BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780868|ref|YP_003065281.1| birA bifunctional protein
[Candidatus Liberibacter asiaticus str. psy62]
         (252 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780868|ref|YP_003065281.1| birA bifunctional protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040545|gb|ACT57341.1| birA bifunctional protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 252

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI
Sbjct: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK
Sbjct: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV
Sbjct: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG
Sbjct: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240

Query: 241 CVRQIFTGDIFT 252
           CVRQIFTGDIFT
Sbjct: 241 CVRQIFTGDIFT 252


>gi|315122711|ref|YP_004063200.1| birA bifunctional protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496113|gb|ADR52712.1| birA bifunctional protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 252

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 196/251 (78%), Positives = 222/251 (88%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M S+LSEC+  Y+FRYEFFDTI STNDECMKRALSGDLGNLWI+AS QT+GRGR   KW+
Sbjct: 1   MLSDLSECKKLYNFRYEFFDTIVSTNDECMKRALSGDLGNLWIIASRQTSGRGRGGKKWV 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           SDKGNLYASLLLIDSISKDSLTLLSFA++VAM S+IAS LP   DVKIKWPND+LVFQRK
Sbjct: 61  SDKGNLYASLLLIDSISKDSLTLLSFAVSVAMHSIIASILPAEVDVKIKWPNDLLVFQRK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IAGILIETL+LK+GLQA+V+GIGLNV++CP DT YPVTSL++EGGCIDLK I  + FQ++
Sbjct: 121 IAGILIETLDLKSGLQAIVIGIGLNVEYCPKDTSYPVTSLRKEGGCIDLKSILPIFFQEI 180

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           A++L +WKKDTGREEIM LWRCFA GIG+ ITIKL   SI G FVGVDDFGYLLLEEKKG
Sbjct: 181 AKMLAIWKKDTGREEIMKLWRCFAYGIGNPITIKLPQFSISGHFVGVDDFGYLLLEEKKG 240

Query: 241 CVRQIFTGDIF 251
           C R+IFTGDIF
Sbjct: 241 CFRKIFTGDIF 251


>gi|255281434|ref|ZP_05345989.1| biotin-[acetyl-CoA-carboxylase] ligase [Bryantella formatexigens
           DSM 14469]
 gi|255267922|gb|EET61127.1| biotin-[acetyl-CoA-carboxylase] ligase [Bryantella formatexigens
           DSM 14469]
          Length = 326

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 105/242 (43%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + DT+ STND   K A  G      +VA  Q+ G+GRR   WI+     +  S+L
Sbjct: 78  GQNLVYLDTVDSTNDYVKKLAEQGAPHGTLVVADYQSGGKGRRGRTWITPHGTTIAMSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   I  +  ++L+    +A    +        DVKIKWPND+++  +K++G L E    
Sbjct: 138 VRPQIRPEKASMLTLVTGMAAAEAVGQITG--LDVKIKWPNDLVIHGKKLSGTLTEMSAE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
             G+  VV+G G+N             +   +   G  +D   I     +      + + 
Sbjct: 196 MEGVHYVVIGTGINANITEFPEELKDLASSLQLELGHPVDRGAIICTCMKYFENYYEKFI 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  +++ ++     +   + +    G   G  +G+D+ G LL+E++ G + +++ G
Sbjct: 256 TTQDMSLLIDEYQRLLANMDRQVRVLDPAGEYGGIAIGIDEQGQLLVEKEDGSITRVYAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|302389451|ref|YP_003825272.1| biotin/acetyl-CoA-carboxylase ligase [Thermosediminibacter oceani
           DSM 16646]
 gi|302200079|gb|ADL07649.1| biotin/acetyl-CoA-carboxylase ligase [Thermosediminibacter oceani
           DSM 16646]
          Length = 327

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 105/242 (43%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
             +  ++   +STN+E  K A  G      ++A  QT G+GR    W    +  ++ S++
Sbjct: 85  GRKIYYYPATASTNEEAKKLAGEGAHHGSLVIAEEQTGGKGRMGRVWLSPPRVGIWMSII 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       ++   AVA    I           IKWPNDILV  +K+AGIL E    
Sbjct: 145 LRPVIQPYEAPRITMTGAVAAAKAIRERTG--VTCHIKWPNDILVEGKKVAGILTEMSAD 202

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLWK 188
            +G+  VV+GIG+NV +          +   +       D  DI +          +  +
Sbjct: 203 IDGINYVVMGIGINVNNDDFPGELKEIATSLKIAKGEAQDRLDILTGFLFRFEDYYNCLE 262

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                ++I+  WR   C +G  + +     ++ G  + VDD G LL+  + G V +I +G
Sbjct: 263 A-GEFKKILEEWRLLCCNLGRRVRVVGRNFTVEGIALDVDDDGALLVRSENGRVERILSG 321

Query: 249 DI 250
           D+
Sbjct: 322 DV 323


>gi|225388543|ref|ZP_03758267.1| hypothetical protein CLOSTASPAR_02279 [Clostridium asparagiforme
           DSM 15981]
 gi|225045388|gb|EEG55634.1| hypothetical protein CLOSTASPAR_02279 [Clostridium asparagiforme
           DSM 15981]
          Length = 326

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 108/242 (44%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++D+  STN    + A  G      +VA  QTAG+GRR   W +     ++ +L+
Sbjct: 78  GSNLVYYDSTDSTNTRARQLAEQGAPHGTLVVADSQTAGKGRRGRHWEAPDGTGIWMTLI 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +     ++L+   A+A+   I        +  IKWPNDI+   +K+ GIL E    
Sbjct: 138 LRPELEPQRASMLTLVTALAVADAIRGLTG--LEAAIKWPNDIVCGGKKVVGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              ++ V+VGIG+NV           T+   +   G  +    + + +     +   L++
Sbjct: 196 AEWIRYVIVGIGINVNMDGFPGELGKTATSLKLELGRGVKRSPLVAAVMNAFEKYYALFE 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      +++ +  ++   G  + +    G   G  +G+D  G LL++  +G V+ + +G
Sbjct: 256 KAGDLSGLVDTYNRWSANTGRQVRVLDPAGEYQGEALGIDSQGALLVKCSEGEVKSVISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|239626151|ref|ZP_04669182.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520381|gb|EEQ60247.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 326

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 6/240 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R E+FD   STN    K A  G      +VA  Q++G+GRR   W S +G  ++ S++L 
Sbjct: 80  RLEYFDETDSTNTRARKFAEEGAPHGTLVVADSQSSGKGRRGRLWTSPRGVGIWMSMVLR 139

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I+    ++L+    +A+   +      G D  IKWPND ++  RKI GIL E     +
Sbjct: 140 PDIAPVHASMLTLIAGMAVVRGVKE--STGLDAMIKWPNDAVLAGRKICGILTEMSTEDD 197

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQDVARVLDLWKKD 190
            ++ V+ GIG+NV            +   +      +    +   + +      D++ + 
Sbjct: 198 SIRYVITGIGINVNIDEFPEEIRDKATSLKMELGKSVKRSPVIRAVAEAFETYYDIFLET 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +   +       G  + +    G   G  +G+DD G LL+ +K G V  + +G++
Sbjct: 258 CDMSRLKEEYNRELANTGREVLVLDPRGQYEGTALGIDDEGSLLVRKKDGTVVPVISGEV 317


>gi|326792448|ref|YP_004310269.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium lentocellum DSM
           5427]
 gi|326543212|gb|ADZ85071.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium lentocellum DSM
           5427]
          Length = 325

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 99/246 (40%), Gaps = 5/246 (2%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
           C        ++++ + STN++    A  G      ++A  Q+AG+GR    W S     +
Sbjct: 73  CGYTLGQVIKYYEVVDSTNEKAKALAREGASEGTLVIADQQSAGKGRLGRNWNSPAGTGI 132

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + SL+L   I     + L+    + M   I        D  IKWPNDI+V  +K+ GIL 
Sbjct: 133 WMSLILKPEILPQYASQLTLVAGLCMCEAIREVTG--LDATIKWPNDIVVNGKKVCGILT 190

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID--LKDIFSLLFQDVARVL 184
           E       +  +V+GIG+NV H       P  +     G  D     +     +   +  
Sbjct: 191 EMSAEMERINYIVLGIGVNVNHKAFPEELPFATSLALEGKQDYERASLIKAFLERFEKDY 250

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             +K D     I++ +      +G  + I     S       +   G L+++ + G  + 
Sbjct: 251 KHYKVDPHLTAILSRYEAHCITLGKTVKIISGNESFTAEAKEITIDGNLIVKTETGEEKL 310

Query: 245 IFTGDI 250
           I +G++
Sbjct: 311 IHSGEV 316


>gi|288871334|ref|ZP_06410116.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium hathewayi DSM
           13479]
 gi|288863858|gb|EFC96156.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium hathewayi DSM
           13479]
          Length = 328

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/241 (24%), Positives = 105/241 (43%), Gaps = 6/241 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
            +  +++   STN    K A  G      +V   Q AGRGRR   W+S     ++ SL+L
Sbjct: 81  RKIVYYEETDSTNIRARKLAEEGAPDGTLVVTDFQNAGRGRRGRMWVSPSGTGVFMSLIL 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I   S ++L+   A+A+   I  T     D  IKWPNDI+   RK+ GIL E     
Sbjct: 141 RPDILPSSASMLTLVAALAVHDGIKETTG--LDTVIKWPNDIVGDGRKLCGILTEMSAEL 198

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID---LKDIFSLLFQDVARVLDLWKK 189
            G+  VV GIG+N             +               + + + +        +++
Sbjct: 199 EGIHYVVTGIGINANMTEFPEEAGEVASSLRILTGSPVRRSRLIASVMKAYEGYYKKFRE 258

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 +M+++      +G  + +    G+  G+ +G+D+ G L++E+  G V ++ +G+
Sbjct: 259 CGSLASLMDVYNEHMANLGREVKVLDPAGTYTGKALGIDEKGELIVEKADGKVIRVVSGE 318

Query: 250 I 250
           +
Sbjct: 319 V 319


>gi|254504283|ref|ZP_05116434.1| biotin-(acetyl-CoA-carboxylase) ligase [Labrenzia alexandrii
           DFL-11]
 gi|222440354|gb|EEE47033.1| biotin-(acetyl-CoA-carboxylase) ligase [Labrenzia alexandrii
           DFL-11]
          Length = 261

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 90/239 (37%), Positives = 131/239 (54%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            F YE ++T+ STN  C++RA+SG  GNLWI A  QTAGRGRR   W S +GNL+AS+L+
Sbjct: 19  DFLYEAYETVGSTNALCLERAVSGHPGNLWIRAGVQTAGRGRRGRAWTSPQGNLFASVLM 78

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           ID      +  L    AVA+   +         V +KWPND+LV   K++GIL+E   LK
Sbjct: 79  IDPAPLARIGELPLLSAVALAEAVDKAAGTLQLVSLKWPNDLLVDGAKLSGILLEAETLK 138

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A V+G G+N    P    Y  T L+  G  +    +F+ L + +A+ L +W +  G
Sbjct: 139 DGRLAAVMGFGVNCVSHPDPAMYQATDLRGLGFQVSADSLFAALAETLAKYLAIWHQPDG 198

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            + I   W   A  +G  IT++ +   I G F  +D  G+L+L    G  R ++ GD+F
Sbjct: 199 FDRIRRQWLKRAAHLGQKITVRAAQEEITGIFDDLDASGHLVLRLDNGQKRTVYAGDVF 257


>gi|254469106|ref|ZP_05082511.1| biotin-(acetyl-CoA-carboxylase) ligase [Pseudovibrio sp. JE062]
 gi|211960941|gb|EEA96136.1| biotin-(acetyl-CoA-carboxylase) ligase [Pseudovibrio sp. JE062]
          Length = 246

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 88/239 (36%), Positives = 130/239 (54%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            F +E +D I STN   +++A  G  GNLW+ +  Q  GRGRR  +W S+ GNL+AS+LL
Sbjct: 6   GFCFEHYDQIGSTNTYGLQKARDGHPGNLWVRSDIQVTGRGRRGREWTSESGNLFASVLL 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +  + +  L F  A+A+   I          ++KWPND+L+  +K++GIL+E+ +  
Sbjct: 66  RVDVQNEKIVQLPFVAALALGEAIERATGAHNLAQLKWPNDVLIDGQKVSGILLESESGP 125

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           NG   +V G G+NV H P    Y VT L+  G   D   +F  L Q  AR L+ WK  +G
Sbjct: 126 NGELCLVCGFGVNVSHHPDLGDYAVTDLRSMGYMCDPSQVFDALAQSFARWLETWKAASG 185

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            EEI + W   A G G  I ++LS     G F+ +D  G L+++   G  R +  GD+F
Sbjct: 186 FEEIRSAWLRRAVGRGKPIRVRLSNEEFSGVFIDIDQMGRLIVKMDHGGERLVTAGDVF 244


>gi|332799851|ref|YP_004461350.1| biotin/acetyl-CoA-carboxylase ligase [Tepidanaerobacter sp. Re1]
 gi|332697586|gb|AEE92043.1| biotin/acetyl-CoA-carboxylase ligase [Tepidanaerobacter sp. Re1]
          Length = 331

 Score =  171 bits (433), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 104/240 (43%), Gaps = 4/240 (1%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +  ++    STN++  K A  G      ++A  Q   RGR    W S  G L+ S++L
Sbjct: 91  GSKIYYYSITGSTNEDAKKLAREGVPDGTLVIAEKQHKARGRMGRAWNSPDGGLWLSVIL 150

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +        L+   AVA+   I  T       +IKWPNDIL   +K+ GIL E     
Sbjct: 151 RPNFVPMDAPKLTIMTAVAVTEAIIQTTG--IHAEIKWPNDILADGKKVCGILTEMSAEM 208

Query: 133 NGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           + +  V++G+G+NV +   P +     TSL++  G    +               +  ++
Sbjct: 209 DAINHVIIGVGINVNNNDFPDELKGIGTSLKQIKGENINRLALLSALLKKLEYYYIKAEN 268

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G  E+   WR     +G  I I        G  + +D+FG LL+  + G V ++ +GD+
Sbjct: 269 EGFHEVFEKWRSLCINLGKKINITGKNDVFEGTAIDIDEFGALLVRTENGEVVRVLSGDV 328


>gi|160941163|ref|ZP_02088500.1| hypothetical protein CLOBOL_06056 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435724|gb|EDP13491.1| hypothetical protein CLOBOL_06056 [Clostridium bolteae ATCC
           BAA-613]
          Length = 326

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R E+FD   STN    K A  G      +VA  QTAG+GRR   W+S     ++ S++
Sbjct: 78  GTRLEYFDETDSTNIRARKLAEEGAPHGTLVVADRQTAGKGRRGKSWVSPAGTGIWMSMV 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +S  S ++L+    +++   +      G +  IKWPND ++  +KI GIL E    
Sbjct: 138 LRPVMSPMSASMLTLIAGLSVVRGVKE--STGLEAMIKWPNDAVLNGKKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              ++ V+ GIG+NV           T+   +   G  I    + + +        D++ 
Sbjct: 196 VECIRYVIPGIGINVNIDDFPEEIRATATSLKLEAGRSIKRSLVIAAVADSFEYYYDIFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      + + +      +   + +    G   G+ +G+D+ G LL+  + G +  + +G
Sbjct: 256 KTCDMSGLRDDYNKALVNLNKEVLVLDPRGQYKGKALGIDNEGSLLVRREDGNISAVISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|303228835|ref|ZP_07315648.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303230985|ref|ZP_07317728.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514367|gb|EFL56366.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302516455|gb|EFL58384.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 324

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 107/244 (43%), Gaps = 8/244 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L            +   AVA+            D  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFPPAEAPKCTLMAAVALTKAFHK--MGLADAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
               +  +V+GIG+NV    +  P +     TSL  EG  I+  + F ++ +++      
Sbjct: 196 SMEEISYIVMGIGVNVKTKQEELPEEIKQIATSLLMEGVDIERTEAFKIILEELEHQYYD 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  E+ +N WR  +  +   I ++    +  G    +DD G LL++   G V++I 
Sbjct: 256 VLDSG-FEDTLNEWRKLSVTLNQEIEVRAPGNTYEGVATDIDDDGNLLVKTTNGEVKRIV 314

Query: 247 TGDI 250
            GD+
Sbjct: 315 AGDV 318


>gi|294793388|ref|ZP_06758533.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 6_1_27]
 gi|294455819|gb|EFG24184.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 6_1_27]
          Length = 324

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 109/243 (44%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L            +   AVA+           TDV IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK--MGLTDVGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  +V+GIG+NVK    + P  +  +       D+    +  F+ +   L+     
Sbjct: 196 SMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYYE 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G +++I  
Sbjct: 256 VLDSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGTIKRIVA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|323693744|ref|ZP_08107941.1| hypothetical protein HMPREF9475_02804 [Clostridium symbiosum
           WAL-14673]
 gi|323502195|gb|EGB18060.1| hypothetical protein HMPREF9475_02804 [Clostridium symbiosum
           WAL-14673]
          Length = 326

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 109/242 (45%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             +  +FD   STN E  + A +G       VA  Q  G+GRR   W S +G  ++ SL+
Sbjct: 78  GKKVLYFDETGSTNTEAKQAAEAGAPHGTLAVADYQNMGKGRRGRMWTSPRGVGVWMSLM 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   I   + ++L+   A+A+   I  T     + +IKWPNDI+   +KI GIL E    
Sbjct: 138 IRPEIHPSAASMLTLVAALAVSEGIGKTCG--LETQIKWPNDIVADGKKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
              +  VV G+G+N     +       +     + G  +    +   + +   +  +++ 
Sbjct: 196 LECINYVVTGMGINANMEELPEEIKDVATSILLQTGKRVKRSQLIGAVMESYEKYYNVFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      +++++      +   + +       +G  +G++D G LL++ + G V Q+ +G
Sbjct: 256 ESGNMSGLLDVYNSHLANMQRSVRVLQPGSEYVGTALGINDAGELLVKTEDGAVHQVISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|323484888|ref|ZP_08090243.1| hypothetical protein HMPREF9474_01994 [Clostridium symbiosum
           WAL-14163]
 gi|323401769|gb|EGA94112.1| hypothetical protein HMPREF9474_01994 [Clostridium symbiosum
           WAL-14163]
          Length = 326

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 109/242 (45%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             +  +FD   STN E  + A +G       VA  Q  G+GRR   W S +G  ++ SL+
Sbjct: 78  GKKVLYFDETGSTNTEAKQAAEAGAPHGTLAVADYQNMGKGRRGRMWTSPRGVGVWMSLM 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   I   + ++L+   A+A+   I  T     + +IKWPNDI+   +KI GIL E    
Sbjct: 138 IRPEIHPSAASMLTLVAALAVSEGIGKTCG--LETQIKWPNDIVADGKKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
              +  VV G+G+N     +       +     + G  +    +   + +   +  +++ 
Sbjct: 196 LECINYVVTGMGINANMEELPEEIKDVATSILLQTGKRVKRSQLIGAVMESYEKYYNVFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      +++++      +   + +       +G  +G++D G LL++ + G V Q+ +G
Sbjct: 256 ESGNMSGLLDVYNSHLANMQRSVRVLQPGSEYVGTALGINDAGELLVKTEDGAVHQVISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|308069475|ref|YP_003871080.1| BirA bifunctional protein [Paenibacillus polymyxa E681]
 gi|305858754|gb|ADM70542.1| BirA bifunctional protein [Paenibacillus polymyxa E681]
          Length = 324

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 70/257 (27%), Positives = 114/257 (44%), Gaps = 10/257 (3%)

Query: 2   FSNLSECQNPYSF--RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
            S L++  N  SF  R    D+  ST  + M+ A  G      ++A  QTAGRGR   KW
Sbjct: 68  VSKLADILNTQSFGQRIVVLDSTVSTQQDAMRLAEEGTPEGTVVLAEEQTAGRGRLGRKW 127

Query: 60  ISDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
            S +   ++ S++L  +        L+    VA+   I        +  IKWPND+L+  
Sbjct: 128 YSPRGKGVWMSIVLRPTQPLAFTPQLTLLTGVAVCRAIRRLTG--VEAGIKWPNDLLIHG 185

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFS 174
           RK++GIL+E+      ++  + GIG++V       P +     TSL+ E G    + +  
Sbjct: 186 RKVSGILLESATEDQRIRYCIAGIGIDVNLNKEDYPEELSQVGTSLKIEAGREIDRTVLI 245

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYL 233
               +    L     + G + I  LW   +  +   +      G  + G  VG+D  G L
Sbjct: 246 SSVLEEMEQLSKLYAEQGFQPIAMLWEALSVTMNRSVRAHTGQGIPVEGTAVGLDPSGAL 305

Query: 234 LLEEKKGCVRQIFTGDI 250
           ++E  +G   Q+ +GDI
Sbjct: 306 VIETDQGERIQVISGDI 322


>gi|294795207|ref|ZP_06760341.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 3_1_44]
 gi|294453999|gb|EFG22374.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 3_1_44]
          Length = 324

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 108/243 (44%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L            +   AVA+           TD  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK--MGLTDAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  +V+GIG+NVK    + P  +  +       D+    +  F+ +   L+     
Sbjct: 196 SMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYYE 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G +++I  
Sbjct: 256 VLDSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRISDGTIKRIVA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|282850017|ref|ZP_06259399.1| biotin-(acetyl-CoA-carboxylase) ligase [Veillonella parvula ATCC
           17745]
 gi|282580206|gb|EFB85607.1| biotin-(acetyl-CoA-carboxylase) ligase [Veillonella parvula ATCC
           17745]
          Length = 324

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 108/243 (44%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L            +   AVA+           TD  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK--MGLTDAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  +V+GIG+NVK    + P  +  +       D+    +  F+ +   L+     
Sbjct: 196 SMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYYE 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D+G EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G +++I  
Sbjct: 256 VLDSGFEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRISDGTIKRIVA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|108763373|ref|YP_632327.1| BirA bifunctional protein [Myxococcus xanthus DK 1622]
 gi|108467253|gb|ABF92438.1| BirA bifunctional protein [Myxococcus xanthus DK 1622]
          Length = 334

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 107/244 (43%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                  +++ STN++  + A  G      +VA  QTAG+GRR   W+S  G NLY S +
Sbjct: 88  GRTIHHHESLPSTNEKAFRLAQDGARHGEVVVAEQQTAGKGRRGRTWVSPPGLNLYFSAI 147

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   AVA+   +      G +  IKWPND+ +   K+AGIL E    
Sbjct: 148 LRPGLPPQRAPELTLVAAVALAESLRDA---GVEAAIKWPNDVHIDGLKVAGILTELSAE 204

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-----GGCIDLKDIFSLLFQDVARVLDL 186
              +  V+VG+G+N+       P  + +         G  +      + L+  +   LDL
Sbjct: 205 PERVHFVIVGVGVNLNSQVEHFPEELRATATSLSLALGQPVHRARFAASLWTRLEEWLDL 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +      + +   W+  +  +G  + ++     + GR   +D  G LL+   +G + ++ 
Sbjct: 265 YLDTG-FDAVRARWKALSSTLGQDVLVRTDRHELRGRAEDIDPSGALLVRTAEGSLERVL 323

Query: 247 TGDI 250
            GD+
Sbjct: 324 AGDV 327


>gi|310642528|ref|YP_003947286.1| biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Paenibacillus polymyxa
           SC2]
 gi|309247478|gb|ADO57045.1| Biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Paenibacillus polymyxa
           SC2]
          Length = 324

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 66/257 (25%), Positives = 116/257 (45%), Gaps = 12/257 (4%)

Query: 3   SNLSECQNPYSF--RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           S L++  N  SF  R    D+  ST  + M+ A  G      ++A  QTAGRGR   KW 
Sbjct: 69  SKLADMLNTQSFGQRIVVLDSTVSTQQDAMRLAEEGAPEGTLVLAEEQTAGRGRLGRKWY 128

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S +   ++ S++L  +        L+    VA+   I        +  IKWPND+L+  R
Sbjct: 129 SPRGKGIWMSIVLRPTQPLAFTPQLTLLTGVAVCRAIRRLTG--VEAGIKWPNDLLIHGR 186

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFS 174
           K++GIL+E+      ++  + GIG++V      +    +    +     G  +D   + +
Sbjct: 187 KVSGILLESATEDQRVRYCIAGIGIDVNLNVEDYPEELSHVGTSLKIEAGLEVDRTALIA 246

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYL 233
            + +++  +L     + G + I  LW   +  +   +      G  + G  VG+D  G L
Sbjct: 247 AVLEEM-ELLSKLYAEQGFQPIAMLWEALSVTMNRSVRAHTGQGIAVEGTAVGLDPSGAL 305

Query: 234 LLEEKKGCVRQIFTGDI 250
           ++E  +G   Q+ +GDI
Sbjct: 306 VIETNQGERIQVISGDI 322


>gi|331268218|ref|YP_004394710.1| birA bifunctional protein [Clostridium botulinum BKT015925]
 gi|329124768|gb|AEB74713.1| birA bifunctional protein, putative [Clostridium botulinum
           BKT015925]
          Length = 328

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 115/244 (47%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                +F+TI STN++  +   +G L    +++  QT GRGR   +W+S K   ++ S++
Sbjct: 79  GKNIMYFNTIDSTNNKAKELGTNGVLEGTVVISEEQTGGRGRLGRQWVSPKFKGIWMSMI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I     + ++  +A A+ S I      G DV IKWPNDI++  +KI GIL E    
Sbjct: 139 LRPDIEPMEASKITQIVAAAVCSAIKEL---GIDVYIKWPNDIVLNNKKICGILTEMSGE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  +V GIG+NV     D P  +  +           I  K++ + +F     + D 
Sbjct: 196 INKINYIVAGIGINVNIDEEDFPEDIKKIATSIKIQTGLKIQRKELIAKIFNKFEMLYDE 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +      +  + + +C +  +G  + I      I  + + + + G L++E   G V +I 
Sbjct: 256 FINKGTIKRSIEICKCNSALLGRKVKIIRKSNEIFAKALTIAEDGELIVEYDDGKVEKIV 315

Query: 247 TGDI 250
           +G++
Sbjct: 316 SGEV 319


>gi|288958975|ref|YP_003449316.1| biotin-[acetyl-CoA-carboxylase] ligase [Azospirillum sp. B510]
 gi|288911283|dbj|BAI72772.1| biotin-[acetyl-CoA-carboxylase] ligase [Azospirillum sp. B510]
          Length = 266

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 130/252 (51%), Gaps = 4/252 (1%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +  +  + P  F+ + FD++ STNDE    + SG      + A  Q +GRGRR   W S 
Sbjct: 7   AEAARLRLPPGFQVKAFDSVGSTNDEAKALSRSGAPEGTIVWARRQESGRGRRGRAWTSP 66

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           +GNLY++ +L   ++      +SF  A+A+     S LP  + V+ KWPND+LV  RK++
Sbjct: 67  EGNLYSTTILRPGLAPAEAAQISFVAALAIAETAESVLPDPSGVRCKWPNDVLVHDRKLS 126

Query: 123 GILIETLNLKNG-LQAVVVGIGLNVKHCPVDTPYPVTS-LQREGGCIDLKDIFSLLFQDV 180
           GIL+E+    +G +  VV+G+G+N++H P    Y  TS +      +    +  +    +
Sbjct: 127 GILLESEPAADGTVAWVVLGVGINLRHFPATADYGATSLIAEGAPAMGPAALLEVYAGHL 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE-EKK 239
           A    LW+       + + W   A G+G  I ++L+  +I G F  +D  G LLL+    
Sbjct: 187 ANWYGLWRAHG-FGPVRDAWMARAKGLGGPILVRLADRTIPGIFADLDSDGVLLLDPTDG 245

Query: 240 GCVRQIFTGDIF 251
           G  ++I  GD+F
Sbjct: 246 GPRQRIAAGDVF 257


>gi|217979063|ref|YP_002363210.1| biotin/acetyl-CoA-carboxylase ligase [Methylocella silvestris BL2]
 gi|217504439|gb|ACK51848.1| biotin/acetyl-CoA-carboxylase ligase [Methylocella silvestris BL2]
          Length = 259

 Score =  168 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 94/252 (37%), Positives = 131/252 (51%), Gaps = 3/252 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M S+L+       FR      + STNDE + RA +GD G LW+VA  QT GRGR    W 
Sbjct: 1   MLSHLARSVEASGFRLSVHGELGSTNDEALARARAGDPGRLWVVAERQTNGRGRLGRSWT 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S+ GNL+ASLLLID         L F  ++A+   +   L     +KIKWPNDIL    K
Sbjct: 61  SEPGNLFASLLLIDPAPLARAPELGFVASLALAIALRRLLDEDPALKIKWPNDILYKDAK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQD 179
           IAG+L+E++ L  G+   V GIG+N    P DT YP + L    G     + + + L +D
Sbjct: 121 IAGVLLESVTLGAGV-GCVAGIGVNCATHPSDTLYPASDLGAIAGRALTPETVLAALAED 179

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +A  L +W ++ G   I   W   A G+G+ I +     +  G F G+D  G L+L+   
Sbjct: 180 MAHWLAVWAQEGGFVLIRAEWLKRAGGLGEPIKVSRGEVATEGVFRGIDAAGRLILDGAA 239

Query: 240 GCVRQIFTGDIF 251
           G +  I  GD+F
Sbjct: 240 GEI-LIEAGDVF 250


>gi|182679338|ref|YP_001833484.1| biotin--acetyl-CoA-carboxylase ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635221|gb|ACB95995.1| biotin--acetyl-CoA-carboxylase ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 264

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 128/245 (52%), Gaps = 7/245 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           +FR   F+ + STNDE + RA +GD G LWIVA  Q+ GRGR    W S  GNLYASLLL
Sbjct: 9   AFRLAHFEKLGSTNDEALARARAGDPGRLWIVADEQSGGRGRLGRTWSSPAGNLYASLLL 68

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           +D      L+ L F   VA+   + + +     + IKWPND+L  + K+ GIL+E+  L 
Sbjct: 69  LDPAPPLHLSELGFVAGVALAESVRALVDADPRLGIKWPNDLLFAEAKLGGILLESTPLP 128

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYP------VTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            G +A V+GIG+N +  P +TPYP      +         I  + +F  L   +AR L++
Sbjct: 129 GGGRACVIGIGVNCRSHPDNTPYPATALVKIGDAALAEKPIGPEHVFRALSASLARWLEV 188

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W       +I   W  +A  IG  I I    G I G F  +D  G L+L   +G  + I 
Sbjct: 189 WAGGKEFGQIRVEWLKYAAHIGRTIQIVRPNGRIEGIFKSIDAQGRLILTGPQGE-KVIE 247

Query: 247 TGDIF 251
            GD+F
Sbjct: 248 AGDVF 252


>gi|167629401|ref|YP_001679900.1| biotin-[acetyl-CoA-carboxylase] ligase [Heliobacterium
           modesticaldum Ice1]
 gi|167592141|gb|ABZ83889.1| biotin-[acetyl-CoA-carboxylase] ligase [Heliobacterium
           modesticaldum Ice1]
          Length = 333

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 102/245 (41%), Gaps = 9/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +   Y F+ ++ STN    + A  G      ++A  QT GRGR    W S  G  +Y ++
Sbjct: 78  FGRHYHFYASLPSTNRTAKELARQGAPEGTVVLAEEQTEGRGRLGRGWYSPPGLGIYFTM 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  ++       ++   +VA+   + +        +IKWPND+L+  +K  G L E   
Sbjct: 138 ILRPTVPLGLAPQVTLLTSVAVCKALETVAG--VQPQIKWPNDVLLNGKKFCGTLTELNA 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
               +  +VVG G+NV     D P        +     G  +D   + + +        D
Sbjct: 196 EMEAVNYLVVGTGINVNQSAGDFPDAVAAVATSVHATTGEKVDRARLLAAVLYFFEADYD 255

