HHsearch alignment of GI: 254780868 and MMDB domain: 2eay_A_186-233

>2eay_A (A:186-233) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A*
Probab=94.26  E-value=0.077  Score=30.61  Aligned_cols=43  Identities=28%  Similarity=0.659  Sum_probs=35.6

Q ss_pred             CCCCEEEEEECCEEEEEEEEEECCCCCEEEECCCCCEEEEEEEEE
Q ss_conf             389779999799389999998769874899969998999996311
Q gi|254780868|r  206 GIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI  250 (252)
Q Consensus       206 ~~gk~V~i~~~~~~~~G~~~gId~~G~L~i~~~~G~~~~i~sGeI  250 (252)
                      ++|..|++ .+.+.++|+.+|+.+.|..++.++.| ++.|.|||.
T Consensus         1 ylgeevkl-lgegkitgklvglsekggalilteeg-ikeilsgef   43 (48)
T 2eay_A            1 YLGEEVKL-LGEGKITGKLVGLSEKGGALILTEEG-IKEILSGEF   43 (48)
T ss_dssp             TTTSEEEE-TTEEEEEEEEEEECTTSCEEEEETTE-EEEECSCCE
T ss_pred             HCCCEEEE-CCCCEEEEEEEEECCCCCEEEEECCC-EEEEEEEEE
T ss_conf             38977999-87998999999998999889997998-799998889