HHsearch alignment of GI: 254780868 and MMDB domain: 1bia_A_272-321

>1bia_A (A:272-321) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli}
Probab=98.47  E-value=3.3e-07  Score=64.02  Aligned_cols=43  Identities=28%  Similarity=0.444  Sum_probs=40.8

Q ss_pred             CCCEEEEEECCEEEEEEEEEECCCCCEEEECCCCCEEEEEEEEE
Q ss_conf             89779999799389999998769874899969998999996311
Q gi|254780868|r  207 IGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI  250 (252)
Q Consensus       207 ~gk~V~i~~~~~~~~G~~~gId~~G~L~i~~~~G~~~~i~sGeI  250 (252)
                      +||.|++..++++++|++.|||++|+|+|++++| ++.|+||||
T Consensus         1 lGk~V~i~~~~~~~~G~a~gId~~G~Llv~~~~g-~~~~~sGEV   43 (50)
T 1bia_A            1 INRPVKLIIGDKEIFGISRGIDKQGALLLEQDGI-IKPWMGGEI   43 (50)
T ss_dssp             TTSEEEEEETTEEEEEEEEEECTTSCEEEEETTE-EEEESSCEE
T ss_pred             CCCEEEEEECCEEEEEEEEEECCCCEEEEEECCE-EEEEEEEEE
T ss_conf             4986999979979999999999898299999991-999998899