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            W        +   W   A G+G  + +       +G+   +D  G LL+ +  G +R++
Sbjct: 256 YWLASGFDR-LRAEWLERAAGMGTTVRVIAGQQEWVGKAEDIDSDGALLVRDSGGKLRRL 314

Query: 246 FTGDI 250
            +G++
Sbjct: 315 ISGEV 319


>gi|296444808|ref|ZP_06886771.1| biotin/acetyl-CoA-carboxylase ligase [Methylosinus trichosporium
           OB3b]
 gi|296257756|gb|EFH04820.1| biotin/acetyl-CoA-carboxylase ligase [Methylosinus trichosporium
           OB3b]
          Length = 267

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 84/241 (34%), Positives = 121/241 (50%), Gaps = 3/241 (1%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R   F+TI STNDE  +RA +GD G LWIVA+ QT GRGR    W S +GNL+ASLLL
Sbjct: 14  GVRLAAFETIDSTNDEARRRAEAGDPGPLWIVAARQTKGRGRLGRSWSSLEGNLHASLLL 73

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE--TLN 130
               +      L F   +A  + +         + +KWPND+L+   K+AG+L+E     
Sbjct: 74  SGFGAPAIAPQLGFVAGLATIAALIEITGAPHRLALKWPNDVLLDGAKLAGVLLEGAQPA 133

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
                 A ++G+G+N    P   PYP + L R     +   +F+ L   +   L LW   
Sbjct: 134 HPAAPFACIIGVGVNCAAAPEGLPYPASDLSRLSAPTNAGALFACLSDHMEETLQLWSSG 193

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   +   W  +A G+G+ I  +L   ++ GRF  +D  G L++   +G  R I  GDI
Sbjct: 194 AGFPALRERWLTYAAGLGEEIEARLPGETLRGRFETIDRDGRLII-SAEGGRRAIEAGDI 252

Query: 251 F 251
           F
Sbjct: 253 F 253


>gi|210610326|ref|ZP_03288355.1| hypothetical protein CLONEX_00545 [Clostridium nexile DSM 1787]
 gi|210152556|gb|EEA83562.1| hypothetical protein CLONEX_00545 [Clostridium nexile DSM 1787]
          Length = 326

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 99/242 (40%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                +++   STN      A  G       VA  Q +G+GRR   W S    N+Y SLL
Sbjct: 78  GRHVIYYEETDSTNTRIKHLAEQGKEHGTLAVADRQNSGKGRRGRAWESPLGENIYMSLL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++      +L+  +A +    I      G +V IKWPND+++  +KI GIL E    
Sbjct: 138 LRPTMEPSKAPMLTLVMAYSAAMAIRE--QEGLEVGIKWPNDLVIGTKKICGILTEMSAE 195

Query: 132 KNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+G+G+NV              +    +   I    + + + +      + + 
Sbjct: 196 VDYINYVVIGVGINVNMQSFPEELCEKATSLRVEKESPIKRSALIACIMKKFEENYERFV 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K+   + +   +          + +    G      +G+++ G LL+ ++ G    +F G
Sbjct: 256 KEQNLKFLQEDYNRLLVSKEKEVRVLEPGGEYNAYALGINETGELLVRKEDGEEETVFAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|283795506|ref|ZP_06344659.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. M62/1]
 gi|291077171|gb|EFE14535.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. M62/1]
 gi|295091188|emb|CBK77295.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Clostridium
           cf. saccharolyticum K10]
          Length = 326

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 107/242 (44%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + D + STN    K A +G +    +V+  QT G+GRR   W S +   ++ +L+
Sbjct: 78  GREILYLDEVDSTNTAAKKAAENGAVHGTLVVSERQTGGKGRRGRAWDSPRGTGIFMTLI 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +++    ++L+   A+A+   I      G +  IKWPNDI++  +KI GIL E    
Sbjct: 138 LRPNMAPVHASMLTLVAALAVADGIRE--CTGAESLIKWPNDIVMSGKKICGILTEMSAD 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  V VGIG+NV              +     G       + S +     R  +++ 
Sbjct: 196 PDCINYVAVGIGINVNMEEFPEEIRGVAASIFTETGKKTKRSLLISAVMAAFERYYEVFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K T    ++  +       G  + +    G   G  +G+D  G LL+E +   VR++ +G
Sbjct: 256 KTTDMSGLLEDYNGKLANCGRTVRVLDPAGEYSGTAIGIDREGELLVEMEDTTVRRVLSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|238019649|ref|ZP_04600075.1| hypothetical protein VEIDISOL_01523 [Veillonella dispar ATCC 17748]
 gi|237863690|gb|EEP64980.1| hypothetical protein VEIDISOL_01523 [Veillonella dispar ATCC 17748]
          Length = 324

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 109/244 (44%), Gaps = 8/244 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L    +       +   AVA+           TD  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFAPVEAPKCTLMAAVALTKAFHK--MGLTDAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
               +  +V+GIG+NV    +  P +     TSL  EG  I+  + F ++ + +      
Sbjct: 196 SMEEISYIVMGIGVNVKTKQEELPEELKLIATSLTMEGIDIERTEAFKIILESLEHQYYE 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G V++I 
Sbjct: 256 VLDSG-FEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGTVKRIM 314

Query: 247 TGDI 250
            GD+
Sbjct: 315 AGDV 318


>gi|114707383|ref|ZP_01440280.1| probable biotin--[acetyl-coa-carboxylase] synthetase protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537264|gb|EAU40391.1| probable biotin--[acetyl-coa-carboxylase] synthetase protein
           [Fulvimarina pelagi HTCC2506]
          Length = 247

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 90/238 (37%), Positives = 132/238 (55%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   F  +SSTN   ++ A SGD G+LWI    Q  GRGR   KW+S+ GNLYAS L I
Sbjct: 8   YRRLSFAAVSSTNTLALEAARSGDPGDLWITGERQLEGRGRMGRKWVSEAGNLYASWLGI 67

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D      L  L F +++A+R+ +   +      ++KWPNDIL+  +K+ GIL+E+  L +
Sbjct: 68  DVAPPAELAKLPFVVSLAIRNAVQRFVEPPASAQMKWPNDILIDGKKLVGILLESSRLPS 127

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G QA+++G G+N+ H P D PY VTSLQ EG     + +F +L ++  R L  +    G 
Sbjct: 128 GRQALILGCGINIAHKPSDAPYGVTSLQDEGYRSGPEPVFEVLAEEWHRQLLRFDGGAGF 187

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I + W   A G+    T++L   ++ G F  +D  G L+L    G  R I  GD+F
Sbjct: 188 AHIRSDWLEHAVGLSRPCTVRLPDRTLEGIFETLDADGRLILRFADGTRRPISAGDVF 245


>gi|255524378|ref|ZP_05391335.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium carboxidivorans
           P7]
 gi|296187503|ref|ZP_06855898.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium carboxidivorans
           P7]
 gi|255511935|gb|EET88218.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium carboxidivorans
           P7]
 gi|296048025|gb|EFG87464.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium carboxidivorans
           P7]
          Length = 330

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 120/257 (46%), Gaps = 11/257 (4%)

Query: 2   FSNLSECQNPY--SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
           F  +SE            +F+++ STN +  + A         +++  QT+G+GR    +
Sbjct: 66  FEEISENLTTKYIGKNLFYFESLDSTNTKAKELASKDATHGTVVISEEQTSGKGRLGRVF 125

Query: 60  ISD-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
           +S  +  ++ S+++   +    +  ++   A A+     +       V++KWPNDI++  
Sbjct: 126 VSPKRKGIWMSIIMRPDMEPLKVPKITQVGAAALVKTFENF---NIKVQVKWPNDIILNN 182

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCI-DLKDIF 173
           +K+ GIL E     N +  VV+GIG+N        P D     TS+  E G     K+  
Sbjct: 183 KKLCGILTEMSGELNKVSYVVMGIGINANLDKEDFPEDLRDKATSISIETGNYIKRKEFV 242

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           S+L     ++ + + ++   +  +++ R  +  IG  I I      I  + + +D+ G L
Sbjct: 243 SILMNTFEKLYEEFVEEDNIKTSVSICRDHSILIGKEIKIINRNEEIFAKALDLDENGEL 302

Query: 234 LLEEKKGCVRQIFTGDI 250
           ++E K G V +IF+G++
Sbjct: 303 VVEFKDGSVHKIFSGEV 319


>gi|304314249|ref|YP_003849396.1| biotin ligase [Methanothermobacter marburgensis str. Marburg]
 gi|302587708|gb|ADL58083.1| predicted biotin ligase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 261

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 114/244 (46%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
               + FD + STN+   + A  G      ++A  Q+ GRGRR   WIS +G ++ S++L
Sbjct: 18  GHEVKCFDEVDSTNNVAKRMAEDGAPEGTVVIARTQSRGRGRRGKPWISPQGGIWMSIIL 77

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +   +  LL+    VA+   +      G DV IKWPNDIL+  +K+ GIL E     
Sbjct: 78  RPEVHPSTAPLLTLVTGVAVARTLKE--ECGLDVGIKWPNDILIGDKKVCGILTEAHARF 135

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI-----FSLLFQDVARVLDLW 187
           N L+ VVVG+G++        P  +            +DI      S   ++   V D +
Sbjct: 136 NTLEYVVVGVGIDTNVDISHFPEDLREGATSIKNELQRDIKSSELISRFLKNFEDVYDSF 195

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           K+     EI+  WR  +  IG  + I+      + G  +G++  G L+LE   G +R++ 
Sbjct: 196 KEGKMD-EILREWRRMSKTIGRRVEIRKQLGEVVRGEAIGINSEGALILELDDGTLRKVI 254

Query: 247 TGDI 250
           +G+ 
Sbjct: 255 SGEC 258


>gi|317132336|ref|YP_004091650.1| biotin/acetyl-CoA-carboxylase ligase [Ethanoligenens harbinense
           YUAN-3]
 gi|315470315|gb|ADU26919.1| biotin/acetyl-CoA-carboxylase ligase [Ethanoligenens harbinense
           YUAN-3]
          Length = 323

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 107/242 (44%), Gaps = 9/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
             R   F +I STN +  + A  G+     +VA  QT GRG     W       ++ S++
Sbjct: 80  GRRIIHFQSIDSTNRKAKELAEQGEPEGTIVVAETQTGGRGCAGRTWDSKPMEGIWMSVI 139

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++   S+  ++     A+   + +   +   V+IKWPNDILV  +KI+G+L E+   
Sbjct: 140 LRPTLDLPSVPCITQIACAAVGQALET---MVKAVQIKWPNDILVNDKKISGVLTESSGE 196

Query: 132 KNGLQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +Q  VVGIG+NV        P       +  +  G     + +   + + + R   L
Sbjct: 197 IDRVQYAVVGIGVNVNQNAEDFLPELAEKATSLKRETGKAQSRQKLCCTILEALERAYLL 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
               TG E  +   +  +  +G  ++   +   + G  V +D+ G L++    G +R I 
Sbjct: 257 GDGATGMECAITYCKDHSVTLGRPVSFMENGMEVHGTAVDIDERGGLVVRTPNGVIRHIS 316

Query: 247 TG 248
           +G
Sbjct: 317 SG 318


>gi|253580951|ref|ZP_04858213.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847793|gb|EES75761.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Ruminococcus sp. 5_1_39BFAA]
          Length = 267

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 106/254 (41%), Gaps = 9/254 (3%)

Query: 3   SNLSECQNP--YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
             +S+  N         F     STN    + A  G       VA  Q+AGRGR D +W 
Sbjct: 8   ETISQAINTKWAGKTVHFAKETDSTNSWIKRLAKDGAEHGTLAVAEFQSAGRGRFDRRWE 67

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           + +  ++  +LLL    S    ++L+  + +A+            +V IKWPNDI++ ++
Sbjct: 68  APEGSSIMMTLLLRPEFSPQYASMLTLVMGMAVAQAAEELGF---NVSIKWPNDIVISKK 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           KI GIL E       +  V++G+G+NV              + +   G   D   + +L+
Sbjct: 125 KICGILTEMGTNGVKINYVLIGVGINVNLKEFPEEMQDKATSLILEGGHEYDRNQVIALV 184

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            +      + + +      +++ +      +   + +     S  G   G+D+ G LL+E
Sbjct: 185 MKYFEINYEKFIQTCDFTHLLDDYHRILANLNQPVRVIDGDRSFEGICRGIDEKGELLVE 244

Query: 237 EKKGCVRQIFTGDI 250
            +   V ++  G++
Sbjct: 245 RQNKEVVKVSAGEV 258


>gi|90417829|ref|ZP_01225741.1| biotin--acetyl-CoA-carboxylase ligase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337501|gb|EAS51152.1| biotin--acetyl-CoA-carboxylase ligase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 262

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 100/238 (42%), Positives = 139/238 (58%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
            R    D +SSTN   ++ A +GD G LW+ A  Q+AGRGRR   W+S++GNLYAS LLI
Sbjct: 9   RRRLTLDEVSSTNTVALEAARAGDPGPLWVTAERQSAGRGRRGRNWVSERGNLYASWLLI 68

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D      L+ L    ++ +R+ +A  +  G  V +KWPND+L+  RK  GIL+E+  L +
Sbjct: 69  DPAPLTQLSNLPLVASLGVRNGLARLVAEGDTVAVKWPNDVLIKGRKTVGILLESERLPD 128

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G  AVVVG G+NV H P DTPYPVTSL  EG   DL+ +F  +  ++ RVL ++    G 
Sbjct: 129 GRMAVVVGCGINVAHVPDDTPYPVTSLALEGATHDLEAVFGAVAAEMERVLAIFAGGRGF 188

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I N W   A G+G    + L+   + GRF  +D+ G LLL +  G V  +  GD+F
Sbjct: 189 SAIRNEWLAHAVGVGQPCRVNLADAVLTGRFEALDEHGLLLLRDAAGRVTAVSAGDLF 246


>gi|302386861|ref|YP_003822683.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium saccharolyticum
           WM1]
 gi|302197489|gb|ADL05060.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium saccharolyticum
           WM1]
          Length = 327

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 112/247 (45%), Gaps = 6/247 (2%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
            +  +    E+ + I STN    + A  G      ++A  Q AGRGRR   W+S    N+
Sbjct: 74  IKGKFGREVEYHEIIDSTNIRAKRLAEEGASSGTLVLADLQEAGRGRRGRTWVSPSGNNI 133

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + SL+L   I   S ++++   A+A+   I +         IKWPNDI+   +K+ GIL 
Sbjct: 134 FMSLILRPDILPSSASMITLVAALAVYDGIKNLTG--LAAGIKWPNDIVANGKKLCGILT 191

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID---LKDIFSLLFQDVARV 183
           E      G+  VVVGIG+NV           T+        +      + + + +   + 
Sbjct: 192 EMSAELEGIHYVVVGIGINVNMEEFPEEVRQTATSLFLETGEKVGRSRLVAAVMEAFEQY 251

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            + +        +++++       G  + +    G  +G+ +G+++ G LL+E + G VR
Sbjct: 252 YEEFISQGDLSGLISVYNKNMVNAGKEVRVLDRSGDYIGKALGINEKGELLVEVEPGKVR 311

Query: 244 QIFTGDI 250
           ++ +G++
Sbjct: 312 RVISGEV 318


>gi|282163048|ref|YP_003355433.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Methanocella paludicola SANAE]
 gi|282155362|dbj|BAI60450.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Methanocella paludicola SANAE]
          Length = 320

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 61/238 (25%), Positives = 109/238 (45%), Gaps = 5/238 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +    +   STN    + A  G      ++A  Q+ G+GR   KW++  G+L  S++L
Sbjct: 79  GRKVIHLNVTGSTNTVARQVAERGVEEGTVVLAETQSHGKGRLGRKWVAKPGSLAMSVIL 138

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +I     + ++   AV++   +      G +  IKWPND+LV  +KI GIL E     
Sbjct: 139 KPAIDPMHASSITLMAAVSVTKALR---GAGLEAAIKWPNDVLVNGKKICGILTEMSAET 195

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           + +  +++GIG+NV +  V      T        +D      LL + +      +K++  
Sbjct: 196 DIVNFIILGIGVNVNND-VPLETATTMKAELSREVDRVKFTQLLLEMLEEDYLTFKEEG- 253

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I+  WR ++  +G L+ +      + G    VD+ G LL++   G +R+I +GD 
Sbjct: 254 FTPILWSWRRYSDTLGRLVEVTYQDEVVTGVAQDVDEDGSLLVKTADGSIRKIVSGDC 311


>gi|269797569|ref|YP_003311469.1| biotin/acetyl-CoA-carboxylase ligase [Veillonella parvula DSM 2008]
 gi|269094198|gb|ACZ24189.1| biotin/acetyl-CoA-carboxylase ligase [Veillonella parvula DSM 2008]
          Length = 324

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 106/243 (43%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + DT  STN E    A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARCLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L            +   AVA+            D  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHKIGLT--DAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  +V+GIG+NVK    + P  +  +       D+    +  F+ +   L+     
Sbjct: 196 SMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYYE 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G +++I  
Sbjct: 256 VLDSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVAKDIDEDGNLLVRISDGTIKRIVA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|226324184|ref|ZP_03799702.1| hypothetical protein COPCOM_01963 [Coprococcus comes ATCC 27758]
 gi|225207733|gb|EEG90087.1| hypothetical protein COPCOM_01963 [Coprococcus comes ATCC 27758]
          Length = 326

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 101/240 (42%), Gaps = 6/240 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E++D I STN+       +G       VA  QTAG+GRR   W S    ++  S+LL 
Sbjct: 80  NLEYYDEIDSTNNRAKALGEAGGADGTLFVAETQTAGKGRRGRCWQSPAGSSISMSILLR 139

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             ++     +L+  +A A    +        D+ IKWPND++V  +KI+GIL E     +
Sbjct: 140 PVMNPSDAPMLTLVMAYAATKALRE--KTELDIGIKWPNDLVVSGKKISGILTEMSAEID 197

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQDVARVLDLWKKD 190
            +  VV+GIG+NV           T+              ++ + + +   +  +   + 
Sbjct: 198 YINHVVIGIGINVNMESFPEDIAKTATSLRIEAGKEFRRFELIAAIMEHFEKAYEAVCEA 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              E IM  +       G  + +           +G+D  G L +E + G  + +F G++
Sbjct: 258 GSLEPIMEDYNRLLVNCGRRVRVLEPEHEYDALALGIDKTGELQVECEDGSRKSVFAGEV 317


>gi|225572775|ref|ZP_03781530.1| hypothetical protein RUMHYD_00966 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039832|gb|EEG50078.1| hypothetical protein RUMHYD_00966 [Blautia hydrogenotrophica DSM
           10507]
          Length = 325

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 104/242 (42%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + +++ STN    K A  G      ++A  QTAG+GRR   W + K  N+ A+ L
Sbjct: 78  GKELYYQESVDSTNTWAKKLAEEGAPNGTVVLADEQTAGKGRRGRTWKNPKGANIAATFL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L      ++  +L+  + +++  +      +G D  IKWPND++V  +KI GIL E    
Sbjct: 138 LRPQFMPEAAPMLTLVMGLSVAQICRE---MGLDAWIKWPNDVVVSGKKICGILTEMSAQ 194

Query: 132 KNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+G G+NV      P       +    +        I + + +      +++ 
Sbjct: 195 VDYVNYVVIGAGINVNLSVLPPELKEIATSFYLEKKEVFPRAQIIARVIEVFEENYEIYT 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K     ++   +       G  + +    G   G   G+D  G L ++++ G V ++  G
Sbjct: 255 KTNDLSQLAETYNQMLINHGRQVKVLDPSGEFAGVSGGIDRSGRLSVKKEDGTVVKVMAG 314

Query: 249 DI 250
           ++
Sbjct: 315 EV 316


>gi|15679898|ref|NP_277016.1| biotin acetyl-CoA carboxylase ligase / biotin operon repressor
           bifunctional protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2623050|gb|AAB86376.1| biotin acetyl-CoA carboxylase ligase/biotin operon repressor
           [Methanothermobacter thermautotrophicus str. Delta H]
          Length = 261

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
               + FD + STN+   + A  G      ++A  Q+ GRGRR   WIS +G ++ S++L
Sbjct: 18  GHEIKCFDEVDSTNNVAKRMAEDGATEGTVVIAKTQSRGRGRRGKPWISPQGGIWMSIIL 77

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +      LL+    VA+   +      G DV IKWPNDIL+  +K+ GIL E     
Sbjct: 78  RPEVHPSRAPLLTLVAGVAVARTLR--DECGLDVGIKWPNDILIGDKKVCGILTEAHARF 135

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI-----FSLLFQDVARVLDLW 187
           N L+ VVVG+G++        P  +            +DI      +   ++     + +
Sbjct: 136 NTLEYVVVGVGIDTNVDISHFPDDLREGATSIKNELKRDIKSSELIARFLRNFEETYNSF 195

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           K      EI+  WR  +  IG  + I+      + G  VG++  G L+LE   G +R++ 
Sbjct: 196 KDGKMD-EILTEWRKLSKTIGRRVEIRKQLGEIVHGDAVGINSEGALILELDDGTLRKVI 254

Query: 247 TGDI 250
           +G+ 
Sbjct: 255 SGEC 258


>gi|313894610|ref|ZP_07828173.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440800|gb|EFR59229.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 324

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 107/243 (44%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  RY + D   STN E  + A  G      +V   Q AGRGR    W S     L+ SL
Sbjct: 78  FGKRYVYMDVTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L    +       +   AVA+           TD  IKWPNDILV  RK+ GIL E   
Sbjct: 138 ILRPDFAPVEAPKCTLMAAVALTKAFHK--MGLTDAGIKWPNDILVNGRKLVGILTEMSG 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  +V+GIG+NVK    + P  +  +        +    +  F+ +   L+     
Sbjct: 196 SMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEGIDIERTEAFRIILEALEYQYYD 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D+G EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G V+++  
Sbjct: 256 VLDSGFEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGTVKRVMA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|296131762|ref|YP_003639009.1| biotin/acetyl-CoA-carboxylase ligase [Thermincola sp. JR]
 gi|296030340|gb|ADG81108.1| biotin/acetyl-CoA-carboxylase ligase [Thermincola potens JR]
          Length = 324

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R  +FDTI STND+  + A +G    L IVA  QT GRGR    W S K   ++ S++
Sbjct: 79  GSRIVYFDTIGSTNDKGKELAANGAPEGLVIVAEEQTTGRGRLGRTWSSPKGRGIWMSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+      L+   AVA+     S         IKWPND+ +  +KIAG+L E    
Sbjct: 139 LRPEINPMDAPKLTLLTAVALARTFDSYPG--IQPGIKWPNDVFIKGKKIAGVLTEMNAE 196

Query: 132 KNGLQAVVVGIGL-----NVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
              +  VVVGIG+       +  P       +     G     KD  + L +++  +   
Sbjct: 197 LERINYVVVGIGVNVNTSRAELPPEIENIATSLYIETGKSWSRKDFLTKLLEELEALYLS 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +K       ++  W+ ++  +   I +     ++ G  V +DD G L++  + G ++++ 
Sbjct: 257 FK-MGEYAAVVEEWKKYSVTLNKKIKVTSPGVALEGTAVDLDDDGALIVRTRDGSLKRVV 315

Query: 247 TGDI 250
            G+I
Sbjct: 316 AGEI 319


>gi|291563815|emb|CBL42631.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region
           [butyrate-producing bacterium SS3/4]
          Length = 326

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 104/242 (42%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             +  FF+   STN+E  + A  G       VA  Q  G+GRR   W S  G  ++ S+L
Sbjct: 78  GTQVAFFEETDSTNNEIRRLAEQGAPHGTLAVAERQLGGKGRRGRVWTSPAGVGIWMSML 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I   + ++L+  +A++ R  I          +IKWPND+++ ++KI GIL E    
Sbjct: 138 LRPQIDPMAASMLTLVMALSTRRGIEKATG--LKSEIKWPNDLVLNKKKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLWK 188
              +Q V+ G G+NV           T+              +I + + +      D + 
Sbjct: 196 LMEIQYVIPGTGINVNQMEFPDDIKATATSLRIESGKIQKRSEIIAAIMEAFEGYYDTFI 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      ++  +      +G+ + +    G   G   G++  G LL+    G +++I +G
Sbjct: 256 ETQDMSGLIEEYNANLVNLGNEVCVLDPAGEYRGVSEGINKEGALLVRLSDGTLKEIISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|303242169|ref|ZP_07328658.1| biotin/acetyl-CoA-carboxylase ligase [Acetivibrio cellulolyticus
           CD2]
 gi|302590251|gb|EFL60010.1| biotin/acetyl-CoA-carboxylase ligase [Acetivibrio cellulolyticus
           CD2]
          Length = 334

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 119/250 (47%), Gaps = 13/250 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
                 F  I STN+   K AL G      +VA  QT+GRGR   +W  SDK  ++ SL+
Sbjct: 79  GRNIAHFGKIDSTNNYAKKIALEGCEEGTLVVADFQTSGRGRLGREWNSSDKKGVWMSLV 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I  + + +++ A ++A+   +        +  IKWPNDI++  +K+ GIL+E    
Sbjct: 139 LRPDIPFEEVQIITLAASIAVVRALKEV--AQIEAGIKWPNDIIINGKKVCGILVEMNME 196

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  +V+GIGLNV       P +     TSL+                + +  +L  +
Sbjct: 197 IDRINFLVLGIGLNVNQKVNDFPDELKDKATSLRICMEETLDNQKLLKRSELIRAILLKF 256

Query: 188 KKDTG------REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           ++          EEI++ W+ ++  +G  +++       +G   G+   G L+++ + G 
Sbjct: 257 EEIYDKVNSGAFEEIISEWKKYSVTLGKEVSMTYKDKQCIGIAEGITRDGKLIVKCEDGT 316

Query: 242 VRQIFTGDIF 251
           V+++ +G+++
Sbjct: 317 VKEVLSGEVW 326


>gi|307942133|ref|ZP_07657484.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseibium sp. TrichSKD4]
 gi|307774419|gb|EFO33629.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseibium sp. TrichSKD4]
          Length = 258

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 90/239 (37%), Positives = 131/239 (54%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR E    + STN    +RA +GDLG++W+ A+ QTAGRGRR   W S++GNL+ASLLL
Sbjct: 15  GFRVERHGAVPSTNTLAFERARAGDLGHIWMTATEQTAGRGRRGRHWASNQGNLFASLLL 74

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           I+    + L  L    AVA+   I          K+KWPND+LV   K++GIL+E   L 
Sbjct: 75  INPAPTNRLPELPMVAAVALSKAIDLATGGYHLAKLKWPNDLLVSGAKLSGILLEAETLV 134

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +   AVV+G G+N    P D  YP T L   G  +  +D+F  L   +A  L  W    G
Sbjct: 135 DNRTAVVLGFGVNCVTHPHDALYPCTDLAALGYRVSAEDLFHHLASSLADELATWNSSNG 194

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             +I + W   A  +   +T++    ++ G+F  +DD G+L+L+   G ++ IF GD+F
Sbjct: 195 FSQIRSGWLERAAHLRQQVTVRNGDEAVTGQFHNLDDRGHLVLKLDNGSLKTIFAGDVF 253


>gi|261417982|ref|YP_003251664.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC61]
 gi|297529650|ref|YP_003670925.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus sp. C56-T3]
 gi|319767206|ref|YP_004132707.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC52]
 gi|261374439|gb|ACX77182.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC61]
 gi|297252902|gb|ADI26348.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus sp. C56-T3]
 gi|317112072|gb|ADU94564.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC52]
          Length = 329

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/244 (29%), Positives = 112/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                FFD + ST     + A  G      +VA  Q AGRGR D KW S K   ++ SL+
Sbjct: 87  GHTIHFFDEVDSTQRIAARLAYEGAPEGTLVVAEEQKAGRGRLDRKWFSPKGTGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   AVA+   I     +  D  IKWPNDIL+  RK  GIL E    
Sbjct: 147 LRPAIPPQRAPQLTLLAAVAVSQAIQEVTGLVPD--IKWPNDILLDGRKCVGILTELQAD 204

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + +V++GIG+NV       P  + ++       +GG +    +   +   + R+ + 
Sbjct: 205 PDRVHSVIIGIGINVNQTIEQFPEDIRAIATSLAIEKGGPVKRAPLIQEILFRLERLYEQ 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +     R   + LW  +A  IG  +T +   G I G   G+ D G L+LE+++  +  I 
Sbjct: 265 YLAHGFRPIKL-LWEGYAVSIGKPVTARTLNGVIHGIARGITDDGLLILEDEQKNIHYIH 323

Query: 247 TGDI 250
           + DI
Sbjct: 324 SADI 327


>gi|304316132|ref|YP_003851277.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777634|gb|ADL68193.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 326

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 121/242 (50%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y  F++ISSTND   + A S       IVA  QT+GRGR    W+S+K   ++ S++
Sbjct: 80  GRNYLHFESISSTNDYAKEIAPS-ATDGTAIVAEEQTSGRGRMGRHWVSNKGQGIWLSMI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++S +    L+   AVA+   I           IKWPNDI++  +K+ GIL E    
Sbjct: 139 LKPNLSPNEAVKLTQVAAVAVVDSIKEIAD--IRSGIKWPNDIVINSKKVCGILTEMNGE 196

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWK 188
            + +  +V+GIG+NV   + P D     TSL  E G I D K + + +  +  +   ++ 
Sbjct: 197 IDRVNFIVIGIGINVNVQNFPEDLCGKATSLSIETGKILDRKPLTASILNNFEKYYRIFL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            +     I NL + ++  +   + + ++    +GR V +DD G L++  K G  + I +G
Sbjct: 257 ING-FSSIRNLCKEYSLTLNKDVKVIINNNECIGRAVDIDDDGNLIVVFKNGEKKTIASG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|154253651|ref|YP_001414475.1| biotin--acetyl-CoA-carboxylase ligase [Parvibaculum lavamentivorans
           DS-1]
 gi|154157601|gb|ABS64818.1| biotin--acetyl-CoA-carboxylase ligase [Parvibaculum lavamentivorans
           DS-1]
          Length = 252

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 118/240 (49%), Gaps = 4/240 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
              F  I STN+E  + A +G+ G LW+VA  QTAGRGRR   W+S  GN   +LL    
Sbjct: 7   VRRFAEIDSTNEEARRLAEAGEPGPLWLVAERQTAGRGRRGRNWVSPTGNFMGTLLFRPR 66

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNL-K 132
                   LSF  AVA+   + S LP       ++KWPND+L  + K+AGIL+E+  +  
Sbjct: 67  CGPRQAGELSFVAAVAVHDAVESLLPPHLRAGLRLKWPNDLLHDKAKLAGILLESSGMAG 126

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             +  V +G+G+N+ H P    YP TSL     G +   +    L       L  W+   
Sbjct: 127 AEVAWVAIGMGINLAHHPEGLEYPATSLAAMSVGLVTPDEAQQALAASFDSWLTKWRGVQ 186

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G   I   W   A G+G  +T++L+ G+  G F G+   G L L    G +R +  GD+F
Sbjct: 187 GFAVIREAWLKRAQGLGGPVTVRLADGTYDGTFEGLAPDGTLQLRMPDGELRLVAAGDVF 246


>gi|56420715|ref|YP_148033.1| biotin [acetyl-CoA carboxylase] synthetase; transcriptional
           repressor of the biotin operon [Geobacillus kaustophilus
           HTA426]
 gi|56380557|dbj|BAD76465.1| biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Geobacillus kaustophilus
           HTA426]
          Length = 329

