HHsearch alignment of GI: 254780868 and MMDB domain: 2eay_A_1-185

>2eay_A (A:1-185) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A*
Probab=100.00  E-value=0  Score=322.26  Aligned_cols=179  Identities=25%  Similarity=0.407  Sum_probs=159.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHH
Q ss_conf             49998164856899999997399997899982446783679985316633334132235322400021013779999999
Q gi|254780868|r   15 RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRS   94 (252)
Q Consensus        15 ~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~   94 (252)
                      +++|||+++|||+++++..   ..++++|+|++||+||||+||+|+||+|+||||++++++.. ...+.+++++|+|+++
T Consensus         4 ~i~~~~~~~STn~~~~~~~---~~~~~~v~A~~QT~GrGr~gr~W~Sp~g~l~~S~~~~~~~~-~~~~~l~~~~~~ai~~   79 (185)
T 2eay_A            4 NLIWLKEVDSTQERLKEWN---VSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEF-ENLLQLPLVLGLSVSE   79 (185)
T ss_dssp             EEEEEEEBSCHHHHHHHSC---CCTTEEEEESCBCC------------CCEEEEEEEECTTTC-CCTTHHHHHHHHHHHH
T ss_pred             CEEEECCCCCHHHHHHHCC---CCCCCEEEECCCCCCCCCCCCEEECCCCCCCEEEEEEECCC-CCHHHHHHHHHHHHHH
T ss_conf             6799378734899998549---99996999897576878899861388777517764300133-3201456677776654


Q ss_pred             HHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCCCC-CCCCCHHH
Q ss_conf             999744542102462146506710221122223323225832676521544444642--233653210023-67789789
Q gi|254780868|r   95 VIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQRE-GGCIDLKD  171 (252)
Q Consensus        95 ~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~--~~~~~~tsL~~~-~~~~~~~~  171 (252)
                      +++.+.  +.++++|||||||+++||+||||+|...     .++|||||||+++.++  +.+.++|||..+ +..+++++
T Consensus        80 ~l~~~~--~~~v~iKWPNDi~~~~kKi~GIL~E~~~-----~~~viGiGiNl~~~~~~~~~~~~atsL~~~~~~~~~~~~  152 (185)
T 2eay_A           80 ALEEIT--EIPFSLKWPNDVYFQEKKVSGVLCELSK-----DKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKE  152 (185)
T ss_dssp             HHHHHH--CCCCEEETTTEEEETTEEEEEEEEEEET-----TEEEEEEEEECSCCCCCTTTTTTBCCHHHHHSSCCCHHH
T ss_pred             HHHHHC--CCCCCEEECHHHHCCCCCCEEEEEEEEE-----EEEEEECCEEECCCCCCCCCCCCCCCHHHCCCCCCCHHH
T ss_conf             433212--5332101040232234442044100025-----579971110321577873111232202220222354356


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             9987779999999987303556488999998752
Q gi|254780868|r  172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFAC  205 (252)
Q Consensus       172 l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~  205 (252)
                      +++.++.++..++..|.+ .+|++++++|++++.
T Consensus       153 l~~~l~~~l~~~~~~~~~-~gf~~~~~~~~~~~l  185 (185)
T 2eay_A          153 VLLKVLKRISENLKKFKE-KSFKEFKGKIESKXL  185 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHH-SCGGGTHHHHHHHBT
T ss_pred             HHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHH
T ss_conf             666667778776554302-677899898999986