HHsearch alignment of GI: 254780868 and MMDB domain: 2e5a_A_1-246

>2e5a_A (A:1-246) Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus}
Probab=97.54  E-value=9.5e-05  Score=48.72  Aligned_cols=162  Identities=12%  Similarity=-0.016  Sum_probs=98.9

Q ss_pred             CEEEEEEECCCCHHHHHHHHH--HC--CC---------CCCEEEEECCCCC-----------------CCCCCCCCCCCC
Q ss_conf             704999816485689999999--73--99---------9978999824467-----------------836799853166
Q gi|254780868|r   13 SFRYEFFDTISSTNDECMKRA--LS--GD---------LGNLWIVASCQTA-----------------GRGRRDNKWISD   62 (252)
Q Consensus        13 ~~~i~~~~~~~STn~~~~~~~--~~--~~---------~~~~~v~A~~Qt~-----------------GrGr~gr~W~s~   62 (252)
                      .|++.....++=....+.+..  ..  ..         .++++++-..|..                 =|.|.|..-+-.
T Consensus         4 ~~~~i~~~~~~~~~~la~~e~l~~~~~~~~~~~l~l~~~~p~v~iG~~q~~~~e~~~~~~~~~gi~vvrR~tGGg~V~hd   83 (246)
T 2e5a_A            4 SGLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHD   83 (246)
T ss_dssp             -CEEEEESCCCHHHHHHHHHHHHHHCCCTTCCEEEEECCSSEEEECTTCCHHHHSCHHHHHTTTCEEEECSSCSCCEEEC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCEEEECCCCCHHHHHCHHHHHHCCCCEEEEECCCCEEEEC
T ss_conf             22899917999889999999999607888995899971899799899898567619999987699189983698559843


Q ss_pred             CCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             33334132235322400021013779999999999744542102462146506710221122223323225832676521
Q gi|254780868|r   63 KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI  142 (252)
Q Consensus        63 ~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGi  142 (252)
                      +|++.+|++++.+...  ....--.++-++.++++.+   |++.. .=|||+.+++|||||+-.-..   +  ..++.|.
T Consensus        84 ~g~l~~s~i~~~~~~~--~~~~y~~~~~~i~~~l~~l---Gv~~~-~~~~~i~v~~~Ki~g~a~~~~---~--~~~~~~~  152 (246)
T 2e5a_A           84 MGNINLTFFTTKKKYD--RMENLKLVVRALKAVHPHL---DVQAT-KRFDLLLDGQFKISGTASKIG---R--NAAYHHC  152 (246)
T ss_dssp             TTEEEEEEEECGGGCC--HHHHHHHHHHHHHHHSTTC---CEEEC-TTSCEEETTTEEEECEEEEEC---S--SCEEEEE
T ss_pred             CCCEEEEEEECCCCCC--HHHHHHHHHHHHHHHHHCC---EEEEE-CCCCEEECCCEEEEEEEEEEE---C--CEEEEEE
T ss_conf             9968999975467689--8999999999999975423---26884-578648768649988889988---9--9899986


Q ss_pred             CCCCCCCCC-----------CC--------CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             544444642-----------23--------36532100236778978999877799999999
Q gi|254780868|r  143 GLNVKHCPV-----------DT--------PYPVTSLQREGGCIDLKDIFSLLFQDVARVLD  185 (252)
Q Consensus       143 GiNi~~~~~-----------~~--------~~~~tsL~~~~~~~~~~~l~~~l~~~l~~~~~  185 (252)
                      .+|++..++           .+        +...|++.+.+..++.+++...+...+.+.+.
T Consensus       153 sl~~~~d~~~~~~~l~~~~~~~~~~~~~s~~~~vt~l~~~~~~~~~~~~~~~l~~~~~~~~~  214 (246)
T 2e5a_A          153 TLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQ  214 (246)
T ss_dssp             EEESSCCHHHHHHHTSCCCCSEEECSCCCCCCCBCCHHHHCTTCCHHHHHHHHHHHHHHHHT
T ss_pred             EEEECCCHHHHHHHCCCCHHHHHHHCCCCCHHHHCCHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             89843888999987189915645421345076404788857999999999999999999848