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/244 (29%), Positives = 112/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                FFD + ST     + A  G      +VA  Q AGRGR D KW S K   ++ SL+
Sbjct: 87  GHTIHFFDEVDSTQRIAARLAYEGAPEGTLVVAEEQKAGRGRLDRKWFSPKGTGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   AVA+   I     +  D  IKWPNDIL+  RK  GIL E    
Sbjct: 147 LRPAIPPQRAPQLTLLAAVAVSQAIQEVTGLVPD--IKWPNDILLDGRKCVGILTELQAD 204

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + +V++GIG+NV       P  + ++       +GG +    +   +   + R+ + 
Sbjct: 205 PDRVHSVIIGIGINVNQTIEQFPEDIRTIATSLAIEKGGPVKRAPLIQEILFRLERLYEQ 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +     R   + LW  +A  IG  +T +   G I G   G+ D G L+LE+++  +  I 
Sbjct: 265 YLAHGFRPIKL-LWEGYAVSIGKPVTARTLNGVIHGIARGITDDGLLILEDEQKDIHYIH 323

Query: 247 TGDI 250
           + DI
Sbjct: 324 SADI 327


>gi|15614248|ref|NP_242551.1| transcriptional repressor of the biotin operon [Bacillus halodurans
           C-125]
 gi|10174302|dbj|BAB05404.1| transcriptional repressor of the biotin operon [Bacillus halodurans
           C-125]
          Length = 323

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 110/245 (44%), Gaps = 9/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     + ++ +ST    +K A  G      ++A+ QT+G+GR    W S    ++  S+
Sbjct: 78  FGREITYLESTASTQTVALKLAQEGAKEGHIVLANEQTSGKGRMGRGWYSPPGSSISMSI 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +    +       L+   AVA+   I  T     D  IKWPND+L+  +KI GIL E   
Sbjct: 138 IFRPQLPPQKAPQLTLLTAVAIVRAIKETTG--LDSDIKWPNDLLIDGKKIVGILTEMQA 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLD 185
            ++ + +V+ GIG+NV H        +  +      ++G  I    + + + +++    D
Sbjct: 196 DQDSVHSVIQGIGINVNHQEEAFAEEIRKIATSLAIKKGEPIQRAPLIAAILKNIELFYD 255

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L+ +      I  LW   A  IG  I  ++      G   G+ D G LLLE+  G +  I
Sbjct: 256 LYLQHG-FSRIKPLWEAHAISIGKRIRARMLNDVKFGVAKGITDDGVLLLEDDDGKLHSI 314

Query: 246 FTGDI 250
           ++ DI
Sbjct: 315 YSADI 319


>gi|253681244|ref|ZP_04862042.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum D
           str. 1873]
 gi|253562482|gb|EES91933.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum D
           str. 1873]
          Length = 328

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 117/244 (47%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                +F+TI STN++  +    G L    +++  QT GRGR   +W+S K   ++ S++
Sbjct: 79  GKNIMYFNTIDSTNNKAKELGAKGILEGTVVISEEQTGGRGRLGRQWVSPKFKGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I     + ++   A A+ SVI      G DV IKWPNDI++  +KI GIL E    
Sbjct: 139 LRPNIEPMEASKITQIAAAAVCSVIKEL---GIDVYIKWPNDIVLNNKKICGILTEMSGE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  +V+GIG+NV     D P  +  +           I  K++ + +F     + D 
Sbjct: 196 INKINYIVLGIGINVNIDKEDFPEYIKDIATSIKIETGLNIQRKELIAKIFNKFEILYDE 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +  +   ++ + + +  +  +G  + I      +  + + + + G L++E   G V +I 
Sbjct: 256 FINEGTIKKSIEICKGNSALLGKEVKIIRKSTEVFAKALTIAEDGELIVEYDDGKVEKIV 315

Query: 247 TGDI 250
           +G++
Sbjct: 316 SGEV 319


>gi|284048928|ref|YP_003399267.1| biotin/acetyl-CoA-carboxylase ligase [Acidaminococcus fermentans
           DSM 20731]
 gi|283953149|gb|ADB47952.1| biotin/acetyl-CoA-carboxylase ligase [Acidaminococcus fermentans
           DSM 20731]
          Length = 331

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 106/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + ++++S+N+   K A          VA  QT G+GR    W S K   L+ SLL
Sbjct: 79  GRAICYEESVTSSNEVLKKLADKNAADGTVCVAEEQTGGKGRLARGWFSPKGKGLWFSLL 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S        ++   AVA+   I        + +IKWPND+L+  +K+ GIL E    
Sbjct: 139 LKPSFLPQEAPKMTLLSAVAVVRAIREVC--QVEAQIKWPNDVLLNGKKLVGILTEMSAE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-----GCIDLKDIFSLLFQDVARVLDL 186
              +  +VVGIG+NV       P  +            G +D   + + +   +    D+
Sbjct: 197 FGHINYLVVGIGINVCVPHDMVPEELRPAAISIADAVEGKVDRVALLAKVLDYLESYYDI 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                G   I++ WR ++  +G  + +     + +G  + +D+ G L ++++ G V  + 
Sbjct: 257 -ACREGFGPILDQWRDYSITLGKQVKVIAPDKTYVGTALDIDETGALQVKKEDGTVETVL 315

Query: 247 TGDI 250
            GD+
Sbjct: 316 AGDV 319


>gi|331091973|ref|ZP_08340805.1| hypothetical protein HMPREF9477_01448 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402872|gb|EGG82439.1| hypothetical protein HMPREF9477_01448 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 545

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 120/254 (47%), Gaps = 7/254 (2%)

Query: 2   FSNLSECQNPY-SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
            ++L E    + S     ++ I STN E ++ A +G+     +VA  Q AGRGRR   W 
Sbjct: 285 VTDLMEMNTRWASGTVYSYEEIDSTNAEALRLAKAGESHGTLVVAKKQYAGRGRRGRTWE 344

Query: 61  SD-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S+ + N+Y SLLL    S     +L+  +A ++  V+        DV IKWPND+++ ++
Sbjct: 345 SEDEENIYMSLLLRPEFSAGKAPMLTLVMAYSVAKVLRE--QENLDVIIKWPNDLVIGKK 402

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           KI GIL E    +N + +V++G+G+NV              +  +  G      D+ + +
Sbjct: 403 KICGILTEMKMEENKISSVIIGVGINVNVESFPRELRDKATSLRREAGREFCCTDLIAKI 462

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            +   +  + + +      I   +       G  + I   +       +G+++ G LL+E
Sbjct: 463 MESFEQNYNYFSEVEDLSFIQEEYNEILVNCGKQVRILEPHNEYEAVALGINEEGELLVE 522

Query: 237 EKKGCVRQIFTGDI 250
           ++ G + ++F G++
Sbjct: 523 KETGEIERVFAGEV 536


>gi|317122126|ref|YP_004102129.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter marianensis
           DSM 12885]
 gi|315592106|gb|ADU51402.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter marianensis
           DSM 12885]
          Length = 362

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 114/242 (47%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +   + STND   + A  G      ++A  Q AGRGR    W S  G L+ SL+L
Sbjct: 96  GHTVHWLPEVGSTNDVARRLADDGAPEGTLVIADRQLAGRGRLRRAWWSPPGGLWMSLIL 155

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             ++  + L LL+ A A A+   +         V  KWPND+L+  RKIAGIL+ET+   
Sbjct: 156 RPTLPPERLPLLTLAAAAAVAEALERHAGRPVAV--KWPNDVLIDDRKIAGILLETVAHP 213

Query: 133 NGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           +G + VV GIG+N+       P      +T L RE      ++  +    D   V     
Sbjct: 214 HGAEYVVAGIGINLDVEGEPVPPGLEGRLTWLAREVVEPVTRNEVAEAVLDRLEVRYRQL 273

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            D G + +++ WR  A  +G+ + + L  G ++G  + V   G L++E+  G   ++  G
Sbjct: 274 HDQGPDPVLDAWRARAAWLGEPVRVTLPAGEVVGIALDVAPDGSLVVEQAGGRRERVLAG 333

Query: 249 DI 250
           D+
Sbjct: 334 DV 335


>gi|258645670|ref|ZP_05733139.1| biotin-[acetyl-CoA-carboxylase] ligase [Dialister invisus DSM
           15470]
 gi|260403037|gb|EEW96584.1| biotin-[acetyl-CoA-carboxylase] ligase [Dialister invisus DSM
           15470]
          Length = 329

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 110/243 (45%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  +F++  STN+E  K A  G      +VA  QT GRGR    + S     ++ S++
Sbjct: 79  GKKVVYFESTPSTNEEAKKIAREGAEEGTIVVAEEQTTGRGRLTRHFYSPFAKGIWFSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
              +      +  +   AV +   I        D  IKWPNDIL   +K+ G+L E    
Sbjct: 139 FRPTFFPMEASKSTLLAAVGVCRGIRRL--GLADAGIKWPNDILYHGKKLVGMLCEMSAS 196

Query: 132 KNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  +++GIG+N     K  P D     TS   EG  +  +D+ + +  ++     L 
Sbjct: 197 MEKIDYIIMGIGINTGVKEKEFPEDFRGHATSFLNEGVNVSRRDLLAAVLAELEAEYKL- 255

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   +++ WR  +  +G+ + +     +  G+ V +DD G LL++  +  VR++  
Sbjct: 256 AQTEGFGRVLDDWRKLSVTLGEEVRVIFGNDNYTGKAVDIDDDGCLLVDTGR-EVRRVMA 314

Query: 248 GDI 250
           GD+
Sbjct: 315 GDV 317


>gi|300855842|ref|YP_003780826.1| bifunctional biotin operon repressor/biotin-(acetyl-CoA
           carboxylase) ligase [Clostridium ljungdahlii DSM 13528]
 gi|300435957|gb|ADK15724.1| bifunctional protein: biotin operon repressor/ biotin-(acetyl-CoA
           carboxylase) ligase [Clostridium ljungdahlii DSM 13528]
          Length = 329

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +   +++I STN    K A   +     I+A  QTAGRGR    W S K  ++Y S++
Sbjct: 80  GKKIIHYESIGSTNTTAKKLAEQEEENGTIIIAEEQTAGRGRIGRTWSSPKYKSIYFSII 139

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +++   +  ++  IA A+   +        + K+KWPNDI++  +K+ GIL E    
Sbjct: 140 LRPNVNPMEVPKITQIIAAAIIEGLKEL---KIEAKVKWPNDIVIDGKKVCGILTEMSGE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  V+ GIG+NV     D    + +            +D K I   +      + + 
Sbjct: 197 LNKVNYVIPGIGINVNLNKEDFQEDILNKATSLKIETGSTMDRKVILGTILNKFEPLYEE 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + +    E  + + +  +  IG  I I  +      + V + + G L+++ + G   ++ 
Sbjct: 257 FVQKGTIESSIEVCKNNSAAIGKNIRIIQNKSERQAKAVDLAEDGRLIVQYENGSFEKLI 316

Query: 247 TGDI 250
           +G+I
Sbjct: 317 SGEI 320


>gi|147676590|ref|YP_001210805.1| biotin-(acetyl-CoA carboxylase) ligase [Pelotomaculum
           thermopropionicum SI]
 gi|146272687|dbj|BAF58436.1| biotin-(acetyl-CoA carboxylase) ligase [Pelotomaculum
           thermopropionicum SI]
          Length = 325

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 100/245 (40%), Gaps = 9/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     + D++ STND   + A  G      +VA  QTAG+GR    W + +   L  SL
Sbjct: 78  FGREIFYRDSVPSTNDLAKEMARRGAGEGAVVVAEEQTAGKGRLGRGWHTPRYKGLCFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +       ++   AVA+ S I           IKWPNDILV  +KI GIL E   
Sbjct: 138 ILYPPVVPSEAAQVTMLAAVAVASAIRDVAG--VPAGIKWPNDILVNSKKICGILTELSA 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLD 185
             + +  +V GIG+NV     D P  + S+           +    +      +  +   
Sbjct: 196 EMDKINYLVTGIGINVNQDLDDFPGELRSVATSVKIEAGRAMPRLKLLQACLAEFEKWYA 255

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +W        ++  W+  +  +   + I        G    VD  G LLL    G ++++
Sbjct: 256 VWLGQG-FSPVLARWKEMSVSLHCPVRISTLKECWDGWAEDVDQDGALLLRLSDGSLKRL 314

Query: 246 FTGDI 250
            +G++
Sbjct: 315 VSGEV 319


>gi|90423919|ref|YP_532289.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB18]
 gi|90105933|gb|ABD87970.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB18]
          Length = 267

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 133/245 (54%), Gaps = 6/245 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD+I STN E M RA  G+ G +W+V + QTAGRGRR   WI+ +GNL +S+L 
Sbjct: 13  GYRVAAFDSIGSTNAEAMARARQGEAGPIWLVTTEQTAGRGRRQRSWIAPRGNLASSVLE 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTL------PVGTDVKIKWPNDILVFQRKIAGILI 126
           +  ++  +   L FA  +A+++ + +            D ++KWPND+L    K+AGIL+
Sbjct: 73  VMEVAPGTAATLGFAAGLALQAALRTLTAQAVGEGPAIDYRLKWPNDVLAGSHKLAGILL 132

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E   + +G  AVVVGIG NV   P DTPYP  SL+  G  +  + +F+ L    A    +
Sbjct: 133 EAEEVADGRLAVVVGIGTNVVAAPGDTPYPAASLKALGLDVTAEQLFAALSDHWASYRAI 192

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W    G  EI   W   A G+G  ++I+    ++ G F  +DD G L++   +G    I 
Sbjct: 193 WDLGRGFAEIRRQWLQHAAGLGGTVSIRSGATTVEGLFDSIDDTGCLIVRTPEGRQIPIA 252

Query: 247 TGDIF 251
            GD++
Sbjct: 253 AGDVY 257


>gi|295689610|ref|YP_003593303.1| biotin/acetyl-CoA-carboxylase ligase [Caulobacter segnis ATCC
           21756]
 gi|295431513|gb|ADG10685.1| biotin/acetyl-CoA-carboxylase ligase [Caulobacter segnis ATCC
           21756]
          Length = 251

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 117/238 (49%), Gaps = 4/238 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
               D I STN E  +RA +G+ G  W+V   QTAGRGRR   W + +GNL A+LL    
Sbjct: 12  VIVLDEIDSTNAEARRRAEAGEAGPFWLVGLRQTAGRGRRGRPWETGEGNLAATLLFRTD 71

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                   +SF  A+A+  ++A  +P    V +KWPND L+   K++GILIE+     G 
Sbjct: 72  KPPGEAAQVSFVAALAVADMLARYVPASL-VSLKWPNDPLLGGLKVSGILIESGASPLGG 130

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGG--CIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             + VGIG+N++  P+D+  P TS+            +   +L +   R   +W      
Sbjct: 131 LWLAVGIGVNLRRKPIDSERPGTSIATYSETLPPSPTEAIEVLAEAFERWFGVWSTLG-F 189

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I + W   A G+G+    +L   ++ G   G+D  G L L    G +R+I  GD+F
Sbjct: 190 PAIADAWTALAHGLGEPCVARLGTETVEGIAEGLDADGALRLRLPDGHLRRITAGDVF 247


>gi|121535058|ref|ZP_01666875.1| biotin--acetyl-CoA-carboxylase ligase [Thermosinus carboxydivorans
           Nor1]
 gi|121306308|gb|EAX47233.1| biotin--acetyl-CoA-carboxylase ligase [Thermosinus carboxydivorans
           Nor1]
          Length = 269

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 104/244 (42%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                +F  I STN+E  + A  G    L +VA  Q+ GRGR    W S     ++ S++
Sbjct: 24  GKEIRYFSEIGSTNNEAKRLAAEGCPEGLIVVAEAQSTGRGRLARGWFSPFGKGIWLSVV 83

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L            +   AVA+   I           IKWPNDIL   +K+ GIL E    
Sbjct: 84  LRPPFHPLDAPKCTLMAAVALTKAIRKVTE--APCGIKWPNDILYEGKKLVGILTEMSAE 141

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            + +  VV+G+G+NV   P + P  +  +           +    + + +  ++  V  L
Sbjct: 142 MDAINYVVIGMGINVNIAPEEFPPELRDIATSVAAAAGRPVSRLALLAEVLAELETVYSL 201

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                G   +++ WR     +G  + +     +  G  V +D+ G LL++  +G VR+I 
Sbjct: 202 -AVRQGFGPVLDEWRKLTITLGQQVNVLAPGETFAGIAVNIDNEGALLVDTGQG-VRRIL 259

Query: 247 TGDI 250
            GD+
Sbjct: 260 AGDV 263


>gi|294101054|ref|YP_003552912.1| biotin/acetyl-CoA-carboxylase ligase [Aminobacterium colombiense
           DSM 12261]
 gi|293616034|gb|ADE56188.1| biotin/acetyl-CoA-carboxylase ligase [Aminobacterium colombiense
           DSM 12261]
          Length = 323

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 104/242 (42%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLL 71
                 F  + STN E  K A  G      IVA  QTAGRGR    W  S +  +  SL+
Sbjct: 79  GHPIIHFREVPSTNIEARKYAREGTAEGTVIVAEHQTAGRGRSGRSWFSSPEWAIQMSLI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +S      ++   A A+   + S    G   +IKWPND+L+ ++K+ GIL E    
Sbjct: 139 LRPKVSPALAASITQIGAAAVAKALESL---GLSPQIKWPNDVLLSEKKVCGILTEMSCE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLWK 188
            + +  +V+GIG+NV            +           + K + + +      +   + 
Sbjct: 196 LDHINHIVIGIGINVNTPHFPDDVASVATSVRIEKGETWNRKKLMAAVLNSFEPLYKEFL 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +     E + + R  +  IG  IT + + G +  + + +D+ G L+++   G    + +G
Sbjct: 256 EGKEHPEYLRICRALSNLIGQHITYETTKGRLSAKAIDIDNIGRLIVQHSDGSTETLLSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|319405684|emb|CBI79307.1| birA bifunctional protein [Bartonella sp. AR 15-3]
          Length = 267

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 95/254 (37%), Positives = 133/254 (52%), Gaps = 4/254 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           MF  LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MFYVLSDFAQKQGYDIETYESVDSTNLVAQRKAYSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M   I   +         V +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIDQTAAQLSFVAGVSMLEAIKQFIKNEKQANNIVSLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L +   A+V+GIG+NV++   D PYP +S++  G  ID K++F  L
Sbjct: 121 KGAKSCGILLELFKLTSQKYALVIGIGMNVEYHYEDAPYPTSSIKNIGLSIDKKELFMAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            Q  A    LWK+  G + I   W      +G  I +      I G F G+D     +++
Sbjct: 181 TQCFAENYLLWKQPCGCDIIRKKWLLSCSHLGQPIKVISDERIIEGIFDGLDCDFNCIVK 240

Query: 237 EKKGCVRQIFTGDI 250
           +K G    I +GD+
Sbjct: 241 QKNGQQVIITSGDV 254


>gi|153853509|ref|ZP_01994889.1| hypothetical protein DORLON_00878 [Dorea longicatena DSM 13814]
 gi|149753664|gb|EDM63595.1| hypothetical protein DORLON_00878 [Dorea longicatena DSM 13814]
          Length = 326

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 102/242 (42%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++D I STN+   +   +G       VA  Q AG+GRR   W S    ++Y ++L
Sbjct: 78  GKNVVYYDEIDSTNNRAKEAGDNGAAHGTLFVADMQVAGKGRRGRVWKSPSGSSIYMTIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+  +A+A+   I        + KIKWPNDI+V  RKI GIL E    
Sbjct: 138 LYPDIPPVKAPQLTLLMAIAVAEGIQEVTG--LETKIKWPNDIVVNGRKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+G G+NV           T+   +   G  +   ++ + + +   +  +++ 
Sbjct: 196 IDYINHVVIGAGINVNQDTFPDDIKATASSLKLELGKSVKRSELIAAVMKSFEKCYEIFI 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      +  L+          + +           +G++  G L++    G  ++I+ G
Sbjct: 256 KTEDLSGLQELYNSMLVNRDQEVKVLEPGNEYKAHAIGINQTGELIVRTPDGKEKEIYAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|312136343|ref|YP_004003680.1| biotin/acetyl-CoA-carboxylase ligase [Methanothermus fervidus DSM
           2088]
 gi|311224062|gb|ADP76918.1| biotin/acetyl-CoA-carboxylase ligase [Methanothermus fervidus DSM
           2088]
          Length = 318

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 70/242 (28%), Positives = 114/242 (47%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +FD + STN    K A  G+     ++A  QT GRGR + +WIS KG ++ S++L
Sbjct: 73  GRNIYYFDIVDSTNLTAKKLAEKGEEEGTIVLAQVQTRGRGRENKEWISPKGGIWTSIIL 132

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I   +   ++   AVA+   +        DV IKWPND+L+  +K+ GIL E+ +  
Sbjct: 133 KPDIPAVNAPQITLMTAVAVAKTLKKLFK-NLDVGIKWPNDVLIGNKKVCGILTESYSRN 191

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-----DLKDIFSLLFQDVARVLDLW 187
             L+ V+VG+G+++       P  +                L D+      +  +V + +
Sbjct: 192 ESLEYVIVGVGIDINVDINSFPIELQEGATSIKEELGKEVPLVDVLCEFLYEFEKVYEKF 251

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           K     +EI+  WR  +  IG  + I+      I G  VGV   G L+LE   G +++IF
Sbjct: 252 K-AGKFQEILKEWRALSKTIGSYVEIRKKFGKRIRGEAVGVTKDGALILELDDGRLKKIF 310

Query: 247 TG 248
           +G
Sbjct: 311 SG 312


>gi|260439204|ref|ZP_05793020.1| biotin-[acetyl-CoA-carboxylase] ligase [Butyrivibrio crossotus DSM
           2876]
 gi|292808219|gb|EFF67424.1| biotin-[acetyl-CoA-carboxylase] ligase [Butyrivibrio crossotus DSM
           2876]
          Length = 326

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 104/243 (42%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASL 70
           +  +  +FD I STN E  ++A    +  +  +A  QT GRGR++  W S  K  ++ S 
Sbjct: 77  FGRKISYFDVIDSTNSEIKRQAEKEFIPGMLAIAEKQTLGRGRKERHWESPAKTGIWMSF 136

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
            +   +     ++++   A+A+   I        + +IKWPNDI++  RK+ GIL E   
Sbjct: 137 AVKPDLPPYKASMITLVTALAVAKAIKDVTG--LNTEIKWPNDIVIGSRKVVGILTEMSA 194

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG---CIDLKDIFSLLFQDVARVLDLW 187
               +  VV+GIG+NV            +          +    I +   +   +  +++
Sbjct: 195 EMTTINYVVIGIGINVNMESFPAELEDKATSLYIAGGTKVRRSSIVAKFGKYFEKYYEIF 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            KD     I + +          + I      I    +G+D  G LL+++  G + +I  
Sbjct: 255 CKDGNLSGIKDEYEKLLVNRNKEVYIIEGDSRIKRVAIGIDTDGELLVKDDNGNIEKIMA 314

Query: 248 GDI 250
           G++
Sbjct: 315 GEV 317


>gi|167758617|ref|ZP_02430744.1| hypothetical protein CLOSCI_00957 [Clostridium scindens ATCC 35704]
 gi|167663813|gb|EDS07943.1| hypothetical protein CLOSCI_00957 [Clostridium scindens ATCC 35704]
          Length = 327

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 98/243 (40%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++    STN    ++   G      ++A  Q AG+GRR   W S +  ++Y ++L
Sbjct: 78  GRHVVYYGETDSTNTRAKEQGERGAEHGTLVIADKQNAGKGRRGRSWESPQGTSIYMTIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL-VFQRKIAGILIETLN 130
           L   I       ++  +A+A    I        +  IKWPNDI+ +  +K+ GIL E   
Sbjct: 138 LRPGIMPVKAPQMTLLMAIAATQGIRRVTG--LEAGIKWPNDIVSLTGKKLCGILTEMSA 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLW 187
             + +  VV+GIG+NV            +       G  +    + + + +   +  D +
Sbjct: 196 EIDYINYVVIGIGVNVNQELFSQEIKERATSLCLELGHKVQRSQLIAAIMESFEKCYDKF 255

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +      +M  +       G  + +           +G+++ G L+++   G  + IF 
Sbjct: 256 METEDLSGLMEEYNSLLVNRGREVKVLEPGHEYEAFAMGINETGELIVKTADGQEKNIFA 315

Query: 248 GDI 250
           G++
Sbjct: 316 GEV 318


>gi|328954522|ref|YP_004371856.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobacca acetoxidans DSM
           11109]
 gi|328454846|gb|AEB10675.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobacca acetoxidans DSM
           11109]
          Length = 342

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 113/248 (45%), Gaps = 9/248 (3%)

Query: 9   QNPYSF---RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN 65
             P+ F       F  + STND     A  G+     IVA  Q+AGRGR    W S  G 
Sbjct: 85  NLPHRFLRGPVWHFMNLPSTNDMAKDLARQGNPEGSIIVAESQSAGRGRMGRIWESPPGG 144

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
            +Y SL+L   +    L  L+   AVA+   I     +  D  IKWPNDIL+  +K+ GI
Sbjct: 145 GIYLSLILRPPLPPAELPRLTLTAAVAVIQAIREVAGLAAD--IKWPNDILLQGKKLGGI 202

Query: 125 LIETLNLKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           L E     + +  V++G+GLNV     P       TSL   G       I   L   +  
Sbjct: 203 LTEMETESDQMSHVILGLGLNVNTTVFPEPVRRLATSLASAGKRYSRLAILRSLLAALDS 262

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           +   + ++     I++LWR  A  +G  +T++     I G  + VD  G LLL++  G +
Sbjct: 263 LYGRFLQEE-FPAILDLWRQSAVTLGQQVTVRQGKEIISGLALDVDSDGALLLQQPDGRI 321

Query: 243 RQIFTGDI 250
            ++ +G+I
Sbjct: 322 EKVISGEI 329


>gi|228920348|ref|ZP_04083694.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839270|gb|EEM84565.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 317

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|219851654|ref|YP_002466086.1| biotin/acetyl-CoA-carboxylase ligase [Methanosphaerula palustris
           E1-9c]
 gi|219545913|gb|ACL16363.1| biotin/acetyl-CoA-carboxylase ligase [Methanosphaerula palustris
           E1-9c]
          Length = 326

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 111/247 (44%), Gaps = 11/247 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL---GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
             + ++  T  STND     A  GD+       I+A  QT G GR    W+S +G ++ +
Sbjct: 81  GRQMQYLKTTPSTNDVARTLATEGDVAALHGTVIIAEEQTGGVGRLSRAWVSPQGGIWIT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L  +I  D + +++ A AVA+   I           IKWPND+ +  +K+AG+L+E  
Sbjct: 141 LILKPTIPIDHVFMITMAGAVAIARAIRK--EFDIGALIKWPNDVYIGDKKVAGLLLELA 198

Query: 130 NLKNGLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +   ++GIG++V        P       T  +     +D     + + ++  R  
Sbjct: 199 AESDSIHYCLLGIGIDVNIKLDTLSPELRSGVTTISEELEHEVDRAAFLARVLREFERHY 258

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            + +       I+  W+  +  +   + +     S  G  + +D++G L++ ++ G + +
Sbjct: 259 QVLESGEYD-AILREWKSMSYTLEQHVRVNTMRNSFEGEAIDIDEYGALIVRKENGKIER 317

Query: 245 IFTGDIF 251
           +  GD F
Sbjct: 318 VIAGDCF 324


>gi|315650363|ref|ZP_07903435.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium saburreum DSM
           3986]
 gi|315487474|gb|EFU77784.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium saburreum DSM
           3986]
          Length = 327

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/255 (21%), Positives = 111/255 (43%), Gaps = 12/255 (4%)

Query: 4   NLSECQNPYSFR----YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
            + +C + Y ++      +F+ I STN    K A      +  +VA+ QT G+GR    W
Sbjct: 68  EIEQCMHSYKYKTLPKVIYFNQIDSTNTYAKK-AADSITSDFLVVANTQTLGKGRLGRSW 126

Query: 60  ISD-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
            S    ++  SL +   +  +  ++++  +A ++   I           IKWPNDI+V  
Sbjct: 127 TSPGTTSISMSLCIRPDLPLEKASMITLVMAASLCDAIEELYST--KPLIKWPNDIVVNS 184

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSL 175
           +KI GIL E  +  +G++ ++ G+G+NV +         T+          +D   + + 
Sbjct: 185 KKICGILTEMSSDIDGIKYIISGVGINVNNDEFPADIANTASSLLIETGIVMDRARLIAS 244

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           +        D++ +      I   +      +G  + I    G      +G+D+ G LL+
Sbjct: 245 VIYHFYENFDIFLQTEDMTSIKAKYESHLANVGRKVRILDPKGEYNATALGIDETGALLV 304

Query: 236 EEKKGCVRQIFTGDI 250
               G +++I +G++
Sbjct: 305 -NADGKIKRIISGEV 318


>gi|220927593|ref|YP_002504502.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulolyticum
           H10]
 gi|219997921|gb|ACL74522.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulolyticum
           H10]
          Length = 326

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 106/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                +F+ I STN    K A  G      +++  QT GRGR   +W SD    ++ S++
Sbjct: 77  GSNIRYFEEIDSTNSYAKKIANEGCAHGTVVISEVQTMGRGRVGRQWQSDTAEGIWFSIV 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   +  +++ +++ A +VA+   I  T        IKWPNDI++  RK+ GIL E    
Sbjct: 137 VRPDLEPENIQVITLAASVAVVEAIKETCG--IICGIKWPNDIILNGRKLGGILTELSAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDL 186
              +  VVVGIGLN         Y +           G  I   ++   +     ++   
Sbjct: 195 PGHVNYVVVGIGLNANQDLEHFDYEIRQKAISLKMYAGKSISRANLLGSILTRFEKIYKS 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                 R +I++ W  ++  IG  + +        G+ + V   G L++E K G  R+I 
Sbjct: 255 ILLGENR-DIIDKWTAYSVTIGKEVKVAYKDMEYFGKALSVASDGRLIVECKDGVTREIS 313

Query: 247 TGDI 250
            G+I
Sbjct: 314 AGEI 317


>gi|291520864|emb|CBK79157.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Coprococcus
           catus GD/7]
          Length = 325

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 104/242 (42%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           +    + +  +STN      A  G      +VA  Q +GRGRR   W S K   ++ S+L
Sbjct: 78  ARPVVYEEEQASTNQTAKMLAEQGASHGTLVVAERQVSGRGRRGRPWHSPKGSGIWMSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I   S ++L+   A+A+   I+S         IKWPNDI++  RK+ GIL E  + 
Sbjct: 138 LRPQIHPMSASMLTLVAAMAVYDAISS---RVEGCAIKWPNDIVIDGRKVCGILTEMSSE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+GIG+NV              +     G      +I + +++   +  D + 
Sbjct: 195 LDNIHYVVIGIGINVNTDDFPVDIASVATSMHVITGAYYKRAEIIADIWKAFEKYYDFFV 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      +++ +      +   + I+       G   G+D  G LL+E   G    + +G
Sbjct: 255 QTENLVLMVDTYNQRLVNMDRRVMIEERGHRYEGTARGIDAEGGLLVERDDGTTTSVISG 314

Query: 249 DI 250
           ++
Sbjct: 315 EV 316


>gi|290969237|ref|ZP_06560762.1| biotin-(acetyl-CoA-carboxylase) ligase [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290780743|gb|EFD93346.1| biotin-(acetyl-CoA-carboxylase) ligase [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 328

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 114/243 (46%), Gaps = 7/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +  ++ + + I STN    K A SG      ++A  Q  GRGR D  ++S     L+ SL
Sbjct: 78  FGKQFIYLEKIDSTNTYAKKIADSGAPEGTVVLAEEQRGGRGRLDRSFLSPFAQGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  S S   ++ L+   AVA+   +       T+  IKWPNDILV  +K+ GIL E   
Sbjct: 138 ILRPSFSPMEVSKLTLMAAVAVTKALHR--CGLTECGIKWPNDILVHDKKVVGILTELHA 195

