HHsearch results for GI: 254780868 and protein with PDBid: 2eay_A

>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A*
Probab=100.00  E-value=0  Score=386.21  Aligned_cols=223  Identities=25%  Similarity=0.436  Sum_probs=197.3

Q ss_pred             EEEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHH
Q ss_conf             04999816485689999999739999789998244678367998531663333413223532240002101377999999
Q gi|254780868|r   14 FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMR   93 (252)
Q Consensus        14 ~~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~   93 (252)
                      .+++|||++||||+++++.   ..+++++|+|++||+||||+||.|+||+|+||||+++++. +......+++++|++++
T Consensus         3 ~~i~~~~~~~STn~~~k~~---~~~~~~~v~a~~Qt~GrGR~gr~W~s~~g~l~~S~~~~~~-~~~~~~~l~~~~~lai~   78 (233)
T 2eay_A            3 KNLIWLKEVDSTQERLKEW---NVSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPK-EFENLLQLPLVLGLSVS   78 (233)
T ss_dssp             CEEEEEEEBSCHHHHHHHS---CCCTTEEEEESCBCC------------CCEEEEEEEECTT-TCCCTTHHHHHHHHHHH
T ss_pred             CCEEEECCCCCHHHHHHHC---CCCCCCEEEECCCCCCCCCCCCEEECCCCCCEEEECCCCC-CHHHHHHHHHHHHHHHH
T ss_conf             7679967878689999854---9999919998976878798998611899984563122642-12336789999999999


Q ss_pred             HHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCC--CCCCCCCCCCCCC-CCCCCHH
Q ss_conf             999974454210246214650671022112222332322583267652154444464--2233653210023-6778978
Q gi|254780868|r   94 SVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP--VDTPYPVTSLQRE-GGCIDLK  170 (252)
Q Consensus        94 ~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~--~~~~~~~tsL~~~-~~~~~~~  170 (252)
                      ++|+.+.+  .+++||||||||+++||+||||+|...     ..+++|||||++..+  ++.+.++|||... +..++++
T Consensus        79 ~~l~~~~~--~~v~iKWPNDI~~~~kKi~GIL~E~~~-----~~~viGiGin~~~~~~~~~~~~~atsL~~~~~~~~~~~  151 (233)
T 2eay_A           79 EALEEITE--IPFSLKWPNDVYFQEKKVSGVLCELSK-----DKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRK  151 (233)
T ss_dssp             HHHHHHHC--CCCEEETTTEEEETTEEEEEEEEEEET-----TEEEEEEEEECSCCCCCTTTTTTBCCHHHHHSSCCCHH
T ss_pred             HHHHHHCC--CCCCEECCCHHEECCCCCEEEEEECEE-----EEEEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHH
T ss_conf             87877456--664061784523678862344000103-----57999999986067676113444337888648865789


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCEEEEEEEEEECCCCCEEEECCCCCEEEEEEEEE
Q ss_conf             99987779999999987303556488999998752389779999799389999998769874899969998999996311
Q gi|254780868|r  171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI  250 (252)
Q Consensus       171 ~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~gk~V~i~~~~~~~~G~~~gId~~G~L~i~~~~G~~~~i~sGeI  250 (252)
                      ++++.++.++..++..|.+ .+|+.++++|+++++++||.|++. +++.++|+++|||++|+|+|++++| ++.|++|||
T Consensus       152 ~l~~~l~~~l~~~~~~~~~-~~~~~i~~~~~~~~~~~gq~V~v~-~~~~i~G~~~GId~~G~Lil~~~~g-~~~i~sGev  228 (233)
T 2eay_A          152 EVLLKVLKRISENLKKFKE-KSFKEFKGKIESKMLYLGEEVKLL-GEGKITGKLVGLSEKGGALILTEEG-IKEILSGEF  228 (233)
T ss_dssp             HHHHHHHHHHHHHHHHHHH-SCGGGTHHHHHHHBTTTTSEEEET-TEEEEEEEEEEECTTSCEEEEETTE-EEEECSCCE
T ss_pred             HHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHHHCCCEEEEC-CCCEEEEEEEEECCCCCEEEEECCC-EEEEEEEEE
T ss_conf             9999999999999999886-688999999999985479889996-6998999999998999789998998-699999789