 (252)
T Consensus       269 Id~~G~L~v~t~~G-~~~i~sGEV  291 (300)
T PRK06955        269 IDETGQLLLDTPAG-RQAIAAGDV  291 (300)
T ss_pred             ECCCCEEEEEECCC-EEEEEEEEE
T ss_conf             99997699998996-899998999