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK- 189
               +  VV+GIG+NV       P  +  +       +++ + + + + V   L+ +   
Sbjct: 196 SAEKINYVVMGIGINVSLTKKMLPRELKRIVTSFAMENVEALRADILKTVLEELEHYYIS 255

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             + G   I+  W+  +C +   + +        G+ VG+D+ G LL+E  KG  R +  
Sbjct: 256 VSENGFAPIIEEWKVLSCMMNREVEVSAIDRIFKGKAVGLDEDGNLLVETNKGTER-VLA 314

Query: 248 GDI 250
           GD+
Sbjct: 315 GDV 317


>gi|166030710|ref|ZP_02233539.1| hypothetical protein DORFOR_00384 [Dorea formicigenerans ATCC
           27755]
 gi|166029502|gb|EDR48259.1| hypothetical protein DORFOR_00384 [Dorea formicigenerans ATCC
           27755]
          Length = 326

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 102/242 (42%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                +FD I STN+   +            VA  Q AG+GRR   W S KG ++Y ++L
Sbjct: 78  GKNIVYFDEIDSTNNRAKELGEKDGAHGTLFVADRQVAGKGRRGRVWESPKGISIYMTIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +      +L+  +A ++   I     +  +  IKWPNDI++ ++K+ GIL E    
Sbjct: 138 LRPDLIPTKAPMLTLVMAQSVAEGIREVTGM--ETGIKWPNDIVMNKKKVCGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+G+G+NV     D      +          +    + + + +   +   L+ 
Sbjct: 196 IDYINYVVIGVGINVNQKVFDEELKEKATSLMIETGAPVKRSALIAAVMKHFEKNYALFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++     +   +       G  + I            G+++ G L++  +KG  + IF G
Sbjct: 256 ENGDLSGLQESYNEMLVNRGKEVRILEPGNEYNAHAYGINETGELIVRTQKGEEKHIFAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|197121885|ref|YP_002133836.1| biotin/acetyl-CoA-carboxylase ligase [Anaeromyxobacter sp. K]
 gi|196171734|gb|ACG72707.1| biotin/acetyl-CoA-carboxylase ligase [Anaeromyxobacter sp. K]
          Length = 330

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 106/240 (44%), Gaps = 9/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLID 74
              ++ ++STND   + A  G      ++A  QTAGRGRR   WIS  + NLY S +L  
Sbjct: 89  LHAYEELASTNDRARELAEEGAAHGEVVIAERQTAGRGRRGRAWISPARKNLYFSAILRP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +       ++   ++A+  V+      G D  IKWPND+L   RKIAGIL E     + 
Sbjct: 149 DLPTARAPEVTLVASLAVCDVLRQA---GVDAGIKWPNDVLAGGRKIAGILTELAAEPDR 205

Query: 135 LQAV----VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +     V +    +  P D     TS+  E G    + +F+              ++
Sbjct: 206 VHWIVVGVGVNVNARAEDFPDDLRGEATSVLLERGEPAPRALFAAACLTALEGWLDVHEE 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I   WR  +  +G  + +++  G + G    +D+ G LL+    G + ++  GD+
Sbjct: 266 QGFGPIREAWRERSVTLGREVRVRVDDGELAGTAEDIDEAGALLVRTASG-LERVLAGDV 324


>gi|253577528|ref|ZP_04854841.1| biotin-acetyl-CoA-carboxylase ligase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843068|gb|EES71103.1| biotin-acetyl-CoA-carboxylase ligase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 327

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 112/247 (45%), Gaps = 10/247 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
            +  R +  D+ SST +E  K A  G      ++A  QTAGRGR+  +W S     ++ S
Sbjct: 80  TFGQRLKLLDSTSSTQEEVRKLAEEGAPHGTLVLAEEQTAGRGRQGRRWYSPPGKGVWMS 139

Query: 70  LLLIDSISK-DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           LLL            L+   AVA+   I        D  IKWPNDIL   RK+ GI++E+
Sbjct: 140 LLLRPDRQPLSIAPQLTLLTAVAVCRAIRKVTG--VDAGIKWPNDILARGRKLCGIIVES 197

Query: 129 LNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
                 ++  V GIG++V        P       +     G  ID   +   + +++ ++
Sbjct: 198 AAEDELIRYAVAGIGIDVNLTAADIPPELETIATSLCIESGRRIDRTSLIGAVIKELEQL 257

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +L+ ++     I +LW   +  +G  IT+    G + G   G+D  G L L ++ G   
Sbjct: 258 YELYIQEG-FAPIGHLWEALSVTLGREITVHTPNGVLQGTATGLDSSGALFLLDQNGKHF 316

Query: 244 QIFTGDI 250
            IF+G++
Sbjct: 317 TIFSGEV 323


>gi|118444008|ref|YP_877003.1| birA bifunctional protein [Clostridium novyi NT]
 gi|118134464|gb|ABK61508.1| birA bifunctional protein, putative [Clostridium novyi NT]
          Length = 328

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 113/244 (46%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                +++TI STN +  +   +G      +++  QT GRGR   +W+S K N ++ S++
Sbjct: 79  GKDIRYYNTIDSTNTKAKELGTAGAKEGTVVISEEQTGGRGRLGRQWVSPKFNGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I     + ++   A A+   I      G    IKWPNDI++  +K+ GIL E    
Sbjct: 139 LKPDIEPMDASKITQIGAAAVCMSINEL---GLKATIKWPNDIVLNGKKVCGILTEMSGE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            N +  +++GIG+NV     D P  +  +              K++ + +F +   + D 
Sbjct: 196 LNKINYIIMGIGINVNIEDEDFPGDIKDIATSIKIESGKKVKRKELVASIFNNFESLYDE 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +      +  +N+ R  +  IG+ I I      +  + +G+ + G L++E   G V +I 
Sbjct: 256 FINSETIKRSINICRENSALIGNDIKIIKRNEEVFAKAIGLTEDGELIVEYNDGKVDKIV 315

Query: 247 TGDI 250
           +G++
Sbjct: 316 SGEV 319


>gi|217959118|ref|YP_002337666.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH187]
 gi|222095267|ref|YP_002529327.1| bira bifunctional protein [Bacillus cereus Q1]
 gi|217062936|gb|ACJ77186.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH187]
 gi|221239325|gb|ACM12035.1| bira bifunctional protein [Bacillus cereus Q1]
          Length = 326

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I        +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVQHAPQLTLLAAVSVAQAIEKFTG--VNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|313901917|ref|ZP_07835335.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467812|gb|EFR63308.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 352

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 112/242 (46%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +   + STND   + A +G      +VA  Q AGRGR    W S  G L+ SL+L
Sbjct: 98  GHTVHWLAEVGSTNDVARRLAEAGAPEGTVVVADRQAAGRGRLRRAWWSPPGGLWMSLIL 157

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             ++  + L LL+ A A A+             V  KWPND+L+  RK+AGIL+ET++  
Sbjct: 158 RPALPPEHLPLLTLAAAAAVAEAAEGLAGRPVQV--KWPNDVLIDDRKVAGILLETVSHP 215

Query: 133 NGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           +G + VV GIG+N+       P +    +T L RE G    ++  +              
Sbjct: 216 HGAEYVVAGIGVNLDVEGEPVPAELAGRLTWLAREAGRRVTRNELAEAILQRLEERYAQL 275

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   ++  WR  A  +G+ + + L  G + G  + V   G L++E+  G  ++I  G
Sbjct: 276 HQEGPGPVLAAWRSRAAWLGEPVRVALPTGEVAGIALDVAPDGSLVVEQAGGRRQRILAG 335

Query: 249 DI 250
           D+
Sbjct: 336 DV 337


>gi|115373043|ref|ZP_01460346.1| biotin-[acetyl-CoA-carboxylase] ligase [Stigmatella aurantiaca
           DW4/3-1]
 gi|310821849|ref|YP_003954207.1| bira bifunctional protein [Stigmatella aurantiaca DW4/3-1]
 gi|115369955|gb|EAU68887.1| biotin-[acetyl-CoA-carboxylase] ligase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309394921|gb|ADO72380.1| BirA bifunctional protein [Stigmatella aurantiaca DW4/3-1]
          Length = 336

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 102/243 (41%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                   T++STN+   + A  G      +VA  QTAG+GRR   W+S  G NLY S +
Sbjct: 86  GRTLHCHGTLASTNELAFRLAHEGAEHGEVVVAEQQTAGKGRRGRVWVSPPGLNLYFSAI 145

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   AVA+   +      G +  IKWPND+ +  RK+AGIL E    
Sbjct: 146 LRPELPPQHAPELTLVAAVALAETLREA---GAEAAIKWPNDVQIDGRKVAGILTEMSAE 202

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
              +  VV+GIG+N+       P  + +        +      +     +   L+ W   
Sbjct: 203 PERVHFVVLGIGVNLNAQREHFPEELRAQATSLSLELGRPVPRASFAAALWLRLEEWLAR 262

Query: 191 TG---REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
                   +   W+  +C +G  + ++ +     G    VD+ G LL+    G + ++  
Sbjct: 263 HQEVGFGPVRRRWKELSCTLGQDVLVRTARLEFRGMAEDVDESGALLVRTPSGSIERVLA 322

Query: 248 GDI 250
           GD+
Sbjct: 323 GDV 325


>gi|325958520|ref|YP_004289986.1| biotin/acetyl-CoA-carboxylase ligase [Methanobacterium sp. AL-21]
 gi|325329952|gb|ADZ09014.1| biotin/acetyl-CoA-carboxylase ligase [Methanobacterium sp. AL-21]
          Length = 323

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 112/242 (46%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +F+ + STN+     A  G      +VA  Q  G+GRR   WIS  G ++ S++L
Sbjct: 79  GHDIHYFNEVDSTNEVAKYLAEEGAEDGTVVVAEIQNKGKGRRGKTWISPPGGIWMSVIL 138

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I     + L+    V +   I     +  DV IKWPNDIL+ ++K+ GIL E     
Sbjct: 139 RPEIPPHRASQLTLVTGVVVAKTIKE--ELNIDVGIKWPNDILIGKKKVCGILTEVNATL 196

Query: 133 NGLQAVVVGIGLNVKHC-PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW---K 188
           + +  +VVGIG+++    P+               ++ +   +LL Q   +  +      
Sbjct: 197 DKVNYLVVGIGIDMNVDVPMLPSDLQKGATSLKNELNTEINGALLVQRFLQNFENIYNDF 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           KD    EI++ WR  +  IG  + ++     + G  VG++  G L++E + G +R++ +G
Sbjct: 257 KDGKFPEILDEWRAMSSTIGTSVEVRTRGKRVQGYAVGINKEGILIIEMEDGSLRKMISG 316

Query: 249 DI 250
           + 
Sbjct: 317 EC 318


>gi|332981873|ref|YP_004463314.1| biotin/acetyl-CoA-carboxylase ligase [Mahella australiensis 50-1
           BON]
 gi|332699551|gb|AEE96492.1| biotin/acetyl-CoA-carboxylase ligase [Mahella australiensis 50-1
           BON]
          Length = 330

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 111/244 (45%), Gaps = 8/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                 F +I STND+  + A +G    L +VA  QT GRGR   +W+S     ++ S++
Sbjct: 80  GREIVHFLSIGSTNDKAKELANNGCREGLIVVAEEQTGGRGRLGRQWVSPQYRGIWMSVV 139

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   A+A+ + I      G  V IKWPND++V  +KI GIL E    
Sbjct: 140 LRPDIQPMEAQKLTLLSALAVSNAIEE--CTGLKVDIKWPNDLVVSGKKICGILTEMSAE 197

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-----GGCIDLKDIFSLLFQDVARVLDL 186
            + +  VV+GIG+N      D P  +           G  +D K++F  + +++  +   
Sbjct: 198 VDKVNHVVIGIGINANMSAEDIPDELKDKATSLAIELGYNVDRKNLFRYISRNIDELYTC 257

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +       ++M  +R     +G    I     S  G    +DD G L++ +  G  ++I 
Sbjct: 258 FINANQWHDLMVEYREKCINVGRRAVISKGDVSWEGMVTDIDDDGALIVLDGHGEKKRII 317

Query: 247 TGDI 250
           +GD+
Sbjct: 318 SGDV 321


>gi|223937560|ref|ZP_03629463.1| biotin/acetyl-CoA-carboxylase ligase [bacterium Ellin514]
 gi|223893723|gb|EEF60181.1| biotin/acetyl-CoA-carboxylase ligase [bacterium Ellin514]
          Length = 325

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                 F+  +STND   + A  G    + + A  QT GRGR    W+S  +  L+ S+L
Sbjct: 81  GRDIRVFEETTSTNDVVERLARDGVKEGVVVFAESQTKGRGRLGRIWMSPARQGLWFSIL 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +   S+T L+ A A A+   I S    G   +IKWPNDIL+  +K+AGIL E    
Sbjct: 141 LRPQLRPTSVTQLTIAAATALFRAIRS--QTGVRPEIKWPNDILIDGKKVAGILTELSAE 198

Query: 132 KNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + ++ +++G+G++V        P       +     G  I+  ++   + Q++ R  + 
Sbjct: 199 LDKVKYIILGVGVDVNLSAADFPPELRKIATSLKVESGQRINRAELAVRILQEMDRDYER 258

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  E +   W      IG  +TI +    I G    +D  G LL+  + G + +I 
Sbjct: 259 -VCSGQFESVAGEWAEHCSTIGRNVTIHVGDRKIQGCAESLDTDGALLVRTQHGHLERII 317

Query: 247 TGDI 250
            GD+
Sbjct: 318 GGDV 321


>gi|229138331|ref|ZP_04266925.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST26]
 gi|228645096|gb|EEL01334.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST26]
          Length = 317

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I        +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVQHAPQLTLLAAVSVAQAIEKFTG--VNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|212638966|ref|YP_002315486.1| biotin operon repressor containing HTH and biotin-(acetyl-CoA
           carboxylase) ligase domains [Anoxybacillus flavithermus
           WK1]
 gi|212560446|gb|ACJ33501.1| Biotin operon repressor containing HTH and biotin-(acetyl-CoA
           carboxylase) ligase domains [Anoxybacillus flavithermus
           WK1]
          Length = 329

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 111/243 (45%), Gaps = 7/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           + +     +++ ST     + A  G      ++A  QTAGRGR +  W S K   ++ S+
Sbjct: 85  FGWSVYDQESVPSTQQLAHQLAHEGAEEGTVVIAEEQTAGRGRLNRSWHSPKGTGIWMSI 144

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  SI       L+  +AVA+   I     +  D  IKWPNDIL+  +K+ GIL E   
Sbjct: 145 ILRPSIPLQQAPQLTLLVAVAVAETIQEITNIVPD--IKWPNDILINGKKVVGILTELQA 202

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLW 187
             + ++AV+VGIG+NV            +       G       I   L Q + ++ + +
Sbjct: 203 DPDQVRAVIVGIGMNVNQKQFPNDIAPIATSLAIETGRTFHRPKIVQTLLQKLEQLYEQY 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +       + LW  ++  IG  I  +   G+I G  +G+ D G L ++ + G +  I++
Sbjct: 263 LQHGFLPIKL-LWEGYSVTIGQQIVARTLNGAIRGVALGITDSGTLKVQTEDGAIHYIYS 321

Query: 248 GDI 250
            DI
Sbjct: 322 ADI 324


>gi|220916677|ref|YP_002491981.1| biotin/acetyl-CoA-carboxylase ligase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954531|gb|ACL64915.1| biotin/acetyl-CoA-carboxylase ligase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 330

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 105/240 (43%), Gaps = 9/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLID 74
               + ++STND   + A  G      ++A  QTAGRGRR   WIS  + NLY S +L  
Sbjct: 89  LHAHEELASTNDRARELAEEGAAHGEVVIAERQTAGRGRRGRAWISPARKNLYFSAILRP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +       ++   ++A+  V+      G D  IKWPND+L   RKIAGIL E     + 
Sbjct: 149 DLPTARAPEVTLVASLAVCDVLRQA---GVDAGIKWPNDVLAGGRKIAGILTELAAEPDR 205

Query: 135 LQAV----VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +     V +    +  P D     TS+  E G    + +F+              ++
Sbjct: 206 VHWIVVGVGVNVNARAEDFPDDLRGEATSVLLERGEPAPRALFAAACLTALEGWLDVHEE 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I   WR  +  +G  + +++  G + G    +DD G LL+    G + ++  GD+
Sbjct: 266 QGFGPIREAWRERSVTLGREVRVRVDDGELAGTAEDIDDAGALLVRTASG-LERVLAGDV 324


>gi|227824809|ref|ZP_03989641.1| biotin-(acetyl-CoA carboxylase) ligase [Acidaminococcus sp. D21]
 gi|226905308|gb|EEH91226.1| biotin-(acetyl-CoA carboxylase) ligase [Acidaminococcus sp. D21]
          Length = 331

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + D I STND   K AL G       VA  Q+ G+GR    W S     L+ SLL
Sbjct: 79  GRNMAYEDVIPSTNDLLKKMALQGAPDGTVCVAEEQSVGKGRLARGWFSPYGKGLWFSLL 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +        ++   AVA+   +          +IKWPNDIL+  RK+ GIL E    
Sbjct: 139 LKPTFLPQEAPKMTLLAAVAVVRAVRELCG--VKAEIKWPNDILLEGRKLVGILTEMSAE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-----VTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
              +  +VVGIG+NV       P       V+         D   + + +   +    + 
Sbjct: 197 FGHINYLVVGIGINVCVPQSMVPEALRESAVSIDDVAEKPTDRVALLAKVLDHLETCYET 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             K+     I++ WR ++  +G ++ +     +  G+   +D+ G LL+  + G V ++ 
Sbjct: 257 VLKEG-FGPILDEWRRYSVTLGRMVKVIAPDTTYTGKAEDIDEEGALLVRRENGHVERVL 315

Query: 247 TGDI 250
            GD+
Sbjct: 316 AGDV 319


>gi|229160587|ref|ZP_04288582.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           R309803]
 gi|228622997|gb|EEK79828.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           R309803]
          Length = 317

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     + A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEETVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CAGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|299538591|ref|ZP_07051874.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus fusiformis ZC1]
 gi|298726178|gb|EFI66770.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus fusiformis ZC1]
          Length = 327

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 99/245 (40%), Gaps = 6/245 (2%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
            +     ++D + ST     K A  G      I+   QTAGRGR    W S     ++ +
Sbjct: 81  HFGREIHYYDVVDSTQTIAHKLAQEGAPHGTIIIGEKQTAGRGRMARPWESAHGTGIWMT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +++   ++    +  +  +AVA+   I +      +  IKWPND+L+  +K  GIL E  
Sbjct: 141 VIVRPDVTPQQASSYTLVVAVAVTMAIKTLYKH-VEPAIKWPNDLLINGKKCTGILTEMQ 199

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR----EGGCIDLKDIFSLLFQDVARVLD 185
              + +QA++VGIG+N      D    +  +      E G    +               
Sbjct: 200 AEADLVQALLVGIGINANQAVADFSPDIADIATSLRLEAGEEINRAALVASILHYLEQFT 259

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G   +  LW+  +C IG  I +        G   G+ D G L L +  G VR I
Sbjct: 260 ELYVKEGFASLKTLWQQLSCTIGQRIEVTTIRERFEGVASGITDDGVLQLTQDDGTVRTI 319

Query: 246 FTGDI 250
           + GDI
Sbjct: 320 YAGDI 324


>gi|196039082|ref|ZP_03106389.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus NVH0597-99]
 gi|300117436|ref|ZP_07055226.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus SJ1]
 gi|196030227|gb|EDX68827.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus NVH0597-99]
 gi|298725271|gb|EFI65923.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus SJ1]
          Length = 326

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|225156046|ref|ZP_03724529.1| Biotin--(acetyl-CoA-carboxylase) ligase [Opitutaceae bacterium
           TAV2]
 gi|224803279|gb|EEG21519.1| Biotin--(acetyl-CoA-carboxylase) ligase [Opitutaceae bacterium
           TAV2]
          Length = 357

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 102/248 (41%), Gaps = 12/248 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
                D + STNDE  +R  +G+   L ++A  QT GRGR    W S   GNLY S    
Sbjct: 99  SLHLLDEVDSTNDEAARRLTAGEAAPLVVMARRQTKGRGRFGRVWHSGVAGNLYCSFGFR 158

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGT------DVKIKWPNDILVFQRKIAGILIE 127
             +    +   S  + V +   +A    +         + IKWPND+L+  RK  GIL E
Sbjct: 159 PRVEPARMQPFSLWMGVNICEFVADFCRIAPGPAGAAKIGIKWPNDLLLDGRKAGGILTE 218

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-----DLKDIFSLLFQDVAR 182
                + ++ +V+G+GLN++  P   P  + +             ++      L   V  
Sbjct: 219 ARMDADQIRDLVLGLGLNLQPPPEGWPPEIAARAVSISEHANVPVEINRFALALVARVLE 278

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
             + +  D  R+   +LW       G  + +        G  +GVDD G LL+    G +
Sbjct: 279 AYEQFVADAHRDTFADLWNKHDLLRGRPVAVLQGDTRTPGTAMGVDDEGCLLVRTPMGGI 338

Query: 243 RQIFTGDI 250
            +   G++
Sbjct: 339 ERFRAGEV 346


>gi|225181450|ref|ZP_03734893.1| biotin/acetyl-CoA-carboxylase ligase [Dethiobacter alkaliphilus AHT
           1]
 gi|225167848|gb|EEG76656.1| biotin/acetyl-CoA-carboxylase ligase [Dethiobacter alkaliphilus AHT
           1]
          Length = 325

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/243 (23%), Positives = 108/243 (44%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +   +  + STN    + A +G+     ++A  Q+AGRGR    W S  G ++ SL+L
Sbjct: 79  GKKVYHYREVDSTNRAARELARAGEAEGTVVLAEAQSAGRGRLGRAWNSPCGGIWLSLIL 138

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +      LL+   AVA     A+         IKWPND+++  +K+AGIL E     
Sbjct: 139 RPKLPPYKAQLLTLMAAVAATE--ATAAVSAVTPGIKWPNDLMINGKKLAGILTEVSAEM 196

Query: 133 NGLQAVVVGIGLNVKHCPVDT-----PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             L  +V+G+G+N                 + + + G  +          +++ +     
Sbjct: 197 EQLNYIVLGLGINANIPADWFAGELEQIATSIMAQSGEAVSRVAWVQAFLRNMEQEYMQA 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           ++    E+++  WR ++  +G  + ++L+     G  V +D+ G LL+  + G V+  + 
Sbjct: 257 EQIG-FEDVLKRWRRYSVTLGKGVDVQLADHRESGTAVDIDEQGALLVRTESG-VKTFWA 314

Query: 248 GDI 250
           GD+
Sbjct: 315 GDV 317


>gi|291534005|emb|CBL07118.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Megamonas
           hypermegale ART12/1]
          Length = 326

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                +F+T+ STN +  K AL G      I++  Q  GRGR    + S K   ++ S++
Sbjct: 79  GSEILYFETVDSTNTQAKKVALQGVKDGTIIISEEQGGGRGRLSRSFFSPKYKGIWFSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L            +   A A+   I         V IKWPND+L   +K+ GIL E    
Sbjct: 139 LKPKFLPQEAPKCTLMAATAITKAIEDVTG--VKVGIKWPNDVLYEGKKLVGILTEMNAE 196

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  +++G+G+NV       P +     TSL +  G    +             L + 
Sbjct: 197 MDCINYIIIGMGINVNIDKKEMPEEIQNIATSLSQITGKKISRLKLLNKILYYLEHLYII 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            ++ G   I++ WR ++  +   I +  +   + G  V +DD G LL+    G + ++  
Sbjct: 257 CQEEGFAPILDEWRKYSITLNQHIRVIGTNEVLEGIAVDIDDDGALLV-NIDGQITRVLA 315

Query: 248 GDI 250
           GD+
Sbjct: 316 GDV 318


>gi|296502206|ref|YP_003663906.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis BMB171]
 gi|296323258|gb|ADH06186.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis BMB171]
          Length = 286

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++      + LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 221 YLQNGFSIIKI-LWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|206974884|ref|ZP_03235799.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus H3081.97]
 gi|206746903|gb|EDZ58295.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus H3081.97]
          Length = 326

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I +      +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVQHAPQLTLLAAVSVAQAIENFTG--VNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|206970585|ref|ZP_03231537.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH1134]
 gi|206734221|gb|EDZ51391.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH1134]
          Length = 326

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|126654220|ref|ZP_01726016.1| transcriptional repressor of the biotin operon [Bacillus sp.
           B14905]
 gi|126589302|gb|EAZ83458.1| transcriptional repressor of the biotin operon [Bacillus sp.
           B14905]
          Length = 327

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 109/246 (44%), Gaps = 8/246 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
            +     +FD + ST     K A  G      I+   QTAGRGR    W S     ++ +
Sbjct: 81  HFGREIHYFDVVDSTQTIAHKLAQEGAPHGTVIIGEEQTAGRGRMARPWESVHGSGIWMT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +++   ++    +  +  +AVA+   I +      +  IKWPND+L+  +K  GIL E  
Sbjct: 141 VIVRPDVTPQQASSFTLVVAVAVTMAIKTLYS-DIEPTIKWPNDLLINGKKCTGILTEMQ 199

Query: 130 NLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +QA++VGIG+NV        P       +     G  I+   + +L+ Q + +  
Sbjct: 200 AEADLVQALLVGIGINVNQEAADFSPDIADIATSLRLEAGEEINRAALVALILQYLEQFT 259

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +L+ ++     I  LW   +C IG  I +        G   G+ D G L L +  G VR 
Sbjct: 260 ELYIEEG-FASIKTLWEQLSCTIGQRIEVTTIRERFEGIASGITDDGVLQLTQDDGLVRT 318

Query: 245 IFTGDI 250
           I+ GDI
Sbjct: 319 IYAGDI 324


>gi|218233846|ref|YP_002366318.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus B4264]
 gi|218161803|gb|ACK61795.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus B4264]
          Length = 326

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|149183106|ref|ZP_01861557.1| BirA [Bacillus sp. SG-1]
 gi|148849183|gb|EDL63382.1| BirA [Bacillus sp. SG-1]
          Length = 317

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 108/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               ++ +++ ST       A  G      ++A  QT GRGR    W S K   ++ S++
Sbjct: 74  GRVIKYIESVPSTQKIAHALAQEGAEEGTTVIADEQTEGRGRLLRSWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +        +   AVA+   I          +IKWPNDIL+  RK+ GIL E    
Sbjct: 134 LKPQLPPQRAPQFTLIAAVAVVQAIEEVCG--LSPEIKWPNDILLNGRKLTGILTELQAE 191

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + + ++++GIG+NV       P +     TSL  E      +        +   +    
Sbjct: 192 ADKINSIIIGIGMNVNQKAEDFPEELQSVATSLFMEKQEKVSRVKLIQRVMEKLEIYYDL 251

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             + G   I  LW  +A  IG  IT +   GSI G+ +G+++ G L +E+ +G V ++++
Sbjct: 252 YMEKGFTPIKLLWESYAISIGRQITARTITGSIHGKALGINEDGVLRIEDAEGQVHEVYS 311

Query: 248 GDI 250
            DI
Sbjct: 312 ADI 314


>gi|319404245|emb|CBI77838.1| birA bifunctional protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 267

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 133/254 (52%), Gaps = 4/254 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MVYVLSDFAKKQGYDIESYESVDSTNLVAQQKAHSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M   +   +         + +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIHQTAAQLSFVAGVSMLEAVKQFIKNEKQANDIISLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L     A+V+GIG+NV++   D PYP +S++  G  ID + +F+ L
Sbjct: 121 KGAKSCGILLELFKLTPQKYALVIGIGMNVEYHYEDAPYPTSSIKNIGLNIDKEQLFTAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            Q  A    LWK+  G + I   W  +   +G  IT+      I G F G+D     +++
Sbjct: 181 TQYFAENYLLWKQPYGCDTIRKKWLLYCSHLGQHITVNSDERIIEGIFDGLDCDFNCIVK 240

Query: 237 EKKGCVRQIFTGDI 250
           +K G    I +GD+
Sbjct: 241 QKNGQRAIITSGDV 254


>gi|228952016|ref|ZP_04114111.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957912|ref|ZP_04119652.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|229043382|ref|ZP_04191099.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH676]
 gi|229069189|ref|ZP_04202480.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           F65185]
 gi|229078819|ref|ZP_04211372.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock4-2]
 gi|229109092|ref|ZP_04238692.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-15]
 gi|229144235|ref|ZP_04272649.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST24]
 gi|229149834|ref|ZP_04278062.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1550]
 gi|229189718|ref|ZP_04316732.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           10876]
 gi|228593767|gb|EEK51572.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           10876]
 gi|228633515|gb|EEK90116.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1550]
 gi|228639243|gb|EEK95659.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST24]
 gi|228674370|gb|EEL29614.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-15]
 gi|228704501|gb|EEL56934.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock4-2]
 gi|228713941|gb|EEL65825.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           F65185]
 gi|228725963|gb|EEL77203.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH676]
 gi|228801828|gb|EEM48705.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807548|gb|EEM54072.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 317

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|21227931|ref|NP_633853.1| biotin operon repressor [Methanosarcina mazei Go1]
 gi|20906352|gb|AAM31525.1| biotin--[acetyl-COA-carboxylase] synthetase [Methanosarcina mazei
           Go1]
          Length = 325

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 107/240 (44%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +  +F+ +SSTN    + A S +     ++A  Q  GRGR   +W+S  G ++ S++L
Sbjct: 82  GKKIHYFEEVSSTNSVAKEIAAS-EEEGALVIAEIQKGGRGRMGREWVSPHGGIWMSVIL 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I     + L+    +A+ +VI     +G D +IKWPND+ +  +K+ GIL E     
Sbjct: 141 KPGIPLRHASRLTLVAGLAVANVIR---DMGLDARIKWPNDVRINGKKVCGILTEAKAEV 197

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           + +  VV+GIG+NV       P       T+L+ E G    +  F   F        +  
Sbjct: 198 DRVDYVVLGIGINVNMDLKDIPESFRAGSTTLKVELGKHIRRVSFLQDFLFELEQQYISF 257

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      I+N W   +  IG  + +      I GR VGV   G L++ +      +I  G
Sbjct: 258 KTQPFSHILNDWLALSDTIGREVKVTTPSRIIEGRAVGVTPDGALIIRKADNTKEEIIAG 317


>gi|229195838|ref|ZP_04322597.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1293]
 gi|228587611|gb|EEK45670.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1293]
          Length = 317

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVQHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|326939254|gb|AEA15150.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 326

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G DV IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVDVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLKNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|260881531|ref|ZP_05404657.2| biotin-[acetyl-CoA-carboxylase] ligase [Mitsuokella multacida DSM
           20544]
 gi|260848702|gb|EEX68709.1| biotin-[acetyl-CoA-carboxylase] ligase [Mitsuokella multacida DSM
           20544]
          Length = 339

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 100/247 (40%), Gaps = 13/247 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F+ TI STN E  + A  G    L +VA  Q  GRGR +  + S     ++ S++
Sbjct: 90  GTEIRFYPTIDSTNLEAKRLAQQGAPDGLVVVAEEQGKGRGRLERSFFSPAGKGIWFSVI 149

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L            +   AVA+             V IKWPND+L   +K+ GIL E    
Sbjct: 150 LRPDFLPQDAPKCTLLSAVAVAKAAEDFGM---KVGIKWPNDVLAGGKKLVGILTEMSAE 206

