HHsearch results for GI: 254780868 and protein with PDBid: 2qhs_A

>2qhs_A Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A
Probab=96.31  E-value=0.036  Score=31.68  Aligned_cols=121  Identities=19%  Similarity=0.148  Sum_probs=72.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECC--CEEEECCCCCCCCCCCCC
Q ss_conf             679985316633334132235322400021013779999999999744542102462146--506710221122223323
Q gi|254780868|r   53 GRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPN--DILVFQRKIAGILIETLN  130 (252)
Q Consensus        53 Gr~gr~W~s~~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~~l~~~~~~~~~~~iKWPN--Di~~~~kKi~GIL~E~~~  130 (252)
                      .|.|...+-.||.|-+=.++......   ..+--..--++.++++.+.   ++.. .-|.  -++++++|||.|=+... 
T Consensus        94 ~RGG~iTyHGPGQLV~YpIl~L~~~~---~~~v~~le~~ii~~l~~~g---i~~~-~~~~~~GVwv~~~KIasIGi~v~-  165 (237)
T 2qhs_A           94 ERGGDVTYHGPGQLVGYPIFPVGREV---RRFLRQIEEAIVRVAAGYG---ISAY-PTPGYAGVWVGEDKLCAIGVAVK-  165 (237)
T ss_dssp             CSSSSEEEECTTEEEEEEECCCTTCH---HHHHHHHHHHHHHHHHHTT---CCCB-CCSSSSSEEETTEEEEEEEEEEE-
T ss_pred             CCCCCEEEECCCCEEEEEHHHHHHHH---HHHHHHHHHHHHHHHHHCC---CCCC-CCCCCCCCCCCHHHHHHHHHHHC-
T ss_conf             79971689899966777746555329---9999999999999998626---6411-33677763440215999998724-


Q ss_pred             CCCCCEEEEEECCCCCCCCC--------CCC-CCCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             22583267652154444464--------223-365321002-36778978999877799999999
Q gi|254780868|r  131 LKNGLQAVVVGIGLNVKHCP--------VDT-PYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLD  185 (252)
Q Consensus       131 ~~~~~~~~viGiGiNi~~~~--------~~~-~~~~tsL~~-~~~~~~~~~l~~~l~~~l~~~~~  185 (252)
                        ..  ...=|+.||++.+-        ..+ +..+|||+. .+..++.+++...+++.|.+.+.
T Consensus       166 --r~--vt~HG~aLNV~~dL~~F~~IvpCGl~~~~vTSL~~elg~~~~~~ev~~~l~~~f~~~Fg  226 (237)
T 2qhs_A          166 --EG--VSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFG  226 (237)
T ss_dssp             --TT--EEEEEEEEESSCCGGGGGGBCCCSSCCSEECCHHHHHTSCCCHHHHHHHHHHHHHHHHT
T ss_pred             --CC--EEECCEEEECCCCHHHHCCEEECCCCCCCEEEHHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             --75--58322689716982770737836889983724699768999999999999999999869