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  V++G G+NV       P +      S     G    +  F     +    L   
Sbjct: 207 MERIHYVIIGTGINVNIKAEEFPEELRDKAASFSEIKGEKIPRAAFFRAVLEHMDALYDA 266

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKL----SYGSILGRFVGVDDFGYLLLEEKKGCVR 243
               G  E+ + WR ++  +G  + I        G+ +G+ V +D+ G LL++   G  R
Sbjct: 267 ILREGFAEVFSEWRRYSITLGQTVRIIDARGGGQGAFVGKAVDIDEDGALLVDTAAGR-R 325

Query: 244 QIFTGDI 250
           ++  GD+
Sbjct: 326 RVLAGDV 332


>gi|326202904|ref|ZP_08192771.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium papyrosolvens DSM
           2782]
 gi|325986981|gb|EGD47810.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium papyrosolvens DSM
           2782]
          Length = 326

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 107/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
               + FD I STN+   K A  G      +VA  QT GRGR   +W SD    ++ S++
Sbjct: 77  GADIQHFDEIDSTNNYAKKIANEGCAHGTVVVAEKQTTGRGRIGRQWQSDTSEGIWFSIV 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +  + L +++ A +VA+   I  TL       IKWPNDI++  +K+ GIL E    
Sbjct: 137 LRPEMKPEDLQVITLAASVAVVEAIEETLG--IVCGIKWPNDIIIDGKKLGGILTELSAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDL 186
              +  VVVGIG+N         Y +          +G  +   ++   +  +   V   
Sbjct: 195 PGHVNYVVVGIGINANQDLEHFDYEIRQKAISLKMCKGETVSRSNLLGSILTNFEEVYKG 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  +EI++ W  ++  IG  + I       +G    V   G L+++ K G  R+I 
Sbjct: 255 VL-LGKNKEIIDRWTKYSVTIGKEVKIAYRNMEYIGTAQSVASDGRLIVQCKDGVTREIS 313

Query: 247 TGDI 250
            G+I
Sbjct: 314 AGEI 317


>gi|228926667|ref|ZP_04089736.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228833043|gb|EEM78611.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 286

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+NV          +  +        G  I   ++   +F  + ++ + 
Sbjct: 161 PDKINAVIMGIGINVNQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 221 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|253700525|ref|YP_003021714.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M21]
 gi|251775375|gb|ACT17956.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M21]
          Length = 327

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 102/245 (41%), Gaps = 10/245 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                      STN    K A  G      ++A  Q+AG+GR    W+S  G NLY S++
Sbjct: 83  GSSVICLKETDSTNSVAFKMAEEGAPEGTVVIADTQSAGKGRLGRIWLSPPGVNLYCSVV 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I   +   L+F   VA+   +          +IKWPNDIL+  +K+AG+L E    
Sbjct: 143 LRPAIPPVAACQLTFLSVVAVARAVER--CTKLKPQIKWPNDILINGKKVAGLLNEMNAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL------QREGGCIDLKDIFSLLFQDVARVLD 185
              +  VV+GIG+N+          +         +  G  +D      +L +++ ++ D
Sbjct: 201 TEKVNFVVLGIGVNLNLRMSTMNEGLLRHPATSLLEEGGEEVDRLSFTRVLLEELDQLYD 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +  +     +   W   +   G  + +        G   GVD FG LL+    G +  +
Sbjct: 261 NFLVEG-DGPVRAEWLARSAIKGRSVRVSQQNREFRGVVQGVDSFGALLVLLSDGTLETV 319

Query: 246 FTGDI 250
            +GD+
Sbjct: 320 LSGDV 324


>gi|239827471|ref|YP_002950095.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. WCH70]
 gi|239807764|gb|ACS24829.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. WCH70]
          Length = 329

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 74/245 (30%), Positives = 110/245 (44%), Gaps = 7/245 (2%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
            +     F + ++ST    ++ A  G      ++A  QTAGRGR D KW S K   ++ S
Sbjct: 85  TFGRYIHFEEEVTSTQKIALRLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMS 144

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L   I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E  
Sbjct: 145 LILRPPIPPQKAPQLTLLTAVAIAQAIQEKANIVPD--IKWPNDILINGKKCVGILTELQ 202

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
              + + +V++G+G+NV       P +     TSL  E G    +             L 
Sbjct: 203 ADPDRIHSVIIGMGINVNQTLDQFPEEIRTIATSLAIEKGERIQRAQLVQEILLRLERLY 262

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G   I  LW  +A  IG  IT +   G+I G  +G+ D G L+LE+++  +  I
Sbjct: 263 QQYLQYGFRPIKLLWEGYATSIGKEITARTLNGTIKGIALGITDEGVLMLEDEEKHIHYI 322

Query: 246 FTGDI 250
            + DI
Sbjct: 323 HSADI 327


>gi|228914212|ref|ZP_04077828.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228932925|ref|ZP_04095790.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945236|ref|ZP_04107592.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228984716|ref|ZP_04144888.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228774914|gb|EEM23308.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228814471|gb|EEM60736.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826728|gb|EEM72497.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228845416|gb|EEM90451.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 286

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 221 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|164686640|ref|ZP_02210668.1| hypothetical protein CLOBAR_00233 [Clostridium bartlettii DSM
           16795]
 gi|164604369|gb|EDQ97834.1| hypothetical protein CLOBAR_00233 [Clostridium bartlettii DSM
           16795]
          Length = 327

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 116/241 (48%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +    DT+ STND   +   +   G   I++  QT G+GR    W S     ++ SL+
Sbjct: 82  GKKVIHLDTVGSTNDYAKE-IGNKVSGGTLIISEQQTKGKGRLGRVWKSKSGDGIWMSLI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   I       L+     ++   +++    G +  IKWPNDI+V  +KI GIL E    
Sbjct: 141 IKPKIEPYKAPFLTLVAGASVVKALSNL---GVEASIKWPNDIIVHNKKICGILTELSAE 197

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
              +  VV+GIG+N+K    P +     TSL +EG  +   DI      +  ++   +  
Sbjct: 198 MERVNYVVIGIGINIKTIDFPDEIKEKATSLYKEGYKLSRVDIVRQFCIEFEKLYKGYIL 257

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D  +++ + L R ++  IG  + +  +    L + + +++ G L+++EK G +++I +G+
Sbjct: 258 DGNKQDTLELCRKYSAIIGKQVYVIKNNKRELVKCIDINENGNLIVKEKNGEIQEIMSGE 317

Query: 250 I 250
           +
Sbjct: 318 V 318


>gi|86158810|ref|YP_465595.1| biotin--acetyl-CoA-carboxylase ligase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775321|gb|ABC82158.1| Biotin--acetyl-CoA-carboxylase ligase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 330

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLLLID 74
               + ++STND   + A  G +    ++A  QTAGRGRR   WI   + NLY S++L  
Sbjct: 89  LHAHEELASTNDRARELAEEGAVHGEVVIAERQTAGRGRRGRAWISPPRKNLYFSVVLRP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +       ++   ++A+   +      G D  IKWPND+L   RKIAGIL E    ++ 
Sbjct: 149 DLPPARAPEITLVASLAVCDALRQA---GVDAGIKWPNDVLAGGRKIAGILTELAAEQDR 205

Query: 135 LQAV----VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +     V +       P D     TS+  E G    + +F+              ++
Sbjct: 206 VHWMVVGVGVNVNAGADDFPDDLRGEATSVLLERGEPAPRALFAAACLTALEGWLDVHEE 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I   WR  +  +G  + + +  G + G    +D+ G LL+    G + ++  GD+
Sbjct: 266 RGFAPIREAWRERSVTLGREVRVAVDGGELAGTAEDIDEAGALLVRTASG-LERVLAGDV 324


>gi|295398916|ref|ZP_06808898.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978382|gb|EFG53978.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 329

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 75/243 (30%), Positives = 107/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F + ++ST    +K A  G      ++A  QTAGRGR D KW S K   ++ SL+
Sbjct: 87  GRHIHFEEEVTSTQQIALKLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E    
Sbjct: 147 LRPPIPPQKAPQLTLLTAVAIAQAIQEITDIVPD--IKWPNDILINGKKCVGILTELQAD 204

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + + +V+VGIG+NV       P +     TSL  E G    +             L   
Sbjct: 205 PDRIHSVIVGIGINVNQTIEQFPEEIRAIATSLSIEKGERIQRAKLIQEILLRLEYLYKQ 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   I  LW  +A  IG  I  +   G++ G  +G+ D G L+LE++   +  I +
Sbjct: 265 YLQYGFRPIKLLWEGYAASIGKEIVARTLTGTMKGIALGITDEGVLMLEDENKQIHYIHS 324

Query: 248 GDI 250
            DI
Sbjct: 325 ADI 327


>gi|312110477|ref|YP_003988793.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y4.1MC1]
 gi|311215578|gb|ADP74182.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y4.1MC1]
          Length = 329

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 75/243 (30%), Positives = 107/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F + ++ST    +K A  G      ++A  QTAGRGR D KW S K   ++ SL+
Sbjct: 87  GRHIHFEEEVTSTQQIALKLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E    
Sbjct: 147 LRPPIPPQKAPQLTLLTAVAIAQAIQEITDIVPD--IKWPNDILINGKKCVGILTELQAD 204

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + + +V+VGIG+NV       P +     TSL  E G    +             L   
Sbjct: 205 PDRIHSVIVGIGINVNQTIEQFPEEIRAIATSLSIEKGERIQRAKLIQEILLRLEYLYKQ 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   I  LW  +A  IG  I  +   G++ G  +G+ D G L+LE++   +  I +
Sbjct: 265 YLQYGFRPIKLLWEGYAASIGKEIVARTLTGTMKGIAIGITDEGVLMLEDENKQIHYIHS 324

Query: 248 GDI 250
            DI
Sbjct: 325 ADI 327


>gi|30019685|ref|NP_831316.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus cereus ATCC 14579]
 gi|29895229|gb|AAP08517.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus cereus ATCC 14579]
          Length = 317

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 192 LDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|258513598|ref|YP_003189820.1| biotin/acetyl-CoA-carboxylase ligase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777303|gb|ACV61197.1| biotin/acetyl-CoA-carboxylase ligase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 329

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 104/253 (41%), Gaps = 18/253 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRALSG---------DLGNLWIVASCQTAGRGRRDNKWISDK 63
                +F+ + STN++  + A                + ++A  QT GRGR    W +  
Sbjct: 79  GRDVRYFEIVDSTNNKAKELAGFKGLSHEAGLTAAEGMLVIAEEQTGGRGRLGRSWHAPY 138

Query: 64  -GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
              ++ S+LL   +  + +  ++   AVA+   +          +IKWPND+    +K+ 
Sbjct: 139 GKGIWMSVLLRPQVCLEIVYQMTMITAVAVMRAVREVCG--IAPEIKWPNDLQYEGKKLC 196

Query: 123 GILIETLNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLF 177
           GIL E     + +  +VVGIG+N         P  T    +  +  G  +    +   + 
Sbjct: 197 GILTEMSAEADRVNYIVVGIGINTASAGDLIPPQITHQMTSLSEITGKPVSRVKLVQEVL 256

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
           Q++    D W       E++  W+     +   + +K  +    G  + V+  G LLL+ 
Sbjct: 257 QELEACYDSWLAGG-FPELLEEWKSHCNSLNRQVAVKTLHEVYTGWSMDVNSDGALLLKL 315

Query: 238 KKGCVRQIFTGDI 250
             G +++  +GD+
Sbjct: 316 DNGEIKKFVSGDV 328


>gi|78188061|ref|YP_378399.1| biotin--acetyl-CoA-carboxylase ligase [Chlorobium chlorochromatii
           CaD3]
 gi|78170260|gb|ABB27356.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium chlorochromatii
           CaD3]
          Length = 327

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 100/242 (41%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +   + ++D ++STN    + A SG      +VA  Q AGRGR    W+S  G NLY SL
Sbjct: 81  FGRFFHYYDEVTSTNLLARELAQSGTPEGTVVVADTQRAGRGRMGRSWVSPSGVNLYFSL 140

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  ++  +A A+   I    P    + IKWPND+LV  +K+AGIL E  +
Sbjct: 141 VLRPQVPLFRVPQVTLLVAAAVHQAIKKLAP-DVALGIKWPNDLLVQGKKVAGILCEMFS 199

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLW 187
               +  V+VGIG+N+            +               + + +      +   W
Sbjct: 200 EPEQVHFVIVGIGINLNQKEFAPELEDRATSLLCETALFFSRPQLLAEVLNAFEPLYQQW 259

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +     I+      A      + I+    +I G  VG+   G L L    G    + +
Sbjct: 260 LGENDLSFILPYLEEHASLTAKEVVIEQGNRTISGTVVGLAQGGELRLITSDGESLLVAS 319

Query: 248 GD 249
           G+
Sbjct: 320 GE 321


>gi|30261633|ref|NP_844010.1| birA bifunctional protein [Bacillus anthracis str. Ames]
 gi|47526834|ref|YP_018183.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|47566000|ref|ZP_00237038.1| biotin protein ligase C terminal domain family [Bacillus cereus
           G9241]
 gi|49184464|ref|YP_027716.1| birA bifunctional protein [Bacillus anthracis str. Sterne]
 gi|65318902|ref|ZP_00391861.1| COG0340: Biotin-(acetyl-CoA carboxylase) ligase [Bacillus anthracis
           str. A2012]
 gi|165869555|ref|ZP_02214214.1| birA bifunctional protein [Bacillus anthracis str. A0488]
 gi|167633380|ref|ZP_02391705.1| birA bifunctional protein [Bacillus anthracis str. A0442]
 gi|167639042|ref|ZP_02397315.1| birA bifunctional protein [Bacillus anthracis str. A0193]
 gi|170686025|ref|ZP_02877247.1| birA bifunctional protein [Bacillus anthracis str. A0465]
 gi|170706401|ref|ZP_02896861.1| birA bifunctional protein [Bacillus anthracis str. A0389]
 gi|177650433|ref|ZP_02933400.1| birA bifunctional protein [Bacillus anthracis str. A0174]
 gi|190568631|ref|ZP_03021536.1| birA bifunctional protein [Bacillus anthracis Tsiankovskii-I]
 gi|196033378|ref|ZP_03100790.1| birA bifunctional protein [Bacillus cereus W]
 gi|218902748|ref|YP_002450582.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH820]
 gi|227815616|ref|YP_002815625.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CDC 684]
 gi|229602333|ref|YP_002866040.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A0248]
 gi|254683125|ref|ZP_05146986.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CNEVA-9066]
 gi|254723713|ref|ZP_05185499.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A1055]
 gi|254734473|ref|ZP_05192185.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Western North America USA6153]
 gi|254740885|ref|ZP_05198573.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Kruger B]
 gi|254755123|ref|ZP_05207157.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Vollum]
 gi|254759660|ref|ZP_05211684.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Australia 94]
 gi|301053174|ref|YP_003791385.1| biotin operon repressor [Bacillus anthracis CI]
 gi|30255861|gb|AAP25496.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Ames]
 gi|47501982|gb|AAT30658.1| birA bifunctional protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|47556917|gb|EAL15247.1| biotin protein ligase C terminal domain family [Bacillus cereus
           G9241]
 gi|49178391|gb|AAT53767.1| birA bifunctional protein [Bacillus anthracis str. Sterne]
 gi|164714995|gb|EDR20513.1| birA bifunctional protein [Bacillus anthracis str. A0488]
 gi|167512832|gb|EDR88205.1| birA bifunctional protein [Bacillus anthracis str. A0193]
 gi|167531418|gb|EDR94096.1| birA bifunctional protein [Bacillus anthracis str. A0442]
 gi|170128499|gb|EDS97366.1| birA bifunctional protein [Bacillus anthracis str. A0389]
 gi|170669722|gb|EDT20463.1| birA bifunctional protein [Bacillus anthracis str. A0465]
 gi|172083577|gb|EDT68637.1| birA bifunctional protein [Bacillus anthracis str. A0174]
 gi|190560231|gb|EDV14211.1| birA bifunctional protein [Bacillus anthracis Tsiankovskii-I]
 gi|195993812|gb|EDX57768.1| birA bifunctional protein [Bacillus cereus W]
 gi|218536589|gb|ACK88987.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH820]
 gi|227006228|gb|ACP15971.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CDC 684]
 gi|229266741|gb|ACQ48378.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A0248]
 gi|300375343|gb|ADK04247.1| biotin operon repressor [Bacillus cereus biovar anthracis str. CI]
 gi|324325653|gb|ADY20913.1| biotin operon repressor [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 326

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|160935040|ref|ZP_02082426.1| hypothetical protein CLOLEP_03916 [Clostridium leptum DSM 753]
 gi|156866493|gb|EDO59865.1| hypothetical protein CLOLEP_03916 [Clostridium leptum DSM 753]
          Length = 349

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 100/242 (41%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                  +   STN+E  ++  +G       +A  QT G+GR    W S     ++ SLL
Sbjct: 106 GRNIVVLEETDSTNEEAKRQGAAGAPDGTLCLAERQTGGKGRLGRSWSSPPGAGVWMSLL 165

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   ++    TLL+    +++   I      G    IKWPNDI++ ++K+ GIL E    
Sbjct: 166 LRPQLAPQEATLLTLIAGLSVCRAIRRLTGCG--AMIKWPNDIVIGRKKVCGILTELAAD 223

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
              +  VVVGIG+N      +      +       G  ID   +   + ++     D + 
Sbjct: 224 MEQIHYVVVGIGVNANLSEFEGELKKKATSLLLETGEKIDRAALIRAVLEEFEACYDRF- 282

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                 + +  +      +   +++      I G+ +G+   G LL++   G + +I +G
Sbjct: 283 VTDLTADFITPYEELCVSLNRQVSVIRGGREITGQSIGLSKEGELLIQT-DGGIVEIGSG 341

Query: 249 DI 250
           ++
Sbjct: 342 EV 343


>gi|229178044|ref|ZP_04305416.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           172560W]
 gi|228605532|gb|EEK62981.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           172560W]
          Length = 317

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|229084644|ref|ZP_04216912.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-44]
 gi|228698667|gb|EEL51384.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-44]
          Length = 286

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEESVESTQHIAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   AV++   I     +G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPAIPVHHAPQLTLLAAVSVAQAIEK--CIGVNVGIKWPNDILIEGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQSKEHFADEIKEIATSLAIESGKPIVRAELMQQIFLQMEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+      + LW  +A  IG  IT +    +I G   G+   G L+LE++ G +  I 
Sbjct: 221 YIKNGFSVIKL-LWESYAISIGKEITARTMKETITGTAKGITADGVLILEDRTGHIHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|229090600|ref|ZP_04221834.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-42]
 gi|228692743|gb|EEL46468.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-42]
          Length = 290

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|169827542|ref|YP_001697700.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus sphaericus C3-41]
 gi|168992030|gb|ACA39570.1| Bifunctional protein birA [Lysinibacillus sphaericus C3-41]
          Length = 327

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 101/245 (41%), Gaps = 6/245 (2%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
            +  +  +FD + ST     K A  G      I+   QTAGRGR    W S     ++ +
Sbjct: 81  HFGRKIHYFDVVDSTQTIAHKLAQEGAPHGTVIIGEEQTAGRGRMARPWESVHGSGIWMT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +++   ++    +  +  +AVA+   I +      +  IKWPND+L+  +K  GIL E  
Sbjct: 141 IIVRPDVTPQQASSYTLVVAVAVTMAITTLYK-DIEPAIKWPNDLLINGKKCTGILTEMQ 199

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR----EGGCIDLKDIFSLLFQDVARVLD 185
              + +QA++VGIG+N      D    +  +      E G    +     L         
Sbjct: 200 AEADLVQALLVGIGINANQEAADFSSNIAEIATSLRLEAGEEINRAALVALILQYLEQFT 259

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
               + G   I  LW   +C IG  I +        G   G+ D G L L +  G VR I
Sbjct: 260 ELYVEEGFASIKTLWEQLSCTIGQRIEVTTIRERFEGIASGITDDGVLQLTQDDGLVRTI 319

Query: 246 FTGDI 250
           + GDI
Sbjct: 320 YAGDI 324


>gi|197118701|ref|YP_002139128.1| bifunctional biotin operon repressor/biotin--acetyl-CoA carboxylase
           ligase [Geobacter bemidjiensis Bem]
 gi|197088061|gb|ACH39332.1| biotin operon repressor and biotin--acetyl-CoA carboxylase ligase
           [Geobacter bemidjiensis Bem]
          Length = 327

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                      STN    K A  G      ++A  Q+AG+GR    W+S  G NLY S++
Sbjct: 83  GSSVICLKETDSTNSVAFKMAEEGAPEGTVVIADTQSAGKGRLGRIWLSPPGVNLYCSVV 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I+  +   L+F   VA+   +          +IKWPNDIL+  +K+AG+L E    
Sbjct: 143 LRPAIAPVAACQLTFLSVVAVARAVER--CTNLKPQIKWPNDILINGKKVAGLLNEMNAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL------QREGGCIDLKDIFSLLFQDVARVLD 185
              +  VV+GIG+N+          +         +  G  +D       L +++ ++ D
Sbjct: 201 TEKVNFVVLGIGVNLNLRMAVISEGLLRHPATSLLEEGGEEVDRLRFTRALLEELDQLYD 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +        +   W   +   G  + +        G   GVD FG LL+    G +  +
Sbjct: 261 NFLVQG-DGPVRAEWLARSAIKGRSVRVSQQNREFSGVVQGVDSFGALLVLLGDGTLETV 319

Query: 246 FTGDI 250
            +GD+
Sbjct: 320 LSGDV 324


>gi|42780740|ref|NP_977987.1| birA bifunctional protein [Bacillus cereus ATCC 10987]
 gi|42736660|gb|AAS40595.1| birA bifunctional protein [Bacillus cereus ATCC 10987]
          Length = 326

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAG+GR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQYIAAKLAYEGAEEGTIVVAEEQTAGKGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|229126950|ref|ZP_04255961.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-Cer4]
 gi|228656550|gb|EEL12377.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-Cer4]
          Length = 290

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|52143811|ref|YP_083017.1| biotin operon repressor [Bacillus cereus E33L]
 gi|51977280|gb|AAU18830.1| biotin operon repressor [Bacillus cereus E33L]
          Length = 326

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +               ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKLIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|49480998|ref|YP_035753.1| biotin operon repressor [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|49332554|gb|AAT63200.1| biotin operon repressor [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 326

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +               ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGRPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|91977341|ref|YP_570000.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB5]
 gi|91683797|gb|ABE40099.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB5]
          Length = 269

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 127/247 (51%), Gaps = 8/247 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD I STN E + +A +G+ G +W V + QTAGRGRR   WI+ +GNL A++L 
Sbjct: 13  GYRLAAFDAIGSTNSEALAQARAGERGPMWFVTTEQTAGRGRRQRAWIAPRGNLAATVLE 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPV--------GTDVKIKWPNDILVFQRKIAGI 124
           + ++       L FA  +A+ + +                  ++KWPND+L   +K+ GI
Sbjct: 73  VLAVPPGVAATLGFAAGLALETALQQVSFEARARAGGADFGFRLKWPNDVLAGGKKLTGI 132

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L+E  ++     AVVVGIG NV   P DTPYP  SL   G  +  +D+F+ L    A   
Sbjct: 133 LLEAESVGADRLAVVVGIGTNVVAAPDDTPYPAASLHGLGIHVSAEDLFAALSDAWAETR 192

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W +  G  EI   W   A G+G  ++++    +I G F  +D+ G L++    G    
Sbjct: 193 AVWNEGRGFGEIRRQWLARAAGLGGPVSVQSGSTTIDGIFDTIDETGCLIVRTSDGRRVP 252

Query: 245 IFTGDIF 251
           +  GD++
Sbjct: 253 VSAGDVY 259


>gi|228938748|ref|ZP_04101351.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971630|ref|ZP_04132252.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978239|ref|ZP_04138616.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           Bt407]
 gi|228781256|gb|EEM29457.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           Bt407]
 gi|228788043|gb|EEM36000.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228820923|gb|EEM66945.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 290

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G DV IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVDVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLKNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|154505275|ref|ZP_02042013.1| hypothetical protein RUMGNA_02789 [Ruminococcus gnavus ATCC 29149]
 gi|153794473|gb|EDN76893.1| hypothetical protein RUMGNA_02789 [Ruminococcus gnavus ATCC 29149]
          Length = 326

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 102/242 (42%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                +F    STN +  +    G        A  QTAG+GRR   W S    N+Y SLL
Sbjct: 78  GQNVYYFTETDSTNIQAKRMGDQGAPHGTLAAAGQQTAGKGRRGRTWESPADQNIYMSLL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+     +L+  +A A    +      G DV+IKWPND+++  +KI GIL E    
Sbjct: 138 LRPEIAPVKAPMLTLVMAYAAAMALRE--CTGLDVQIKWPNDLVINGKKICGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCIDLKDIF-SLLFQDVARVLDLWK 188
            + +  VV+GIG+N      P +     TSL+ E G    +    + + +   +    + 
Sbjct: 196 IDYINYVVIGIGINTNIEQFPEELKQTATSLRIEAGHSIRRSPLIAAIMRWFEKAYAEFM 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      I   +       G  + +    G      +G+++ G LL+ +  G    ++ G
Sbjct: 256 KTEDLSGIQKAYNELLVNCGREVRVLEPKGEWQAEALGINNGGELLVRKADGSETAVYAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|298674486|ref|YP_003726236.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalobium evestigatum
           Z-7303]
 gi|298287474|gb|ADI73440.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalobium evestigatum
           Z-7303]
          Length = 325

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 107/244 (43%), Gaps = 11/244 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           +   FD + STN+E  + A   D     I++  Q +GRGR    W S +G +Y S++L  
Sbjct: 84  KIYHFDELESTNEEAKRLAPDED-EGTVIISETQKSGRGRMGRDWTSPRGGIYMSVILKP 142

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +I       L+    +A+ + I +    G +  IKWPNDIL+  RK+ GIL E       
Sbjct: 143 TIPASHAYHLTLVAGIAVANAIRNL---GINACIKWPNDILINNRKVCGILTEINAEIEK 199

Query: 135 LQAVVVGIGLNVKHCPVDT-----PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           +  +V+G+G+N                 +     G  ++       L  +  +    +K 
Sbjct: 200 IDYIVLGMGINANVDTGMFSSELKEGSTSLKSELGKPVERVSFVQNLLYEFEQEYIKFKS 259

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                +I++ W   +  IG  ++I      + G+ +GV   G L++++  G   +I  G 
Sbjct: 260 -KPFNDIVDEWISLSDTIGKEVSIMTPSKMVEGKAIGVTKNGALIVKKDDGEKEEIIAGR 318

Query: 250 -IFT 252
            I+T
Sbjct: 319 CIYT 322


>gi|228900217|ref|ZP_04064448.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 4222]
 gi|228964611|ref|ZP_04125719.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228795042|gb|EEM42540.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228859386|gb|EEN03815.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 4222]
          Length = 286

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G  V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVGVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 221 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|75760405|ref|ZP_00740449.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|74492116|gb|EAO55288.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 330

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 87  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G  V IKWPNDIL+  +K  GIL E    
Sbjct: 147 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVGVGIKWPNDILIQGKKAVGILTEMQAD 204

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 205 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 265 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 323

Query: 247 TGDI 250
           + DI
Sbjct: 324 SADI 327


>gi|118477090|ref|YP_894241.1| biotin operon repressor [Bacillus thuringiensis str. Al Hakam]
 gi|118416315|gb|ABK84734.1| biotin operon repressor [Bacillus thuringiensis str. Al Hakam]
          Length = 334

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT+GRGR   KW S K   ++ S++
Sbjct: 91  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSII 150

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 151 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 208

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 209 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 268

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 269 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 327

Query: 247 TGDI 250
           + DI
Sbjct: 328 SADI 331


>gi|218896566|ref|YP_002444977.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus G9842]
 gi|218545634|gb|ACK98028.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus G9842]
          Length = 326

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G  V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVGVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|78223194|ref|YP_384941.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter metallireducens
           GS-15]
 gi|78194449|gb|ABB32216.1| Biotin--acetyl-CoA-carboxylase ligase [Geobacter metallireducens
           GS-15]
          Length = 338

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 105/243 (43%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                F     STN    + A  G +    ++A  Q  GRGR   +W S  G NLY S++
Sbjct: 94  GTSLVFVGETDSTNTLAYRLAEDGAVEGTVVIADAQNRGRGRLGRQWESPAGVNLYCSII 153

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+F  AVA+   I      G    IKWPND+LV   K+AG+L E    
Sbjct: 154 LRPPIMPLHAPQLTFLSAVAVAEAIER--SAGLAPVIKWPNDVLVNGFKVAGMLNEMSAE 211

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  +V+GIG+N+       P D  +P +SL  E G    +  F+    +   V    
Sbjct: 212 TERIDFLVLGIGVNINMQRDQFPTDLRHPASSLAIEAGHEVSRLSFARALLESLDVHYSQ 271

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   +   W   +  +G  + +  + G + G   G+D+ G LLL    G + ++  
Sbjct: 272 YRSEGYAPLRQAWLGRSAVMGRRVRVSGNQGDMTGTVEGIDEIGALLLRTAHGTLERVLA 331

Query: 248 GDI 250
           GD+
Sbjct: 332 GDV 334


>gi|73669100|ref|YP_305115.1| biotin--(acetyl-COA-carboxylase) synthetase [Methanosarcina barkeri
           str. Fusaro]
 gi|12018159|gb|AAG45428.1|AF317651_5 bifunctional biotin ligase/biotin operon repressor PYCB
           [Methanosarcina barkeri]
 gi|72396262|gb|AAZ70535.1| biotin--(acetyl-COA-carboxylase) synthetase [Methanosarcina barkeri
           str. Fusaro]
          Length = 326

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 107/240 (44%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +F+ ++STN    + A S +     ++A  Q  GRGR   +WIS  G ++ S++L
Sbjct: 83  GKEIHYFEEVTSTNSIAKEIAAS-EEEGTLVIAEVQKGGRGRLGREWISPHGGIWMSVIL 141

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I     + L+    +A+ +VI +   +  D +IKWPND+ +  +K+ GIL E     
Sbjct: 142 KPGIPLRHASRLTLVAGLAVANVIRN---MDLDARIKWPNDVRINGKKVCGILTEAKAEV 198

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           + +  VV+GIG+NV       P       T+L+ E G    +  F   F        +  
Sbjct: 199 DKVDYVVLGIGINVNMDLKDIPESFRAGSTTLKAELGRHIKRVSFLQDFLFELEQQYILF 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      I+N W   +  IG  + +      I G+ VGV   G L++++      +I  G
Sbjct: 259 KTQPFSHILNDWLALSDTIGREVKVTTPSRIIEGKAVGVTPDGALVIKKADDTKEEIIAG 318


>gi|319408593|emb|CBI82248.1| birA bifunctional protein [Bartonella schoenbuchensis R1]
          Length = 265

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 92/253 (36%), Positives = 133/253 (52%), Gaps = 2/253 (0%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A +G  G LWIVA  QT GR RR   W 
Sbjct: 1   MVYALSDFALKQGYVLESYESVDSTNLIAQQKANAGHRGYLWIVAEKQTQGRARRGRTWY 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQ 118
           S KGNLY+SLLLID I   + + LSF   V++   I   +    D  V +KWPNDIL+  
Sbjct: 61  SPKGNLYSSLLLIDDIVCQTASQLSFVAGVSIVEAIRHFIKDKKDSIVNLKWPNDILLKG 120

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
            K +GIL+E   L     A+V+GIG+NVKH   D PY  +S++  G  ID +++F +L +
Sbjct: 121 IKSSGILLELFTLTPQKYALVIGIGVNVKHHFKDAPYLTSSIKNIGLDIDKEELFMVLTK 180

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
             A    LWK+  G   I   W  ++  +G  I I        G F G+D     ++++K
Sbjct: 181 CFAENYLLWKQSEGSSIIHKKWLLYSAHLGQPIKIINGEKLTEGIFDGLDHDFNCIVKQK 240

Query: 239 KGCVRQIFTGDIF 251
            G    I  GD++
Sbjct: 241 DGQKAIITAGDVY 253


>gi|138895758|ref|YP_001126211.1| BirA bifunctional protein [Geobacillus thermodenitrificans NG80-2]
 gi|196248640|ref|ZP_03147340.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. G11MC16]
 gi|134267271|gb|ABO67466.1| BirA bifunctional protein [Geobacillus thermodenitrificans NG80-2]
 gi|196211516|gb|EDY06275.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. G11MC16]
          Length = 329

 Score =  158 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 108/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  FF+ + ST     K A  G      ++A  Q AGRGR D KW S +   ++ SL+
Sbjct: 87  GHQIHFFEEVDSTQRIAAKLAYEGAPEGTLVIAEEQKAGRGRLDRKWFSPQGTGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+  +AVA+   I     +  D  IKWPNDIL+  +K  GIL E    
Sbjct: 147 LRPPIPPQQAPQLTLLVAVAVSQAIQEVTGLVPD--IKWPNDILLHGKKCVGILTELQAD 204

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +++V++GIG+NV       P D     TSL  E G    +             L   
Sbjct: 205 PDRVRSVIIGIGINVNQTSAQFPEDICDIATSLAIEKGERIKRAPLIQEILLQLERLYKQ 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             + G   I  LW  +A  IG  +T +     I G   G+ D G L+LE+++  +  I +
Sbjct: 265 YLEHGFRPIKLLWEGYAVSIGKPVTARTLGKVIRGIARGITDDGLLILEDEQNQLHYIHS 324

Query: 248 GDI 250
            DI
Sbjct: 325 ADI 327


>gi|229121179|ref|ZP_04250416.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           95/8201]
 gi|228662298|gb|EEL17901.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           95/8201]
          Length = 286

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +               ++   +F  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGRPIVRAELMQQIFLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ KG V  I 
Sbjct: 221 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHKGKVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|16126179|ref|NP_420743.1| biotin protein ligase [Caulobacter crescentus CB15]
 gi|221234951|ref|YP_002517387.1| biotin operon repressor/biotin--(acetyl-CoA-carboxylase) synthetase
           [Caulobacter crescentus NA1000]
 gi|13423393|gb|AAK23911.1| biotin protein ligase [Caulobacter crescentus CB15]
 gi|220964123|gb|ACL95479.1| biotin operon repressor/biotin--(acetyl-CoA-carboxylase) synthetase
           [Caulobacter crescentus NA1000]
          Length = 250

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 77/237 (32%), Positives = 118/237 (49%), Gaps = 3/237 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
               D I STN E  +RA +G +  LW+V   QTAGRGRR   W + +GNL A+LL    
Sbjct: 12  IVVLDEIDSTNAEARRRAEAGAVEPLWLVGLRQTAGRGRRGRAWETGEGNLAATLLFRTE 71

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                   +SF  A+A+  ++A  +P    + +KWPND L+   K++GIL+E+     G 
Sbjct: 72  RPPAEAAQVSFVAALAVADLLARYVPSHL-ISLKWPNDPLLGGLKVSGILVESGASPFGG 130

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             + VGIG+N+K  P+D   P T++          ++   +L +   R L  W     R 
Sbjct: 131 LWLAVGIGVNLKRKPIDAERPATAIATYLEAPPSPQEAAEVLAEAFERWLRTWDILGFR- 189

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I + W   A G+G+    +L + ++ G    +D  G L L    G +R+I  GD+F
Sbjct: 190 AIADAWTARAHGLGEPCVARLGHETVEGVAEALDADGALRLRLADGSLRRITAGDVF 246


>gi|229155202|ref|ZP_04283314.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           4342]
 gi|228628329|gb|EEK85044.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           4342]
          Length = 290

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|225863500|ref|YP_002748878.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus 03BB102]
 gi|225787725|gb|ACO27942.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus 03BB102]
          Length = 326

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT+GRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G +  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKLHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|206889577|ref|YP_002249406.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206890257|ref|YP_002249455.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741515|gb|ACI20572.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742195|gb|ACI21252.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 266

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +D + STN +  +    G      +VA  Q  G+GR   KWIS    NLY S+ 
Sbjct: 20  GKEIVVYDEVESTNSKANELLKQGYPSGTVVVADRQIKGKGRLGRKWISPSGKNLYMSIG 79

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +  +I     TLL+    VA  + +         V IKWPND+LV  +K+ GIL E    
Sbjct: 80  IKPTIPPKYATLLTLTSVVACTTALRRY--ADVPVLIKWPNDMLVDDKKVGGILTEMKIE 137

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
              +++ VVGIG+NV     D P  +  +       +G       +   + ++  +   L
Sbjct: 138 GEKIKSAVVGIGINVNMTEEDMPEEIKEIASSLKICKGEDFSRSLLAVEIIKEFDKWYQL 197

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +K   R+ I++ W   +  IG  + I LS   ++     +D+ G L+++   G   +I 
Sbjct: 198 LEKRQ-RKTIIDRWMQLSGTIGRQVKIVLSDRELIATAEAIDEEGRLIVKLTDGTYEKIC 256

Query: 247 TGDI 250
            GD+
Sbjct: 257 AGDV 260


>gi|229010947|ref|ZP_04168143.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides DSM
           2048]
 gi|229058274|ref|ZP_04196661.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH603]
 gi|229132446|ref|ZP_04261300.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST196]
 gi|229166484|ref|ZP_04294240.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH621]
 gi|228617058|gb|EEK74127.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH621]
 gi|228651152|gb|EEL07133.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST196]
 gi|228720045|gb|EEL71631.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH603]
 gi|228750347|gb|EEM00177.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides DSM
           2048]
          Length = 286

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     + A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 43  GRTVYFEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWYSPKGTGIWMSII 102

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 103 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 160

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 161 PDKINAVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 220

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 221 YLKNG-FSVIKILWESYAVSIGKEITARTMKETINGLAKGITEDGVLLLEDHQGQVHHIH 279

Query: 247 TGDI 250
           + DI
Sbjct: 280 SADI 283


>gi|163939454|ref|YP_001644338.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus weihenstephanensis
           KBAB4]
 gi|163861651|gb|ABY42710.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus weihenstephanensis
           KBAB4]
          Length = 326

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     + A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWYSPKGTGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLKNG-FSVIKILWESYAVSIGKEITARTMKETINGLAKGITEDGVLLLEDHQGQVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|224369786|ref|YP_002603950.1| BirA [Desulfobacterium autotrophicum HRM2]
 gi|223692503|gb|ACN15786.1| BirA [Desulfobacterium autotrophicum HRM2]
          Length = 304

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 7/238 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
              F  +I ST DE  + A  G      ++A  QT GRGR +  W S KG L+ +++L  
Sbjct: 67  NILFSPSIDSTMDEARRLAREGVPHFTVVIAEQQTKGRGRLNRAWSSQKGGLWFTIILRP 126

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +       ++FA ++ +   +        + K+KWPNDIL+  +K+ G+L E     + 
Sbjct: 127 DLPPQLSFKVNFAASLCLAKTLNQL--FNINAKVKWPNDILINNQKLVGLLSEMETRGDM 184

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           +  V VGIG+NV + P        S+    G  +    I +       R LD   +    
Sbjct: 185 ISFVNVGIGINVNNQPEKEQPNAVSISTLLGQKVSRTKILAAFLDRFQRTLDNILERN-- 242

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I+ LW+     IG  + I+       G  + VDD G L+L ++    R++  GD F
Sbjct: 243 --IIELWKEQTATIGRQVRIETFKDHFQGLALDVDDTGALILMDEDHTTRRVIYGDCF 298


>gi|85717015|ref|ZP_01047977.1| biotin--protein ligase [Nitrobacter sp. Nb-311A]
 gi|85696139|gb|EAQ34035.1| biotin--protein ligase [Nitrobacter sp. Nb-311A]
          Length = 270

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 126/248 (50%), Gaps = 9/248 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD I STN E + RA +G+ G +W+VA+ QTAGRGRR   WIS  GNL  S+L 
Sbjct: 13  GYRLAVFDRIGSTNAEALMRARAGETGPIWLVAAEQTAGRGRRQRSWISPPGNLACSVLE 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTL---------PVGTDVKIKWPNDILVFQRKIAG 123
           +  IS      LSFA  +A+ + + S                  +KWPND+L   +K+AG
Sbjct: 73  VIDISPAVAATLSFAAGLALEAALRSVSLEARMRSPGSENVTFHLKWPNDVLADGKKLAG 132

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           IL+E   +++   AVVVGIG NV   P   PYP  +L+  G  I  +D+F  L       
Sbjct: 133 ILLEAEIVEHDRLAVVVGIGANVVAAPEGMPYPAVALRDLGIDIGAEDLFRALTDAWTEF 192

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
             +W +  G   I  LW   A G+G  ++I+    +I G F  +D  G L++    G   
Sbjct: 193 RTIWDEGRGFGGIRRLWLDRAAGVGQHVSIRSDSSTISGLFDTIDKNGCLIVATSDGKRV 252

Query: 244 QIFTGDIF 251
            +  GD++
Sbjct: 253 AVSAGDVY 260


>gi|114777612|ref|ZP_01452593.1| birA biofunctional protein, putative [Mariprofundus ferrooxydans
           PV-1]
 gi|114552083|gb|EAU54600.1| birA biofunctional protein, putative [Mariprofundus ferrooxydans
           PV-1]
          Length = 319

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 112/254 (44%), Gaps = 12/254 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + + LS        R    D   STN + M+ A  G+   L ++A  QT GRGR   +W 
Sbjct: 69  LQARLSTTHL--GHRLLLVDETGSTNQDVMRLAEHGEPDGLVMIAKRQTTGRGRLGRRWH 126

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           +   +L  S+LL  ++  + +  LS   AVA+   +   +P    ++IKWPND++    K
Sbjct: 127 TVPESLAVSVLLRPALPPEKVPQLSLLTAVALHEALQVYVP---ALRIKWPNDLMCHGGK 183

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC-----IDLKDIFSL 175
           +AGIL E       + AVV+G G+N+       P  +T    +        +   ++ + 
Sbjct: 184 LAGILTEMRAEPGSVHAVVLGFGINLNPPADGWPADITQPAIDLATAAGRSMSRLEVVAG 243

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           +   +    D + +          W+  A      + +    G + G   G+D  G LLL
Sbjct: 244 VLNVLDAWYDRYLRQGFDPVREAWWQAHAA-SDQAVRVHDGRGYLHGMARGLDHDGALLL 302

Query: 236 EEKKGCVRQIFTGD 249
           E ++G +R+I  G+
Sbjct: 303 ETEEG-MRRIIAGE 315


>gi|316933907|ref|YP_004108889.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           DX-1]
 gi|315601621|gb|ADU44156.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           DX-1]
          Length = 268

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 129/246 (52%), Gaps = 8/246 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD++ STN E + RA +G+ G  W V + QTAGRGRR   W++ +GNL +S+L 
Sbjct: 14  GYRLAAFDSVGSTNAEALARARAGEAGPAWFVTTEQTAGRGRRQRAWVAPRGNLASSVLE 73

Query: 73  IDSISKDSLTLLSFAIAVAMRSVI-------ASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           +  +   +   L FA  +A+ + +        +        ++KWPND+L   +K+AGIL
Sbjct: 74  VMRVPPGTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLASGKKLAGIL 133

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +E  N+ + L AVVVGIG NV   P DTPYP  SL   G  +  +D+F+ L      +  
Sbjct: 134 LEAENVGDRL-AVVVGIGTNVVAAPTDTPYPAVSLHDLGIAVSAEDLFAALSDAWTELRG 192

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +W    G  EI   W   A G+G+ ++I      + G F  +DD G L++    G    +
Sbjct: 193 IWDGGRGFAEIRRRWLERAAGLGEPVSITSGDSVLEGVFDSIDDTGCLIVRTTDGRRVPV 252

Query: 246 FTGDIF 251
             GD++
Sbjct: 253 SAGDVY 258


>gi|147919954|ref|YP_686292.1| biotin--(acetyl-CoA-carboxylase) synthetase [uncultured
           methanogenic archaeon RC-I]
 gi|110621688|emb|CAJ36966.1| biotin--(acetyl-CoA-carboxylase) synthetase [uncultured
           methanogenic archaeon RC-I]
          Length = 319

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 106/238 (44%), Gaps = 5/238 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +   F+   ST+    + A  G      ++A  QT G+GR   KW + +G ++ +++L
Sbjct: 79  GSKIVHFNVTGSTHLVARQLAERGIEEGTVVIAETQTRGKGRLGRKWSARQGGIWMTVVL 138

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       ++   AV++   +      G +  IKWPND+LV  +KI GIL E     
Sbjct: 139 KPKIDPMHAASITLMAAVSVTKALREL---GLEAVIKWPNDVLVNGKKICGILTEMSAET 195

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           + +  +++  G+NV    V      T+    G  +D   +   + +++       ++   
Sbjct: 196 DMVNFIILSAGINVN-NEVPLDIATTARAELGHKVDRLKLAQSILEELDEDYATLREQG- 253

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I+  WR ++  +G  + +     +I G    VDD G LL++   G VR+I +GD 
Sbjct: 254 FTPILWNWRRYSDTLGRPVEVTYQGEAIRGIAQDVDDAGSLLVKLADGSVRKIVSGDC 311


>gi|121602388|ref|YP_989084.1| biotin-[acetyl-CoA-carboxylase] ligase [Bartonella bacilliformis
           KC583]
 gi|120614565|gb|ABM45166.1| biotin-[acetyl-CoA-carboxylase] ligase [Bartonella bacilliformis
           KC583]
          Length = 266

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 86/250 (34%), Positives = 129/250 (51%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +  E ++++ STN    ++A +G  G LWIVA  Q  GR RR   W S KG
Sbjct: 4   LSNFAQKQGYGVESYESVDSTNLVAQQKAQAGHPGYLWIVAEEQIQGRARRGRSWSSPKG 63

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILVFQRK 120
           NLY SLLLID+I+  +   L F   V+M   +   +         + +KWPNDIL+   K
Sbjct: 64  NLYTSLLLIDNITHQTAAHLGFVAGVSMVEAVKEFIKDQHKSEDIISLKWPNDILLEGAK 123

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +GIL+E   L     A+V+GIG+NV+    D PYP +S+++ G  ID K +F +L +  
Sbjct: 124 SSGILLELFELSPQKYALVIGIGMNVESHYKDAPYPTSSMKKIGLHIDKKQLFKVLTKFF 183

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           A+   LWK+  G + I   W  ++   G  I +      I G F G+D     +++++ G
Sbjct: 184 AKNYLLWKQPKGYDVIRKKWLLYSAHFGQHIKVTDGSKIIEGIFDGLDCNFNCIVKQENG 243

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 244 QEAIITAGDV 253


>gi|228990653|ref|ZP_04150618.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus
           pseudomycoides DSM 12442]
 gi|228996751|ref|ZP_04156388.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides
           Rock3-17]
 gi|228763070|gb|EEM11980.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides
           Rock3-17]
 gi|228769179|gb|EEM17777.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus
           pseudomycoides DSM 12442]
          Length = 318

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 75  GRTVYFKESVESTQHIAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 134

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   AV++   I        +V IKWPNDIL+  +K  GIL E    
Sbjct: 135 LRPAIPVHHAPQLTLLAAVSVAQAIEK--CTSVNVGIKWPNDILIEGKKAVGILTEMQAD 192

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++   
Sbjct: 193 PDKINAVIMGIGINANQGQEHFADEIKEIATSLAIESGKPIVRAELMQQIFLQMEKLYQE 252

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+      + LW  +A  IG  IT +    +I G   G+   G L+LE+ KG +  I 
Sbjct: 253 YVKNGFSVIKL-LWESYAISIGKEITARTMKDTITGVAKGITADGVLMLEDDKGQLHHIH 311

Query: 247 TGDI 250
           + DI
Sbjct: 312 SADI 315


>gi|28210569|ref|NP_781513.1| putative transcriptional repressor of the biotin operon birA
           [Clostridium tetani E88]
 gi|28203006|gb|AAO35450.1| putative transcriptional repressor of the biotin operon birA
           [Clostridium tetani E88]
          Length = 327

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++  + STN++  + AL+       +++  QT+GRGR    W S     +Y S +
Sbjct: 79  GRNIMYYKEVDSTNNKAKELALN-SPEGTVVISELQTSGRGRLGRDWYSPFGKGIYMSTI 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +   + + ++   A A+     S   +G    IKWPNDI++  +K+ GIL E    
Sbjct: 138 LKPDVDPVNASKITQIAAAALCK---SFNEIGIKSYIKWPNDIIINNKKVCGILTEMDAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  +V+GIG+NV       P  ++++           I+ +++ S +  +   + + 
Sbjct: 195 LNQINYIVLGIGINVNMEKDSFPEEISTIASSLKIESGIHINRQELVSTILNNFEILYNE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +         + + R  +  +G  I I      + G  + +DD G L++++K   + +I 
Sbjct: 255 YLNKKNILSSIKICRENSILLGKEIKIIKGNEVLQGTAMDIDDEGLLIIKDKDDNLNKII 314

Query: 247 TGDI 250
           +G++
Sbjct: 315 SGEV 318


>gi|331086550|ref|ZP_08335628.1| hypothetical protein HMPREF0987_01931 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330410383|gb|EGG89815.1| hypothetical protein HMPREF0987_01931 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 327

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 110/239 (46%), Gaps = 6/239 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
            E++    STN    + A  G +     VA  Q+AG+GRR   W S KG  ++ SLLL  
Sbjct: 81  VEYYAETDSTNIRAKQAAGQGAVHGTLFVADRQSAGKGRRGRSWDSPKGTEIFMSLLLRP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
               D   +L+  +A+A    +        +VKIKWPND+++  +KI GIL E     + 
Sbjct: 141 QFVPDKAPMLTILMAIAAAEAVR--DKTDLEVKIKWPNDLVIGGKKICGILTEMSAEIDY 198

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           +  VVVG+G+NV            +          I   ++ + + Q    + + ++K+ 
Sbjct: 199 IDYVVVGVGVNVNRKEFPEELREKATSLLLEGKVSIKRSELIAEIMQRFETLYEAFEKEQ 258

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +   +   +   G  +T+    G+  G  +G+++ G LL+E + G +  ++ G++
Sbjct: 259 SLRFVQQRYNEQSVNCGRRVTVLEPKGNWDGIALGINEAGELLVENEAGEICTVYAGEV 317


>gi|20089561|ref|NP_615636.1| biotin operon repressor/biotin-pyruvate carboxylase ligase
           [Methanosarcina acetivorans C2A]
 gi|19914476|gb|AAM04116.1| biotin operon repressor/biotin-pyruvate carboxylase ligase
           [Methanosarcina acetivorans C2A]
          Length = 325

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 107/240 (44%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +  +F+ +SSTN    + A S +     ++A  Q  GRGR   +WIS  G ++ S++L
Sbjct: 82  GQKIHYFEEVSSTNSVAKEIAAS-EEEGSLVIAEVQKVGRGRMGREWISPHGGIWMSVIL 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I     + L+    +A+ +VI     +G D +IKWPND+ +  +K+ GIL E     
Sbjct: 141 KPGIPLRHASRLTLVAGLAVANVIR---DMGLDARIKWPNDVRINGKKVCGILTEAKAEV 197

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           + +  V++GIG+NV       P       T+L+ E G    +  F            +  
Sbjct: 198 DRVDYVILGIGINVNMELKDIPESFRAGSTTLKVETGKHIRRVSFLQDLLFELEQQYIRF 257

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K     +I+N W   +  IG  + +      I G+ VGV   G L++ +      +I  G
Sbjct: 258 KTQPFSQILNDWLALSDTIGREVKVTTPSRIIEGKAVGVTPDGALIIRKSDDTKEEIIAG 317


>gi|313906483|ref|ZP_07839817.1| biotin/acetyl-CoA-carboxylase ligase [Eubacterium cellulosolvens 6]
 gi|313468673|gb|EFR64041.1| biotin/acetyl-CoA-carboxylase ligase [Eubacterium cellulosolvens 6]
          Length = 264

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/250 (19%), Positives = 95/250 (38%), Gaps = 4/250 (1%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
             + E      +   +   + STN+   + A          +A  Q+AG+G R   W S 
Sbjct: 8   ERIKEALTAEGYEIRYLPEVDSTNEWAKREAKEKVTDGRVYLADYQSAGKGSRGRAWESP 67

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
           +   +  S++L   ++ + L++++  + +A    I        D KIKWPND++   +K+
Sbjct: 68  RGTTISMSVVLEPKVTPEKLSMITLVMGMAAADGIREVSG--IDTKIKWPNDVVHNGKKL 125

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
            GIL E       L   +             +    +     G       + + +     
Sbjct: 126 CGILTEMGAGFGYLVVGIGINVNTADFPEELSDKATSLYLETGRYFSRNAVVAAVLNYFR 185

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL-EEKKG 240
           +   L+ KD     +++ ++         + +        G  +G+D  G LL+  E  G
Sbjct: 186 KYYSLFVKDGDLTSLVDRYQSMLANRDQRVRVLDQRNPFEGTALGIDKTGELLVKREDDG 245

Query: 241 CVRQIFTGDI 250
            V +IF G++
Sbjct: 246 QVVKIFAGEV 255


>gi|295110731|emb|CBL24684.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Ruminococcus
           obeum A2-162]
          Length = 268

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 105/242 (43%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                F   I STN+ C + +    +     VA  Q+AG+GR   +W+  +GN +  S+L
Sbjct: 21  GKTVHFAKEIDSTNEWCKRLSKEDAVHGTLAVAEFQSAGKGRLGRRWVVPEGNSIMMSIL 80

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L         ++L+  + +++   +      G DV IKWPND++V ++KI GIL E    
Sbjct: 81  LRPDFEPRFASMLTLVMGLSVAQAVKEL---GVDVSIKWPNDVVVSRKKICGILTEMGLE 137

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              ++ VV+G+G+NV    +       +       G   D   +  L+     +  + + 
Sbjct: 138 DGKIREVVIGVGINVNLAEIQEELKDKATSLYLETGKTYDRNFLIGLVMGKFEKNYEKFV 197

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      +++ +          + I        G  +G+D  G LL+    G +R++ +G
Sbjct: 198 QTCDLSLMIDDYNMMLANKCQPVRILDKLDPYEGVALGIDREGELLVRVADGRIRKVCSG 257

Query: 249 DI 250
           ++
Sbjct: 258 EV 259


>gi|152975061|ref|YP_001374578.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023813|gb|ABS21583.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus cytotoxicus NVH
           391-98]
          Length = 326

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHVAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWYSPKGTGVWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILINGKKTVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++   
Sbjct: 201 PDKINAVIMGIGINANQQTEHFVDEIKQIATSLAIESGKPIVRAELMQQIFLQMEKLYKE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +  +      + LW  +A  IG  IT +    +I G   G+ D G LLLE+ +G +  I 
Sbjct: 261 YLNNGFTVVKL-LWESYAVSIGKEITARTMRQTITGVAKGITDDGVLLLEDHQGYIHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|14548143|gb|AAK66800.1|U40238_23 bifunctional protein: biotin repressor/biotin
           [acetyl-CoA-carboxylase] ligase [uncultured
           crenarchaeote 4B7]
          Length = 333

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/246 (28%), Positives = 113/246 (45%), Gaps = 11/246 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R  +F+ I ST +   + A         I+A  QTAGRGR D KW S KG ++ SL++
Sbjct: 88  GKRIYYFEEIDSTQNFAKQIAYDKKENGTIIIAEKQTAGRGRLDRKWTSPKGGMWFSLII 147

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                  + TL+    AVA+   I S L      ++KWPNDI +  +K+AG+L++     
Sbjct: 148 HPKFDVSNSTLIPILSAVALSKSIKSVLG--IKTEVKWPNDITMNGKKVAGMLVDASFQA 205

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA--RVLDLWK-- 188
           N +  +++GIG+N           +       G   L+         +     L  ++  
Sbjct: 206 NNIDYLILGIGVNFDIDAKKLEKRLAKTPNFYGVNSLRKKDDKTPPKLLLKEFLLQFEEK 265

Query: 189 ----KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                +  + +I+  W   A GIG  ITI  S G I G   G+D+ G L ++ +K   ++
Sbjct: 266 LSQLDNGEKSKIVKEWTKRAAGIGKKITINTSNGKISGISQGIDNDGALKIKTRK-ETKK 324

Query: 245 IFTGDI 250
           IF GD+
Sbjct: 325 IFVGDV 330


>gi|291551183|emb|CBL27445.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Ruminococcus
           torques L2-14]
          Length = 330

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 101/244 (41%), Gaps = 6/244 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++D++ STN    +    G       VA  QTAGRGRR   W S    ++Y SLL
Sbjct: 78  GRNIVYYDSVDSTNLRIKQMGDEGAPEGTLAVADKQTAGRGRRGRSWDSPSGSSIYMSLL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIAST--LPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L   I  D   +L+  +A+++   I          DVKIKWPNDI++  +K+ GIL E  
Sbjct: 138 LRPKIEPDQAPMLTLVMALSVAEGIMDCGDSCGNPDVKIKWPNDIIINGKKLVGILTEMS 197

Query: 130 NLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
              + +  V +G+G+NV              +     G  +    + + + +   +   +
Sbjct: 198 TQIDYINHVTIGVGINVNLTEFPEEIRETATSLRLECGHVVKRAPLIAAVMKRFEQNYTI 257

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + +      +   +          + I  +        +G++  G L++ ++ G    ++
Sbjct: 258 FLEHGDLSGLKERYSELLVNKDREVRILGAKEQYNAYALGINQTGELIVRKEDGTEEAVY 317

Query: 247 TGDI 250
            G++
Sbjct: 318 AGEV 321


>gi|326389755|ref|ZP_08211320.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994237|gb|EGD52664.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 326

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/234 (26%), Positives = 108/234 (46%), Gaps = 8/234 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSISKD 79
            I STN+   + A S       I+A  QTAGRGR    WIS K   ++ S++L  +I   
Sbjct: 88  VIDSTNNFAKEIA-SNVPDGTVIIAEEQTAGRGRLGRSWISQKGCGIWMSIILKPNIQPK 146

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+   A+++   I        + KIKWPNDI++  +K+ GIL E  +  + +  V+
Sbjct: 147 EAINLTQLAAISVVKAIEEVF--HVESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVI 204

Query: 140 VGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV            +          +D K + + +  ++    + + +      I
Sbjct: 205 IGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQKGFEY-I 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 264 RPICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|295093041|emb|CBK82132.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Coprococcus
           sp. ART55/1]
          Length = 326

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 106/254 (41%), Gaps = 8/254 (3%)

Query: 3   SNLSECQNP--YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
            N+S   N   ++ +  ++D   STN        +  +     VA+ QTAG+GRR + W 
Sbjct: 66  ENISRHLNTKTFARKLYYYDETDSTNTRAKIVGETDPVHGALFVANEQTAGKGRRGHSWN 125

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           SDK   +  S LL   I    ++ ++   AVA+              +IKWPND+L   +
Sbjct: 126 SDKGTTISMSYLLKPDIDISCVSRITLVSAVALARAFGKVEG--VKPQIKWPNDVLSDGK 183

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           K+ GIL E  +    +  VVVGIG+NV              + L   G   D     + +
Sbjct: 184 KLVGILTEMSSEGTDISYVVVGIGINVYNQSFPEDIADKATSILLENGRGCDRSWFIAQV 243

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  ++ D +  +     +++ +  +       + +           +G+   G LL+ 
Sbjct: 244 SNEFEKLYDEFVINKDLGFLVDEYNSYLVNKDKQVYVIEGDQKTEYTALGLSPDGGLLVR 303

Query: 237 EKKGCVRQIFTGDI 250
           +  G VR I +G++
Sbjct: 304 DADGAVRDIISGEV 317


>gi|229183831|ref|ZP_04311048.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus BGSC
           6E1]
 gi|228599680|gb|EEK57283.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus BGSC
           6E1]
          Length = 290

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT+GRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|319407253|emb|CBI80892.1| birA bifunctional protein [Bartonella sp. 1-1C]
          Length = 267

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 133/254 (52%), Gaps = 4/254 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MVYVLSDFAQKQGYDIESYESVDSTNLVAQQKAHSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M   +   +         + +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIHQTAAQLSFVAGVSMLEAVKQFIKNEKQPNDIISLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L     A+V+GIG+NV++   D PYP +S++  G  ID + +F+ L
Sbjct: 121 KGAKSCGILLELFKLTPLKYALVIGIGMNVEYHYEDAPYPTSSIRNIGLNIDKEQLFTAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            Q  A    LWK+  G + I   W  +   +G  IT+      I G F G+D     +++
Sbjct: 181 TQYFAENYLLWKQPCGCDIIRKKWLLYCSHLGQHITVNSDERIIEGIFDGLDCDFNCIVQ 240

Query: 237 EKKGCVRQIFTGDI 250
           +K G    I +GD+
Sbjct: 241 QKNGQRAIITSGDV 254


>gi|196046596|ref|ZP_03113820.1| birA bifunctional protein [Bacillus cereus 03BB108]
 gi|196022529|gb|EDX61212.1| birA bifunctional protein [Bacillus cereus 03BB108]
          Length = 326

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT+GRGR   KW S K   ++ S++
Sbjct: 83  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGPGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 201 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  I  +     I G   G+ + G LLLE+ +G V  I 
Sbjct: 261 YLQNG-FSVIKILWESYAVSIGKEINARTMREMITGVAKGITEDGVLLLEDHEGKVHHIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|307266004|ref|ZP_07547551.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918966|gb|EFN49193.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 326

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/234 (26%), Positives = 108/234 (46%), Gaps = 8/234 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSISKD 79
            I STN+   + A S       I+A  QTAGRGR    WIS K   ++ S++L  +I   
Sbjct: 88  VIDSTNNFAKEIA-SNVPDGTVIIAEEQTAGRGRLGRSWISQKGCGIWMSIILKPNIQPK 146

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+   A+++   I        + KIKWPNDI++  +K+ GIL E  +  + +  V+
Sbjct: 147 EAINLTQLAAISVVKAIEEVF--HVESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVI 204

Query: 140 VGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV            +          +D K + + +  ++    + + +      I
Sbjct: 205 IGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQKGFEY-I 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 264 RPICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|229172274|ref|ZP_04299838.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus MM3]
 gi|228611262|gb|EEK68520.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus MM3]
          Length = 290

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT GRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTTGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +               ++   +F  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGEPIVRAELMQQIFLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|323141553|ref|ZP_08076438.1| biotin--[acetyl-CoA-carboxylase] ligase [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413965|gb|EFY04799.1| biotin--[acetyl-CoA-carboxylase] ligase [Phascolarctobacterium sp.
           YIT 12067]
          Length = 335

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/253 (23%), Positives = 105/253 (41%), Gaps = 10/253 (3%)

Query: 5   LSECQNPY-SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
           LS  Q  +      + D++ S+N+     A  G    L +VA  Q AG+GR    WIS  
Sbjct: 73  LSRLQTKWLGRNICYRDSVDSSNNLAKALANEGCENGLLVVAEEQGAGKGRLSRGWISPY 132

Query: 64  -GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
              ++ S++L         +  +   AVA+   I           IKWPND+L+  RK+ 
Sbjct: 133 AKGIWFSVVLKPPFLPQEASKCTLLAAVAVVKSINKIAG--VHAAIKWPNDVLLLGRKLV 190

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLF 177
           GIL E       +  VV+G G+N    P D P  V  L               ++   + 
Sbjct: 191 GILTEMNAEFGHINYVVIGTGINTNASPEDYPEEVRDLAVSVADAATEPFTRVELLCDIL 250

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
           +++  + +      G   + + WR ++C +G  + +     +  G    +D+ G L++  
Sbjct: 251 KNMEDLYET-AVQDGFGPVFDEWRRYSCTLGQEVKVIAPDMTYFGTAEDIDEEGLLIVRR 309

Query: 238 KKGCVRQIFTGDI 250
           + G   ++  GD+
Sbjct: 310 EDGSKEKVVAGDV 322


>gi|269792423|ref|YP_003317327.1| biotin/acetyl-CoA-carboxylase ligase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100058|gb|ACZ19045.1| biotin/acetyl-CoA-carboxylase ligase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 336

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 107/246 (43%), Gaps = 14/246 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P       F+ I ST +     A  G    +  VA  QT GRGRRD +W S +G LYAS+
Sbjct: 87  PLGHPILHFERIESTQNPVKDLAQKGHPEGVTAVADRQTMGRGRRDRRWESPEGGLYASV 146

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL   I    + +++ A A+AM   I +       V IKWPND+LV  RK+ G+L E   
Sbjct: 147 LLRPPILPGHVQMVNLACAMAMGDAIEARCG--IKVDIKWPNDLLVGGRKLCGMLSEGAV 204

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG------GCIDLKDIFSLLFQDVARVL 184
             + +  +V GIG+N+K  P     P                 DL   F    +    +L
Sbjct: 205 EADRVHHIVAGIGVNIKGSPTIQDSPQDVTSIAEEGGTLVARHDLLAFFLRSLKHHIGIL 264

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                   R+  +N +R     +G  I +    G++ G    V+D G LL+    G +R 
Sbjct: 265 -----CEDRKAFINSYRGRCSTLGRRIVVSSDSGTLEGVAEDVEDEGSLLIRTSTGLLR- 318

Query: 245 IFTGDI 250
              GD+
Sbjct: 319 FSAGDV 324


>gi|229029318|ref|ZP_04185406.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1271]
 gi|228731977|gb|EEL82871.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1271]
          Length = 290

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 112/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QT+GRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I+G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSVIKILWESYAVSIGKEITARTMRETIIGVAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|77919567|ref|YP_357382.1| biotin-(acetyl-CoA carboxylase) holoenzyme synthetase and biotin
           operon repressor [Pelobacter carbinolicus DSM 2380]
 gi|77545650|gb|ABA89212.1| biotin-(acetyl-CoA carboxylase) holoenzyme synthetase and biotin
           operon repressor [Pelobacter carbinolicus DSM 2380]
          Length = 327

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 110/240 (45%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
             ++    STN    +   +G      ++A  Q AGRGR   +W S  G NLYAS+LL  
Sbjct: 87  VIYYAETDSTNLCAHELGKAGAPEGSVVLADSQIAGRGRLGRRWCSPPGVNLYASVLLRP 146

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            ++    + L+F  A A+   +A T        +KWPND+LV  RKIAG+L E       
Sbjct: 147 PVAPRYASQLTFLSAAAVARTVAETG--NLAATVKWPNDVLVGGRKIAGLLNELDAETEQ 204

Query: 135 LQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +V+GIG+N+       P D  YP TS+  E G    +  F          L      
Sbjct: 205 IHYLVLGIGVNLNMRTEQFPEDLRYPATSMMLECGRKVSRLDFVRCLLRHLDHLYALYLS 264

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   ++ +W+ +   +G  + + L    I+G+  G+D  G LLL+   G   ++  GD+
Sbjct: 265 EGFPPVLAVWQQYFDLVGRSVEVDLQDRRIIGKVAGLDSDGALLLDLTDGTRERVLAGDV 324


>gi|167745538|ref|ZP_02417665.1| hypothetical protein ANACAC_00229 [Anaerostipes caccae DSM 14662]
 gi|167655259|gb|EDR99388.1| hypothetical protein ANACAC_00229 [Anaerostipes caccae DSM 14662]
          Length = 327

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 107/242 (44%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLL 71
               +   T+ STN E  + A +G      + A  QT+G+GRR   W+S     ++ S +
Sbjct: 78  GKTVKVMKTVDSTNLEARRLAEAGASHGTLVTAEEQTSGKGRRGRSWVSVPGQGVWMSFV 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +  ++ ++L+   A+A+   I        D KIKWPND+L+  +K+ GIL E    
Sbjct: 138 LRPDVELENSSMLTLVAALAVEKGIKDAAG--IDGKIKWPNDVLINGKKVCGILTELSAQ 195

Query: 132 KNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + L  +VVGIG+N               +     G   D   +   + +      +++K
Sbjct: 196 MDELNYIVVGIGINANIEQFPEEVRDKATSLFLETGKPADRIALLCRVLEHFEHDYEIFK 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      +M  +  F    G  I +       + +  G++  G L++E+  G  R+IF+G
Sbjct: 256 KTQDFSMLMEEYNSFLAHRGQEIKVMRGNDEYMCKSGGINRRGELIVEDSLGRTREIFSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|134298046|ref|YP_001111542.1| biotin--acetyl-CoA-carboxylase ligase [Desulfotomaculum reducens
           MI-1]
 gi|134050746|gb|ABO48717.1| biotin--acetyl-CoA-carboxylase ligase [Desulfotomaculum reducens
           MI-1]
          Length = 333

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLL 71
                ++ T +STN+     A  G      I+   Q+ GRGR    W    +  L  S++
Sbjct: 87  GQTVRYYKTTTSTNEVAKDLARQGITEGAIIITEEQSKGRGRLGRTWQCPPRTGLCFSVV 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L    +   +   +   AVA+   +     +G   ++KWPND+ +   KI GIL E    
Sbjct: 147 LFPRANPMEVPQFTMLAAVAVVKAL--YRTLGLRAQVKWPNDVYIEGLKICGILAEMAAE 204

Query: 132 KNGLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + ++ VV+GIGLNV               +   + G  +    I  +L +++  +  LW
Sbjct: 205 ADRVKYVVLGIGLNVNQSKEDLVCFGNTATSLRVQLGRTLLRSQILKVLLEELDNLYTLW 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++     +  LWR  A  IG+ + +     +  G   G+DD G LLL    G ++  ++
Sbjct: 265 QQEGFL-PLKGLWRDNALWIGNKVQVSGLNSNYQGTMEGIDDGGALLLRLYDGTIKTFYS 323

Query: 248 GDI 250
           G++
Sbjct: 324 GEV 326


>gi|316939233|gb|ADU73267.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium thermocellum DSM
           1313]
          Length = 338

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 106/251 (42%), Gaps = 16/251 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                 F  I STN+     A  G      ++A  QT GRGR    W S     ++ S++
Sbjct: 82  GQNIHCFSEIDSTNNYAKTLAQKGCDDGTVVLAEHQTQGRGRLGRSWDSMGGKGIWMSIV 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++  + + +++ A AVA+       +    D  IKWPNDI++  +K+ GIL E    
Sbjct: 142 LRPAVGLEDVQIITLAAAVAVVLAFKKVMG--IDAGIKWPNDIVLDGKKVCGILTEMSME 199

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ------------REGGCIDLKDIFSLLFQD 179
              +  +++GIG+N  H   + P  +                 +        +   +  +
Sbjct: 200 MERINFLILGIGINFSHEESEFPEEIRDRATSLGIYLKEKKGMDISRFKRSHLIRAILSE 259

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +  V D+   +     I+  W+ ++  +G  + IK       G    VD  G L++++  
Sbjct: 260 LEEVYDM-INEGKAGVIVEEWKKYSVTLGKEVVIKYREEQYTGIAQDVDQSGRLIVKQDD 318

Query: 240 GCVRQIFTGDI 250
           G VR+I +G++
Sbjct: 319 GTVREILSGEV 329


>gi|323489709|ref|ZP_08094936.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Planococcus donghaensis MPA1U2]
 gi|323396840|gb|EGA89659.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Planococcus donghaensis MPA1U2]
          Length = 328

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 105/243 (43%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
               E+ ++ +ST     + A  G      ++   QTAGRGR   KW S  K  ++ S++
Sbjct: 83  GQEIEYVESCASTQIIAHQLAQEGAPDGTVVLTETQTAGRGRMARKWDSAAKKGVWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +++       +   AVA+   I          KIKWPNDIL+  +K  GIL E  + 
Sbjct: 143 LRPNVAPQKAPQFTLVTAVAIVRAIEEVTK--LQPKIKWPNDILLNGKKCTGILTELQSD 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL----QREGGCIDLKDIFSLLFQDVARVLDLW 187
            +G+QA+++GIGLNV     D    V  +    +   G    +            +    
Sbjct: 201 ADGIQALIIGIGLNVNQEQEDFDPEVQDIATSLKMTSGETVNRQKLVQSVLFYMELYTQM 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D G   +  LW  ++  IG  +  +++  ++ G   G+ D G L L    G +  I++
Sbjct: 261 YIDEGFGMLKILWESYSTTIGHPVRARMTNHTLEGIAEGITDEGVLQLRTSDGKLHGIYS 320

Query: 248 GDI 250
            DI
Sbjct: 321 ADI 323


>gi|125975068|ref|YP_001038978.1| biotin--acetyl-CoA-carboxylase ligase [Clostridium thermocellum
           ATCC 27405]
 gi|281418515|ref|ZP_06249534.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium thermocellum
           JW20]
 gi|125715293|gb|ABN53785.1| biotin--acetyl-CoA-carboxylase ligase [Clostridium thermocellum
           ATCC 27405]
 gi|281407599|gb|EFB37858.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium thermocellum
           JW20]
          Length = 338

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 106/251 (42%), Gaps = 16/251 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                 F  I STN+     A  G      ++A  QT GRGR    W S     ++ S++
Sbjct: 82  GQNIHCFSEIDSTNNYAKTLAQKGCDDGTVVLAEHQTQGRGRLGRSWDSMGGKGIWMSIV 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++  + + +++ A AVA+       +    D  IKWPNDI++  +K+ GIL E    
Sbjct: 142 LRPAVGLEDVQIITLAAAVAVVLAFKKVMG--IDAGIKWPNDIVLDGKKVCGILTEMSME 199

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ------------REGGCIDLKDIFSLLFQD 179
              +  +++GIG+N  H   + P  +                 +        +   +  +
Sbjct: 200 MERINFLILGIGINFSHEESEFPEEIRDRATSLGIYLKEKKGMDISRFKRSHLIRAILSE 259

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +  V D+   +     I+  W+ ++  +G  + IK       G    VD  G L++++  
Sbjct: 260 LEEVYDM-INEGKAGVIVEEWKKYSVTLGKEVVIKYREEQYTGIAQDVDQSGRLIVKQDD 318

Query: 240 GCVRQIFTGDI 250
           G VR+I +G++
Sbjct: 319 GTVREILSGEV 329


>gi|75676064|ref|YP_318485.1| biotin--protein ligase [Nitrobacter winogradskyi Nb-255]
 gi|74420934|gb|ABA05133.1| Biotin--acetyl-CoA-carboxylase ligase [Nitrobacter winogradskyi
           Nb-255]
          Length = 270

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 123/248 (49%), Gaps = 9/248 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD I STN E + RA +G+ G +W+VA+ QTAG GRR   WIS +GNL  S+L 
Sbjct: 13  GYRLAVFDRIGSTNAEALARARAGETGPIWLVAAEQTAGHGRRQRSWISPRGNLACSVLE 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSV---------IASTLPVGTDVKIKWPNDILVFQRKIAG 123
           +   S      LSFA  +A+ +          + S         +KWPND+L    K+AG
Sbjct: 73  VIDTSPAVAATLSFAAGLALEAALRTVSLEARMRSPGSENVTFHLKWPNDVLAGGGKLAG 132

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           +L+E   +     AVVVG G NV   P   PYP  SL+  G  I  +D+F  L    A  
Sbjct: 133 VLLEAETVAPDRLAVVVGTGANVAAAPEGMPYPAASLRDIGIDIGAEDLFGALTDAWAEF 192

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
             +W K  G  EI  LW   A G+G  ++I+    +I G F  +D  G L++    G   
Sbjct: 193 RIVWDKGRGFGEIRRLWLERAAGVGQHVSIRSDSSTISGLFDTIDKDGCLIVVTSDGRRV 252

Query: 244 QIFTGDIF 251
            +  GD++
Sbjct: 253 AVSAGDVY 260


>gi|317472898|ref|ZP_07932204.1| biotin-[acetyl-CoA-carboxylase] ligase [Anaerostipes sp. 3_2_56FAA]
 gi|316899618|gb|EFV21626.1| biotin-[acetyl-CoA-carboxylase] ligase [Anaerostipes sp. 3_2_56FAA]
          Length = 327

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 107/242 (44%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLL 71
               +   T+ STN E  + A +G      + A  QT+G+GRR   W+S     ++ S +
Sbjct: 78  GKTVKVMKTVDSTNLEARRLAEAGASHGTLVTAEEQTSGKGRRGRSWVSVPGQGVWMSFV 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +  ++ ++L+   A+A+   I        D KIKWPND+L+  +K+ GIL E    
Sbjct: 138 LRPDVELENSSMLTLVAALAVEKGIKDAAG--IDGKIKWPNDVLINGKKVCGILTELSAQ 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
            + L  +VVGIG+N             +       G   D   +   + +      +++K
Sbjct: 196 MDELNYIVVGIGINANIEQFPEEVRDKATSLLLETGKPADRIALLCRVLEHFEHDYEIFK 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      +M  +  F    G  I +       + +  G++  G L++E+  G  R+IF+G
Sbjct: 256 KTQDFSMLMEEYNSFLAHRGQEIKVMRGNDEYMCKSGGINRRGELIVEDSLGRTREIFSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|228907269|ref|ZP_04071129.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 200]
 gi|228852409|gb|EEM97203.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 200]
          Length = 290

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 73/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +T+ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 47  GRTVYFEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++  VI      G  V IKWPNDIL+  +K  GIL E    
Sbjct: 107 LRPSIPVHHAPQLTLLAAVSVAQVIEK--CTGVGVGIKWPNDILIQGKKAVGILTEMQAD 164

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   ++  + ++ + 
Sbjct: 165 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEE 224

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I 
Sbjct: 225 YLQNG-FSGIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIH 283

Query: 247 TGDI 250
           + DI
Sbjct: 284 SADI 287


>gi|331003018|ref|ZP_08326530.1| hypothetical protein HMPREF0491_01392 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413062|gb|EGG92437.1| hypothetical protein HMPREF0491_01392 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 327

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 104/239 (43%), Gaps = 8/239 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             + D + STN      A + +     +V+  QT G+GR    W S     ++ SL +  
Sbjct: 84  IIYMDEVDSTNTYAKSIADNLNKD-FLVVSDMQTFGKGRLGRIWDSPSSTGIFMSLCIKP 142

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I+ +  ++++  +A+++   I           IKWPNDI++  +KI+GIL E  +  +G
Sbjct: 143 DIAIEKASMITLVMALSLCDAIEELY--SLHPTIKWPNDIVINSKKISGILTEMSSDMDG 200

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLWKKDT 191
           ++ ++ G+G+NV +          +          +    + + +        +++ K  
Sbjct: 201 IKYIISGVGINVNNKEFPADIKDMASSLFLETDIIMHRAKLIASVISHFYNNFNIFLKTE 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              ++   +      IG  + I    G      +G+D+ G L++    G +++I +G++
Sbjct: 261 DMTDLKEKYEKHLANIGKEVKILDPKGEYQAVALGIDENGALIV-NSTGKIKRIISGEV 318


>gi|297545155|ref|YP_003677457.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842930|gb|ADH61446.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 326

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y    TI STN+   + A S       I+A  Q+AGRGR    W+S K   ++ S++
Sbjct: 80  GKNYIHKLTIDSTNNFAKEIA-SKVPDGTVIIAEEQSAGRGRLGRSWLSQKGCGIWMSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   A+++   I        + KIKWPNDI+V  +K+ GIL E  + 
Sbjct: 139 LKPNIQPQEAINLTQVAAISVVKAIEELS--HVENKIKWPNDIIVNNKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+GIG+NV            +          +D K + + +  ++    + + 
Sbjct: 197 IDKINYVVIGIGVNVNCYNFPEELKGKATSLNLETNSKVDRKKLTASILNNLEFYYNTYL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      I  +    +  IG  I +  + G + G+ V +D  G L++E K+G    I +G
Sbjct: 257 QKGFEY-IRPICIAKSITIGREIKVIYNEGEMEGKAVTIDSNGSLIVETKEGKRLSIMSG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|229096128|ref|ZP_04227101.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-29]
 gi|228687088|gb|EEL40993.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-29]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 112/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K+ GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKVVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDKEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|229115084|ref|ZP_04244494.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-3]
 gi|228668224|gb|EEL23656.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-3]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|229102240|ref|ZP_04232949.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-28]
 gi|228681141|gb|EEL35309.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-28]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     K A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G +V IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVNVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDKEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + ++     I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I 
Sbjct: 252 YLQNG-FSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|167036997|ref|YP_001664575.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115415|ref|YP_004185574.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855831|gb|ABY94239.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928506|gb|ADV79191.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 326

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y     I STN+   + A S       I+A  Q AGRGR    WIS K   ++ S++
Sbjct: 80  GKNYIHKLVIDSTNNFAKEMA-SKVPDGTVIIAEEQIAGRGRLGRSWISQKGCGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   A+++   I        + KIKWPNDI++  +K+ GIL E  + 
Sbjct: 139 LKPNIQPQEALNLTQVAAISVVKAIEEVF--HVESKIKWPNDIILNNKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  V++GIG+NV            +          +D K + + +  ++    + + 
Sbjct: 197 IDKINYVIIGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      I  +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +G
Sbjct: 257 QKGFEY-IRPICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|240850597|ref|YP_002971997.1| biotin-protein ligase BirA [Bartonella grahamii as4aup]
 gi|240267720|gb|ACS51308.1| biotin-protein ligase BirA [Bartonella grahamii as4aup]
          Length = 269

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 87/250 (34%), Positives = 135/250 (54%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E +D++ STN    ++A +G  GNLWIVA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQEQGYTIEAYDSVDSTNLIAQRKAQTGHQGNLWIVAQEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILVFQRK 120
           NLY+SLLLID I   +   L F   +++   I   +         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLIDDIVHQTAAQLGFVAGISVAEAIKQLIKDEKQTNNIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +G+L+E L L +   A+V+GIG+NVK+   + PYP +SL+  G  I+ + +F++L +  
Sbjct: 127 SSGVLLEILKLSSQQYALVIGIGINVKYNYENAPYPTSSLKNIGLHIEAEQLFTVLTECF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G E I   W  ++  +G  + +      I G F G+D     ++++K G
Sbjct: 187 SKNYLLWKQPKGCEIIRKKWLLYSAHLGKYVKVVNDEKVIEGVFDGLDSDFNCIIKQKNG 246

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 247 QTAIITAGDV 256


>gi|163815769|ref|ZP_02207140.1| hypothetical protein COPEUT_01949 [Coprococcus eutactus ATCC 27759]
 gi|158448910|gb|EDP25905.1| hypothetical protein COPEUT_01949 [Coprococcus eutactus ATCC 27759]
          Length = 326

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/254 (24%), Positives = 107/254 (42%), Gaps = 8/254 (3%)

Query: 3   SNLSECQNP--YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
            N+S   N   ++ +  ++D   STN        +  +     VA+ QTAG+GRR + W 
Sbjct: 66  ENISRYLNTKTFARKLYYYDETDSTNTRAKIVGETDLVHGALFVANEQTAGKGRRGHSWN 125

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           SDK   +  S LL   I    ++ ++   AVA+              +IKWPND+L   +
Sbjct: 126 SDKGTTISMSYLLKPDIDISCVSRITLVSAVALARAFGKVDG--VKPQIKWPNDVLSDGK 183

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           K+ GIL E  +    +  VVVGIG+NV              + L   G   D     + +
Sbjct: 184 KLVGILTEMSSEGTDISYVVVGIGINVYNQSFPEDIADKATSILLENGRGCDRSWFIAQV 243

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  ++ D + K+     +++ +  +       + +           +G+   G LL+ 
Sbjct: 244 SNEFEKLYDEFVKNKDLGFLVDEYNSYLVNKDKQVYVIEGDQKTEYTALGLSPDGGLLVR 303

Query: 237 EKKGCVRQIFTGDI 250
           +  G VR I +G++
Sbjct: 304 DADGAVRDIISGEV 317


>gi|256750642|ref|ZP_05491528.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750482|gb|EEU63500.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 326

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y     I STN+   + A S       I+A  Q AGRGR    WIS K   ++ S++
Sbjct: 80  GKNYIHKLVIDSTNNFAKEMA-SKVPDGTVIIAEEQIAGRGRLGRSWISQKGCGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   A+++   I        + KIKWPNDI++  +K+ GIL E  + 
Sbjct: 139 LKPNIQPQEALNLTQVAAISVVKAIEEVF--HVESKIKWPNDIILNNKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  V++GIG+NV            +          +D K + + +  ++    + + 
Sbjct: 197 IDKINYVIIGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      I  +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +G
Sbjct: 257 QKGFEY-IRPICIEKSITIGRQIKVIANEGEIEGKAVNIDNNGSLVVETKEGKRLSIMSG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|153004345|ref|YP_001378670.1| biotin--acetyl-CoA-carboxylase ligase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027918|gb|ABS25686.1| biotin--acetyl-CoA-carboxylase ligase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 329

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 104/243 (42%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLL 71
                 +D + STND   + A +G      +VA  QTAGRGRR  +W+   + NLY S++
Sbjct: 85  GRELHCYDELGSTNDRAKELADAGAEHGEVVVAEAQTAGRGRRGREWVSPPRRNLYFSVV 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   ++A+          G    IKWPND+LV  +K+AGIL E    
Sbjct: 145 LRPDLPPARAAELTLVASIAVCDAARQA---GVAAGIKWPNDVLVGGKKLAGILTELAAE 201

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
            + +  VV+G+G+NV     D P  +                 +L        L+ W   
Sbjct: 202 PDRVHWVVIGVGVNVNARAEDFPEELRGDATSLLIERRRPVPRALFAAACLTGLEGWLDR 261

Query: 191 T---GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   I + WR  +  +G  + ++     I G    +D  G LL+  + G V +I  
Sbjct: 262 HAEEGFGTIRDAWRERSVTLGREVVVRTEGREIAGVAEDIDAQGALLVRGRAG-VERILA 320

Query: 248 GDI 250
           GD+
Sbjct: 321 GDV 323


>gi|222055477|ref|YP_002537839.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. FRC-32]
 gi|221564766|gb|ACM20738.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. FRC-32]
          Length = 336

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 73/244 (29%), Positives = 112/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             R    +   STN+   + A  G      ++A  Q+ G+GR    W S KG NLY S++
Sbjct: 94  GKRIICLEETDSTNNVTFRLAEEGTAEGTVVIADAQSRGKGRLGRSWASPKGVNLYCSVV 153

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S+   + + L+F   VA+   I   L       IKWPNDIL+  RKIAG+L E    
Sbjct: 154 LRPSMPPVAASQLTFLSVVAVARAIE--LSTSLKAWIKWPNDILINGRKIAGLLNEMSAE 211

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDL 186
              +  VV+GIG+N+       P D  +P +SL  E G  +D       L +++  + D+
Sbjct: 212 TEKVNFVVLGIGININMRQEQFPTDLRHPASSLYIESGAELDRNRFIRTLLKELDDLYDV 271

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + +      +   W   +   G    I     ++ G   G+DD G LLL+   G   +I 
Sbjct: 272 YLQRGY-GPVREEWLSRSQLYGRKARIDCQDRTMTGIIRGIDDMGALLLDL-DGREERIL 329

Query: 247 TGDI 250
           +GD+
Sbjct: 330 SGDV 333


>gi|182411911|ref|YP_001816977.1| biotin--acetyl-CoA-carboxylase ligase [Opitutus terrae PB90-1]
 gi|177839125|gb|ACB73377.1| biotin--acetyl-CoA-carboxylase ligase [Opitutus terrae PB90-1]
          Length = 332

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLL 72
           F     D + STNDE  ++  +G +    ++A  QT GRGR    W S+  GNLYAS   
Sbjct: 83  FPILLLDEVDSTNDEAARQLAAGRIAPFVVLAHRQTHGRGRLGRSWHSEAPGNLYASFAF 142

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              IS   +   +  + V +  +IA+         IKWPNDIL   RK  G+L E     
Sbjct: 143 RPKISPTRMGAFTLWMGVNVCELIATV--AQLAPGIKWPNDILFDGRKAGGMLTEARIDA 200

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-----DLKDIFSLLFQDVARVLDLW 187
           + ++ +V G+GLN+       P  +               D+    + L   V    D +
Sbjct: 201 DQIRDLVFGLGLNINGPVHGWPADLARRAVSLSEKTKASLDVNYFTAALIGRVLLAYDHF 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
                 +   +LW+ F    G  I +  S   I G   GVDD G LL+    G +++   
Sbjct: 261 VDGEHTKTFADLWQRFDVLRGHPIALLQSGRRIAGIAAGVDDEGSLLIRSATGRLQRFHA 320

Query: 248 GDI 250
           GD+
Sbjct: 321 GDV 323


>gi|325662827|ref|ZP_08151396.1| hypothetical protein HMPREF0490_02136 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470879|gb|EGC74108.1| hypothetical protein HMPREF0490_02136 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 327

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 111/239 (46%), Gaps = 6/239 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
            E++    STN    + A  G +     VA  Q+AG+GRR   W S +G  ++ SLLL  
Sbjct: 81  VEYYAETDSTNIRAKQAAGQGAVHGTLFVADRQSAGKGRRGRIWDSPEGTEIFMSLLLRP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
             + D   +L+  +A+A    +        +VKIKWPND+++  +KI GIL E     + 
Sbjct: 141 QFAPDKAPMLTILMAIAAAEAVR--DKTDLEVKIKWPNDLVIGGKKICGILTEMSAEIDY 198

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           +  VVVG+G+NV            +          I   ++ + + Q    + + ++K+ 
Sbjct: 199 IDYVVVGVGVNVNRKEFPEELREKATSLLLEGKVSIKRSELIAEIMQRFETLYEAFEKEQ 258

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +   +   +   G  +T+    G+  G  +G+++ G LL+E + G +  ++ G++
Sbjct: 259 SLRFVQQRYNEQSVNCGRRVTVLEPKGNWDGIALGINEAGELLVENEAGEICTVYAGEV 317


>gi|256003278|ref|ZP_05428270.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium thermocellum DSM
           2360]
 gi|255992969|gb|EEU03059.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium thermocellum DSM
           2360]
          Length = 291

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 106/251 (42%), Gaps = 16/251 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
                 F  I STN+     A  G      ++A  QT GRGR    W S     ++ S++
Sbjct: 35  GQNIHCFSEIDSTNNYAKTLAQKGCDDGTVVLAEHQTQGRGRLGRSWDSMGGKGIWMSIV 94

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++  + + +++ A AVA+       +    D  IKWPNDI++  +K+ GIL E    
Sbjct: 95  LRPAVGLEDVQIITLAAAVAVVLAFKKVMG--IDAGIKWPNDIVLDGKKVCGILTEMSME 152

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ------------REGGCIDLKDIFSLLFQD 179
              +  +++GIG+N  H   + P  +                 +        +   +  +
Sbjct: 153 MERINFLILGIGINFSHEESEFPEEIRDRATSLGIYLKEKKGMDISRFKRSHLIRAILSE 212

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +  V D+   +     I+  W+ ++  +G  + IK       G    VD  G L++++  
Sbjct: 213 LEEVYDM-INEGKAGVIVEEWKKYSVTLGKEVVIKYREEQYTGIAQDVDQSGRLIVKQDD 271

Query: 240 GCVRQIFTGDI 250
           G VR+I +G++
Sbjct: 272 GTVREILSGEV 282


>gi|317500640|ref|ZP_07958859.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089880|ref|ZP_08338773.1| hypothetical protein HMPREF1025_02356 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316897958|gb|EFV20010.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330403577|gb|EGG83135.1| hypothetical protein HMPREF1025_02356 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 332

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 98/246 (39%), Gaps = 8/246 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +    STN    +    G L     VA  QTAGRGRR   W S     ++ S+L
Sbjct: 78  GRNVVCYKVTDSTNLRIKQMGDEGALAGTLAVAEEQTAGRGRRGRSWESPAGAGIFMSVL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVG----TDVKIKWPNDILVFQRKIAGILIE 127
           L   I+ D  ++L+   A +    I            D++IKWPND++V  +K+AGIL E
Sbjct: 138 LRPKITPDKASMLTIVTACSTAKGIKKYFENEGASCPDIQIKWPNDLVVNGKKLAGILTE 197

Query: 128 TLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
                + +  V VGIG+N            +  +     G  +    + + + +      
Sbjct: 198 MSTQIDYINYVTVGIGINANTKKFPEELKDHATSLYLECGHMVKRASVIASIMKCFEEDY 257

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            L+ +      +M  +          + +    G+   + +G+D  G L++  + G    
Sbjct: 258 RLFLETEDLSGLMETYMSMLVNRDRDVLVLDPSGTYKAKALGIDKNGELIVRREDGTSEH 317

Query: 245 IFTGDI 250
           ++ G++
Sbjct: 318 VYAGEV 323


>gi|153815884|ref|ZP_01968552.1| hypothetical protein RUMTOR_02129 [Ruminococcus torques ATCC 27756]
 gi|145846703|gb|EDK23621.1| hypothetical protein RUMTOR_02129 [Ruminococcus torques ATCC 27756]
          Length = 332

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 98/246 (39%), Gaps = 8/246 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +    STN    +    G L     VA  QTAGRGRR   W S     ++ S+L
Sbjct: 78  GRNVVCYKVTDSTNLRIKQMGDEGALAGTLAVAEEQTAGRGRRGRSWESPAGAGIFMSVL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVG----TDVKIKWPNDILVFQRKIAGILIE 127
           L   I+ D  ++L+   A +    I            D++IKWPND++V  +K+AGIL E
Sbjct: 138 LRPKITPDKASMLTIVTACSTAKGIKKYFENEGASCPDIQIKWPNDLVVNGKKLAGILTE 197

Query: 128 TLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
                + +  V VGIG+N            +  +     G  +    + + + +      
Sbjct: 198 MSTQIDYINYVTVGIGINANTKKFPEELKDHATSLYLECGHMVKRASVIASIMKCFEEDY 257

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            L+ +      +M  +          + +    G+   + +G+D  G L++  + G    
Sbjct: 258 RLFLETEDLSGLMETYMSMLVNRDRDVLVLDPSGTYKAKALGIDKNGELIVRREDGTSEH 317

Query: 245 IFTGDI 250
           ++ G++
Sbjct: 318 VYAGEV 323


>gi|261406082|ref|YP_003242323.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. Y412MC10]
 gi|261282545|gb|ACX64516.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. Y412MC10]
          Length = 329

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 54/245 (22%), Positives = 108/245 (44%), Gaps = 9/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +    +  D  +ST ++  + A  G      +++  QT GRGR   K+ S +   ++ SL
Sbjct: 83  FGKSIKLLDKTTSTQEDARQLAEEGAAEGTLVISEEQTGGRGRMGRKFHSPRGKGIWMSL 142

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L           L+    VA+   IA     G    IKWPNDIL   +K+ GIL+E+  
Sbjct: 143 VLRPKQPLHLTQQLTLLTGVAVCRAIAK--SAGVQTDIKWPNDILYQGKKVCGILLESAT 200

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-----GCIDLKDIFSLLFQDVARVLD 185
               ++  + GIG++      D P  + ++           ++   +   +  ++  + +
Sbjct: 201 EDERVRYCIAGIGISANLKEADFPEELRNVATSIRIAGGKTVNRTSLIQSIMSEMEVLYE 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L+ +    E + +LW   +  +G  + ++ +     G   G++  G LL+  + G +  +
Sbjct: 261 LYNEQG-FEPVASLWEALSGTVGREVQVQTARDRFSGIATGLNQDGALLVRNQHGELVPV 319

Query: 246 FTGDI 250
           ++GDI
Sbjct: 320 YSGDI 324


>gi|163868359|ref|YP_001609568.1| birA bifunctional protein [Bartonella tribocorum CIP 105476]
 gi|161018015|emb|CAK01573.1| birA bifunctional protein [Bartonella tribocorum CIP 105476]
          Length = 269

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 89/250 (35%), Positives = 135/250 (54%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++++ STN    ++A +G  G LWIVA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQKQGYTVESYESVDSTNLIAQRKAQTGHQGYLWIVAQEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILVFQRK 120
           NLY+SLLLID I   +   L F   V++   I   +         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLIDDIVHQTAAQLGFVAGVSVAEAIKQFIKDEKQSNNIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +G+L+E L L +   A+V+GIG+NVK+   D PYP +SLQ  G  ++ + +F++L +  
Sbjct: 127 SSGVLLEILQLPSQQYALVIGIGINVKYNYEDAPYPTSSLQNIGLHVEAEQLFTVLTESF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           +R   LWK+  G E I N W  ++  +G  + +      I G F G+D     ++++K G
Sbjct: 187 SRNYLLWKQPKGCEIIRNKWLLYSAHLGKHVKVVNDEKIIEGIFDGLDCDFNCIIKQKNG 246

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 247 QTAIITAGDV 256


>gi|21672894|ref|NP_660959.1| BirA bifunctional protein [Chlorobium tepidum TLS]
 gi|21645947|gb|AAM71301.1| birA bifunctional protein [Chlorobium tepidum TLS]
          Length = 333

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 99/242 (40%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +   + + ++I STN      A  G +    +VA  QT GRGR    W+S  G NLY S+
Sbjct: 80  FGRNFIYLESIDSTNLRARASAREGAVEGTVVVADSQTEGRGRMRRAWVSPAGVNLYCSI 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  +    A A+   +    P G    IKWPNDI+   RK+ GIL E  +
Sbjct: 140 VLRPPVPSIRVPEIPLVAAAAIHEAVTQECP-GLAAFIKWPNDIITGGRKLCGILCEMES 198

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLW 187
             +    VVVG GLNV   PV       +          +    + + +     ++   W
Sbjct: 199 EPDCTHFVVVGFGLNVNLDPVPEELRKIATSIAIETGLRMSRARLLAAVLNRFEQLYRDW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +      I+      +   G  + I+     + G   G+   G+LLL    G +  + +
Sbjct: 259 LEKENLAFILPYLEAHSWLKGRELKIEQFNTVLTGTEAGLSPQGHLLLRTVDGALLSVTS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|115524544|ref|YP_781455.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisA53]
 gi|115518491|gb|ABJ06475.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisA53]
          Length = 270

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 9/245 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +FD + STN E M +A  G+ G +W V   QTAGRGRR   WI+ +GNL +SLL + 
Sbjct: 15  RLAYFDRLGSTNAEAMAQARGGETGPIWFVTLEQTAGRGRRQRPWIAPRGNLASSLLEVL 74

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPV---------GTDVKIKWPNDILVFQRKIAGIL 125
            ++      L FA  +A+   + +               D ++KWPND+L   +K+AGIL
Sbjct: 75  DVAPGVAATLGFAAGLALEQALQTLTAQTATRRGIALPIDYRLKWPNDVLANGQKLAGIL 134

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +E  +  +G  AVVVGIG NV   P DTPYP TSL+  G  +  +D+F+ L         
Sbjct: 135 LEAESTADGRLAVVVGIGTNVVAAPTDTPYPATSLRALGLDVTAEDVFAALSDAWTEYRG 194

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +W +  G  EI   W   A G+G  ++I+    +I G F  +DD G L++   +G +  I
Sbjct: 195 IWDQGRGFAEIRKAWLQRAAGLGAPVSIRSGATAIEGLFDSIDDTGCLMIRTPQGRLIPI 254

Query: 246 FTGDI 250
             GD+
Sbjct: 255 AAGDV 259


>gi|291547780|emb|CBL20888.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Ruminococcus
           sp. SR1/5]
          Length = 268

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 97/243 (39%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALS-GDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
                F     STN    +     G       VA  Q+AGRGR   +W +   + +  S+
Sbjct: 20  GKTVHFARETDSTNLWGKRAWREEGAGHGELFVAEYQSAGRGRFTRRWSAPPDSAITMSI 79

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           L+    S     +L+  + +++   +A     G DV IKWPND++V ++KI GIL E   
Sbjct: 80  LICPEFSPQKAPMLTLVMGLSVAQAVAEL---GLDVWIKWPNDVVVSRKKICGILTEMTM 136

Query: 131 LKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            ++ +   V+G+G+NV              +     G   D   +  L+ +      + +
Sbjct: 137 KQDKIGCAVIGVGINVNMESFPEEMADKATSLYLESGHPFDRAQVVGLVMKHFEENYERF 196

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +      +   +      +   + +        G   G++  G LL+E   G V ++ +
Sbjct: 197 VQTEDLSGLKPDYEKMLANLNQPVRVLDQNDPYEGIARGINAGGELLVERADGTVEEVNS 256

Query: 248 GDI 250
           G++
Sbjct: 257 GEV 259


>gi|260893705|ref|YP_003239802.1| biotin/acetyl-CoA-carboxylase ligase [Ammonifex degensii KC4]
 gi|260865846|gb|ACX52952.1| biotin/acetyl-CoA-carboxylase ligase [Ammonifex degensii KC4]
          Length = 332

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 104/249 (41%), Gaps = 6/249 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           L   +  +   Y  +  + STN+   + A S       +VA  Q  G+GRR   W S  G
Sbjct: 72  LPLLRGKWGRPYYHYPQLQSTNETLKQMAASL-PEGAVVVAEEQAGGKGRRGRSWHSPPG 130

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
            ++ SLLL  ++   +L  L   +++A+   ++   P   D  +KWPNDIL   +K+ G+
Sbjct: 131 GIWFSLLLRPAVHPLALLSLPLVLSLAVVKSLSGFFP-ELDWALKWPNDILCRGKKLGGV 189

Query: 125 LIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           L+E       +   V GIG+NV      P       +     G       + + + +   
Sbjct: 190 LVEVAAETEQVHWAVAGIGINVNISSFPPELEGRATSLELCRGKKSCRPCLLAAILERAE 249

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            +  LW    G   +   ++      G  + ++       G+  GVDD G L+L    G 
Sbjct: 250 ELYSLW-CREGFAPLAKDYQALFLYRGRRVRVEEEGRFWEGKAEGVDDKGRLVLRLDDGS 308

Query: 242 VRQIFTGDI 250
           +R +  G++
Sbjct: 309 LRLLLGGEV 317


>gi|319898896|ref|YP_004158989.1| birA bifunctional protein [Bartonella clarridgeiae 73]
 gi|319402860|emb|CBI76411.1| birA bifunctional protein [Bartonella clarridgeiae 73]
          Length = 267

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 133/254 (52%), Gaps = 4/254 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A +G  G LWIVA+ QT GR RR   W 
Sbjct: 1   MVYVLSDFAQKQGYDIEAYESVDSTNLVAQQKAHAGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVK----IKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M   I   +     +     +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIHQTAAQLSFVAGVSMVEAIKQFIKNEKQINNLVSLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L +   A+V+GIG+NV+H   D PYP +S++  G  +D K +F++L
Sbjct: 121 KGAKSCGILLELFKLTSQKYALVIGIGMNVEHHYEDAPYPTSSIKNIGLNVDRKQLFTVL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            Q  A    LWK+  G + I   W  +   +G  I +      I G F G+D     +++
Sbjct: 181 TQYFAENYLLWKQSNGCDIISKKWLLYCSHVGQHIKVINDKRIIEGTFDGLDCNFNCIVK 240

Query: 237 EKKGCVRQIFTGDI 250
           +  G    I +GD+
Sbjct: 241 QTNGQQTIITSGDV 254


>gi|225569861|ref|ZP_03778886.1| hypothetical protein CLOHYLEM_05955 [Clostridium hylemonae DSM
           15053]
 gi|225161331|gb|EEG73950.1| hypothetical protein CLOHYLEM_05955 [Clostridium hylemonae DSM
           15053]
          Length = 326

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 61/253 (24%), Positives = 101/253 (39%), Gaps = 7/253 (2%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
             +L   +        +     STN +       G       VA  QTAG+GRR   W S
Sbjct: 68  LESLIRTRW-AGRPVVYASETDSTNIQAKALGEKGASHGTLFVADRQTAGKGRRGRSWES 126

Query: 62  DK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
               ++Y ++LL          +L+  +A+++   I  T   G   +IKWPNDI+V ++K
Sbjct: 127 PAGTSIYMTVLLRPGFLPSRAPMLTLVMALSVAEGI--TGETGLLAQIKWPNDIVVNRKK 184

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCIDLKDIFSLL-F 177
           + GIL E     + +  VV G G+NV     P +     TSL  EGG    +   +    
Sbjct: 185 VCGILTEMSAEVDYINYVVTGAGINVNTECFPREIAGTATSLYIEGGARVRRAKLAARIM 244

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
           +      + +        + + +       G  + I            G++D G L++  
Sbjct: 245 ERYEENYETFLAAEDLSGLKSAYNRLLVNRGKEVRILEPGNEYEAVASGINDTGELIVTA 304

Query: 238 KKGCVRQIFTGDI 250
           + G  R IF G++
Sbjct: 305 RDGSRRAIFAGEV 317


>gi|322419426|ref|YP_004198649.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M18]
 gi|320125813|gb|ADW13373.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M18]
          Length = 327

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                      STN    K A  G      ++A  QTAG+GR    W+S  G NLY S++
Sbjct: 83  GTSIVCLKETESTNQVAFKMAEEGAAEGTVVIADAQTAGKGRLGRIWLSPAGVNLYCSVV 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I+  +   L+F   VA+   I          +IKWPNDIL+  +K+AG+L E    
Sbjct: 143 LRPAIAPMAACQLTFLSVVAVARAIQ--GCTTLQPQIKWPNDILINGKKVAGLLNEMNAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL------QREGGCIDLKDIFSLLFQDVARVLD 185
              +  VV+GIG+N+          +         +  G  +D       L  ++ R+ D
Sbjct: 201 TEKVNFVVLGIGVNLNLKMSSISESLLRHPATSLLEEGGVEVDRLAFTRSLLIELDRLYD 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           ++ ++     +   W   +   G  + +        G   GVD FG LL++   G V  +
Sbjct: 261 VFLREGE-GPVRAEWLERSAIQGRSVKVSQGEREFTGVVQGVDSFGALLVQLSDGKVETV 319

Query: 246 FTGDI 250
            +GD+
Sbjct: 320 LSGDV 324


>gi|229016894|ref|ZP_04173822.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1273]
 gi|229023100|ref|ZP_04179614.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1272]
 gi|228738246|gb|EEL88728.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1272]
 gi|228744455|gb|EEL94529.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1273]
          Length = 317

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                F +++ ST     + A  G      +VA  QTAGRGR   KW S K   ++ S++
Sbjct: 74  GRTVYFEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSII 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI       L+   AV++   I      G DV IKWPNDIL+  +K  GIL E    
Sbjct: 134 LRPSIPVHHAPQLTLLAAVSVAQAIEK--CTGVDVGIKWPNDILIQGKKAVGILTEMQAD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDL 186
            + + AV++GIG+N           +  +        G  I   ++   +F  + ++ + 
Sbjct: 192 PDKINAVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW  +A  IG  IT +    +I G   G+ + G L+LE+ +G V  I 
Sbjct: 252 YLKNG-FSVIKILWESYAISIGKEITARTMKQTINGLAKGITEDGVLMLEDHQGHVHHIH 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|20808369|ref|NP_623540.1| biotin-(acetyl-CoA carboxylase) ligase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516980|gb|AAM25144.1| Biotin-(acetyl-CoA carboxylase) ligase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 326

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
              Y   +++SSTND   + A         IVA  QT GRGR    W S+K   +  S++
Sbjct: 80  GRNYIHKESLSSTNDMAKELAYK-VPDGTVIVAEEQTKGRGRMGRSWFSEKSSCILTSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I  +    L+   A+ +   I          KIKWPNDI++  +K+ GIL E  + 
Sbjct: 139 LKPQIRPEKTVALTQVAALTVVKAIEEVC--SVKTKIKWPNDIILNSKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  +V+GIG+NV            +   +      +D K + + L  ++      ++
Sbjct: 197 IDVVNYIVIGIGINVNCTEFPDDLKEKATSLQLELEKPVDRKKLLASLLNNLEIYYKEYE 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +    E +  L    +  IG  + +  +   I G+ + +D  G L+++ +KG    + +G
Sbjct: 257 EKG-FESLRPLILENSITIGKEVRVIYTDREIRGQAIAIDKEGKLVIKTEKGEEIALLSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|189501364|ref|YP_001960834.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium phaeobacteroides
           BS1]
 gi|189496805|gb|ACE05353.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium phaeobacteroides
           BS1]
          Length = 329

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 105/242 (43%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     F + + STN +    A  G      +VA CQT GRGR   +W+S    NLY SL
Sbjct: 80  FGRNLLFHEKVDSTNMQAKILARQGASEGSVLVADCQTGGRGRMGREWVSPPGANLYFSL 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    L+ +    A A+   +  T+  G    IKWPNDIL+  RK+ GIL E  +
Sbjct: 140 VLRPPVPPVRLSQIPLLAAAAIHQALDRTVE-GVSSAIKWPNDILIEGRKVCGILCEMES 198

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLW 187
             +    V+VGIG+NV    +       +       G      DI S +      + D W
Sbjct: 199 EPDMTHFVIVGIGVNVNLRDIPGEIKGIATSLFLESGSEYSRPDILSSILNSFEPLYDTW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +      ++     +A      + ++    ++ GR  G+   G L+LE + G +  I +
Sbjct: 259 LEADDLFAVLPYLERYAWLKDREVKVEQYKSTLEGRVRGLTRTGELMLESQDGSMHAISS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|52080752|ref|YP_079543.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus licheniformis ATCC 14580]
 gi|52786123|ref|YP_091952.1| hypothetical protein BLi02379 [Bacillus licheniformis ATCC 14580]
 gi|319645290|ref|ZP_07999523.1| BirA protein [Bacillus sp. BT1B_CT2]
 gi|52003963|gb|AAU23905.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus licheniformis ATCC 14580]
 gi|52348625|gb|AAU41259.1| BirA [Bacillus licheniformis ATCC 14580]
 gi|317393099|gb|EFV73893.1| BirA protein [Bacillus sp. BT1B_CT2]
          Length = 327

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                F D +SST     + A +G      IVA  QT GRGR    W S +GN ++ S++
Sbjct: 83  GQTIHFQDVVSSTQKIAHELANNGAPEGTIIVADKQTEGRGRMARAWHSPEGNGIWMSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I      G   +IKWPNDIL+  +K+ GIL E    
Sbjct: 143 LRPEIPVQKTPQLTLLAAVAIVQAIEE--QTGIAAEIKWPNDILINGKKVVGILTELQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR-----EGGCIDLKDIFSLLFQDVARVLDL 186
            + + +V+VG G+NV     D P  +           G  ID   +   +     +  + 
Sbjct: 201 ADQVHSVIVGTGINVNQLAADFPEELQETATSLRLASGEKIDRAALVQTIMSTFEKRYED 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +      E I  LW  +A  +   +T +   G+  G+ +G+D+ G L+LE   G +++I+
Sbjct: 261 YLAYG-FEPIKLLWESYALTLNRELTARTLNGTFHGKALGIDEEGVLILETSDG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|254419436|ref|ZP_05033160.1| biotin-(acetyl-CoA-carboxylase) ligase [Brevundimonas sp. BAL3]
 gi|196185613|gb|EDX80589.1| biotin-(acetyl-CoA-carboxylase) ligase [Brevundimonas sp. BAL3]
          Length = 249

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 112/241 (46%), Gaps = 7/241 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
               D I ST  E  + A +G++G  WI+A  QTAGRGRR   W+   GNL A+LL+   
Sbjct: 6   LVILDEIDSTLSEARRLAEAGEVGPKWIIARRQTAGRGRRGRSWVDKPGNLAATLLIRVH 65

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
            S       +F  A+A+  ++   +     V IKWPND+L+  RK  GIL+E+    +G 
Sbjct: 66  ASPREAAQATFIAALAVADLLDVFVSPAL-VSIKWPNDVLLDGRKACGILVESGAHASGG 124

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGGC-----IDLKDIFSLLFQDVARVLDLWKKD 190
             + VGIG+N+ H P  T     ++             ++    +L +  A     W+  
Sbjct: 125 LWLAVGIGVNLAHAPEGTEKASAAIAERLREDLAFAPPVEAAAEILAETFAVWWGRWQTM 184

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              E +++ W     G+    T +L   +I G   GV+  G L L    G VR I  GD+
Sbjct: 185 G-FEPVLDAWTSRLTGLNGPCTARLDNETIEGLAEGVEPDGALRLRLADGSVRLISAGDV 243

Query: 251 F 251
           F
Sbjct: 244 F 244


>gi|148264857|ref|YP_001231563.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter uraniireducens
           Rf4]
 gi|146398357|gb|ABQ26990.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter uraniireducens
           Rf4]
          Length = 336

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 115/244 (47%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             +   F+   STN+   K A  G      ++A  Q+ G+GR   +W S  G NLY S++
Sbjct: 94  GTKIICFNETDSTNNVAFKLAEDGAAEGTVVIADTQSRGKGRLGREWASPDGVNLYCSII 153

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  SI+  + + L+F   VA+   +  + P      IKWPNDIL+  +KIAG+L E    
Sbjct: 154 LRPSITPVAASQLTFLSVVAVARSVEQSTP--LQPWIKWPNDILINGKKIAGLLNEMSAE 211

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDL 186
              +  VV+GIG+NV       P D  +P +SL  EGG  ++  D    L  ++  + D 
Sbjct: 212 TEKVNFVVLGIGVNVNMRSEQFPADLRHPASSLFIEGGVPVNRNDFVRTLLHELDALYDS 271

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +  D     I   W   +   G  + +      + G   G+DD G LLL+   G   ++ 
Sbjct: 272 YLVDGY-GAIREEWLARSQMYGRQVRVSCQDRVMTGVVKGIDDIGALLLDL-DGREERVL 329

Query: 247 TGDI 250
           +GD+
Sbjct: 330 SGDV 333


>gi|148255899|ref|YP_001240484.1| putative biotin--(acetyl-CoA-carboxylase) synthetase
           [Bradyrhizobium sp. BTAi1]
 gi|146408072|gb|ABQ36578.1| putative Biotin--(acetyl-CoA-carboxylase) synthetase
           [Bradyrhizobium sp. BTAi1]
          Length = 269

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 122/246 (49%), Gaps = 10/246 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +    FD   STN E +  A  G     W V + QTAGRGRR   W++ +GNL +S+L +
Sbjct: 14  YGLVVFDQAGSTNIEALAAARQGARAPCWFVTTEQTAGRGRRQRPWVAPRGNLASSVLEV 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGT---------DVKIKWPNDILVFQRKIAGI 124
            +++      L FA  +A+ + +                 D  +KWPND+L   RKI G+
Sbjct: 74  LNVAPVVAATLGFAACLAIENALRQVSREAVLRSGGSSALDFAVKWPNDVLAGGRKIVGM 133

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L+E   +  GL AVV GIG NV   P DTP P  SL+  G  +  +D+FS L +      
Sbjct: 134 LLEAEQVAGGL-AVVAGIGTNVVAAPTDTPTPAVSLRDLGVEVSAEDLFSALSESWVEYF 192

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W +  G  +I  LW   A G+G  + I+  +  I G F  +D+ G +L+   +G +  
Sbjct: 193 GIWNEGRGFADIRRLWLERAAGLGQPVAIRSGHAIIEGIFDTIDEQGCMLVRTAEGRLEP 252

Query: 245 IFTGDI 250
           I  GD+
Sbjct: 253 ITAGDV 258


>gi|187780265|ref|ZP_02996738.1| hypothetical protein CLOSPO_03861 [Clostridium sporogenes ATCC
           15579]
 gi|187773890|gb|EDU37692.1| hypothetical protein CLOSPO_03861 [Clostridium sporogenes ATCC
           15579]
          Length = 327

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 112/245 (45%), Gaps = 10/245 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +      FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S+
Sbjct: 78  FGQNIIHFDSINSTNDKAKKIASS-ENDGTVIISEEQTLGKGRLGRTWSSSKFKGVYMSI 136

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   I+   +  +     VA  +VI + L       IKWPNDI+V  +K+ GIL E   
Sbjct: 137 ILKPDINTMDVPKI---TQVAAAAVITTLLNNNIKAYIKWPNDIIVNNKKVCGILTEMSG 193

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLD 185
             N +  VVVG+G+NV     D P  + S        D        + + +  +  ++  
Sbjct: 194 EINKVNYVVVGMGINVNCEEEDIPKDLISKATSLKIEDNKEFKRNILVADILNNFEKLYT 253

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              +    +  + + +  +  IG  + I       LG+ VG++  G LL++ +   ++ +
Sbjct: 254 ELIEYNNIDTSIEICKKNSILIGKEVRIINRNKERLGKAVGLNSNGELLVQFENEEIKPL 313

Query: 246 FTGDI 250
            +G+I
Sbjct: 314 ISGEI 318


>gi|291541653|emb|CBL14763.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Ruminococcus
           bromii L2-63]
          Length = 322

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 94/242 (38%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                  D + STND   K    G       VA  QT G+GR    W + K  ++  S L
Sbjct: 78  GKNLIVLDEVGSTNDYLKKLGADGCENGTVAVAREQTQGKGRLGRVWKAKKDDSITFSFL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   ++ ++    +A+   I        D +IKWPNDI++ ++K+ GIL E    
Sbjct: 138 LRPKIAPSEVSSITPLAGLAVCKAIREFTG--LDCRIKWPNDIIIGKKKLVGILTEMSAE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + ++ V+ GIG+N             +       GG  D    F+ +   +        
Sbjct: 196 FDAVEYVITGIGINADTQDFPDDIKEKATSIYLATGGHFDKNKFFACVLNHIEEEFIK-N 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                   +  +      +G  IT      S+  + VGV+  G L+ E      + I +G
Sbjct: 255 DLKLSPVALKEYTSLCATVGRDITFTKDGKSVTAKAVGVNPDGELIAELPDKTTKLINSG 314

Query: 249 DI 250
           ++
Sbjct: 315 EV 316


>gi|167646780|ref|YP_001684443.1| biotin--acetyl-CoA-carboxylase ligase [Caulobacter sp. K31]
 gi|167349210|gb|ABZ71945.1| biotin--acetyl-CoA-carboxylase ligase [Caulobacter sp. K31]
          Length = 250

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 121/238 (50%), Gaps = 4/238 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
               D I STN E  +RA +G++G +WIV   QTAGRGRR   W + +GNL A+LL    
Sbjct: 10  VVVLDEIDSTNAEARRRAEAGEVGPIWIVGLRQTAGRGRRGRAWETGEGNLAATLLFSTD 69

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                   +SF  A+A+  ++A+ +P    V +KWPND L+   K++GIL+E+     G 
Sbjct: 70  KPPAEAAQVSFVAALAVADLLAAYVPASL-VSLKWPNDPLLGGLKVSGILVESGMRSTGG 128

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREG--GCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             + VG+G+N+   P+D+  P T++            +   +L    AR  D+W +    
Sbjct: 129 LWIAVGVGVNLARKPIDSERPATAITAYRDAPPPSPIEAIEVLAAAFARWQDVWLRLG-F 187

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I + W   A G+G+    +L   ++ G   G+D  G L L    G +R+I  GD+F
Sbjct: 188 PAIADAWTARAHGLGEACVARLGTETLEGIAEGLDGDGALRLRLADGQLRRITAGDVF 245


>gi|289578944|ref|YP_003477571.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter italicus
           Ab9]
 gi|289528657|gb|ADD03009.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter italicus
           Ab9]
          Length = 326

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y    TI STN+   + A S       I+A  Q+AGRGR    W+S K   ++ S++
Sbjct: 80  GKNYIHKLTIDSTNNLAKEIA-SKVPDGTVIIAEEQSAGRGRLGRSWLSQKGCGIWMSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   A+++   I        + KIKWPNDI+V  +K+ GIL E  + 
Sbjct: 139 LKPNIQPQEAINLTQVAAISVVKAIEELS--HVENKIKWPNDIIVNNKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+GIG+NV            +          +D K + + +  ++    + + 
Sbjct: 197 IDKINYVVIGIGVNVNCYNFPEELKGKATSLNLETNSKVDRKKLTASILNNLEFYYNTYL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      I  +    +  IG  I +  + G ++G+ V +D  G L++E K+G    I +G
Sbjct: 257 QKGFEY-IRPICIAKSITIGREIKVIYNEGEMVGKAVTIDSNGSLIVETKEGKRLSIMSG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|157692743|ref|YP_001487205.1| bifunctional transcriptional
           regulator/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus pumilus SAFR-032]
 gi|157681501|gb|ABV62645.1| bifunctional transcriptional
           regulator/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus pumilus SAFR-032]
          Length = 327

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     F   ++ST          G      +V+  QT G+GR    W S     ++ SL
Sbjct: 82  FGRHIYFQKEVASTQLIAHDLVNEGAPHGTLVVSDHQTNGKGRLQRAWHSPNGTGIWMSL 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   I       ++   +VA+   I      G    IKWPNDIL+  +K+ GIL E   
Sbjct: 142 ILRPEIPLHKAPQMTLLASVAIAEAIK--DQTGLRPSIKWPNDILLNGKKVVGILTELKA 199

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLD 185
             + + AV++G G+NV     D P  + +            +D   +   +     +   
Sbjct: 200 EADQVHAVIIGPGINVNQTADDFPDELKNVATSLRMELNDKVDRAALIQQIMSTFEKRYA 259

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            + K      I  LW  +A  IG  I  +   G   G+ +G+++ G LLLE ++G +++I
Sbjct: 260 DYIKHG-FAPIKQLWESYAMTIGQHIVARTVNGQYTGKALGINEEGVLLLETEEG-IQKI 317

Query: 246 FTGDI 250
           ++ DI
Sbjct: 318 YSADI 322


>gi|307825692|ref|ZP_07655909.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacter tundripaludum
           SV96]
 gi|307733269|gb|EFO04129.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacter tundripaludum
           SV96]
          Length = 332

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 110/242 (45%), Gaps = 9/242 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
            +E  D I STN   ++R+ +  L      A  QTAG+GRR  +W+S    N+Y S+L  
Sbjct: 86  SFEIHDQIDSTNRYLVERSQNNALSGSVCFAEYQTAGKGRRGRQWVSPYGSNIYLSILWR 145

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +++ LS AI VA+   +        D+ +KWPNDI    +K+ GIL+E     +
Sbjct: 146 FQQGPAAISGLSLAIGVAVIRALKQ--HQINDIGLKWPNDIYSQGKKLGGILVEVSGETD 203

Query: 134 GLQAVVVGIGLNVKHCP-----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           G  + V+G+GLN+         +   +   S       +    +   L   +  V+  ++
Sbjct: 204 GPCSAVIGLGLNLFLPETEAESITQAWTDLSKITGQNQLFRNKLAGTLLNHLLPVIAEYE 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                +  ++ WR + C  G   T+ +      G   G+DD G LL+E   G V+   +G
Sbjct: 264 GVG-IQAYLDEWRSYDCLTGKSATLFIGQQQFEGIVRGIDDNGMLLIERPDGHVQTFASG 322

Query: 249 DI 250
           ++
Sbjct: 323 EV 324


>gi|197301326|ref|ZP_03166411.1| hypothetical protein RUMLAC_00057 [Ruminococcus lactaris ATCC
           29176]
 gi|197299644|gb|EDY34159.1| hypothetical protein RUMLAC_00057 [Ruminococcus lactaris ATCC
           29176]
          Length = 337

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/244 (20%), Positives = 105/244 (43%), Gaps = 6/244 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++D + STN    +    G +     VA  QTAGRGRR   W S    ++  S+L
Sbjct: 85  GKNIVYYDEVDSTNLRIKQLGDEGAVEGTLAVADRQTAGRGRRGRSWDSPAGESISMSIL 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIA--STLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L   I+ +   +L+  +A ++   I     +     ++IKWPNDI++  +K+ GIL E  
Sbjct: 145 LRPQITPNQAPMLTLVMACSVAEGIMDCKDVCGEQQIQIKWPNDIIIHGKKLVGILTEMS 204

Query: 130 NLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
              + +  V VG+G+NV              +     G  +    + + + + +     L
Sbjct: 205 TQIDYINHVTVGVGINVNLTDFPEEIRERATSLRLECGHKVKRAPLIAAIMKRLEENYAL 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + +     ++M  +          + I  +    +   +G++  G L++ ++ G + +++
Sbjct: 265 FMETGDLSQLMEKYSELLVNKDRDVMILGAKEQYVAHALGINKTGELIVRKEDGTIEEVY 324

Query: 247 TGDI 250
            G++
Sbjct: 325 AGEV 328


>gi|229544024|ref|ZP_04433083.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus coagulans 36D1]
 gi|229325163|gb|EEN90839.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus coagulans 36D1]
          Length = 325

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/241 (29%), Positives = 103/241 (42%), Gaps = 5/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           +    + +TI ST     +    G      ++A  QT GRGR    W S K   ++ S++
Sbjct: 83  ARNIHYRETIDSTQRLAHQLVQEGCPDGTLVIAEQQTGGRGRLRRSWYSPKYTGIWMSIV 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +        +   AVA+   I  T  +  +  IKWPND+L+  +K AGIL E    
Sbjct: 143 LRPDLPPQMAPPFTLIAAVAVAQAIEETAGIVPE--IKWPNDLLIGGKKCAGILTELEAD 200

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +QAV+ GIG+NV     P       TSL    G    + +      +     +    
Sbjct: 201 TDRIQAVITGIGINVNETDFPDPLKSIATSLSLASGKKVKRALLIQRILEKLEKYEEIYL 260

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G   +  LW  +A   G  IT     G I GR VG+ D G L LE + G +  I++ D
Sbjct: 261 QNGFAPLKILWESYANVAGKKITAHTLKGDISGRAVGITDDGVLQLEGEDGQMHAIYSAD 320

Query: 250 I 250
           I
Sbjct: 321 I 321


>gi|323703654|ref|ZP_08115296.1| biotin/acetyl-CoA-carboxylase ligase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531369|gb|EGB21266.1| biotin/acetyl-CoA-carboxylase ligase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 330

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 110/243 (45%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             +  +F    STND     A  G      +VA  QT GRGR    W S     LY S++
Sbjct: 82  GRQARYFKATGSTNDVAKDLARQGAAEGTVVVAEEQTTGRGRLGRVWQSPAQAGLYFSVI 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +S   +T ++   AVA+    A    +G   ++KWPND+ +   KI GIL E    
Sbjct: 142 LYPMVSPMEVTQVTLLAAVAVVR--ALARELGVTARVKWPNDVYLNGCKICGILAEMAAE 199

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + ++ +VVGIG+NV               +   + G  ++   I   + +++ ++  LW
Sbjct: 200 ADRVKYLVVGIGVNVNQGQEDFAALGSTASSLKLQVGYRVNRAAILRAILEELDQLYALW 259

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + +     + +LW+  A  +G  + +     +  G    +D+ G L+L    G +++ ++
Sbjct: 260 QTEG-FASLRSLWKDVALWLGYSVLVSGGQRNWQGTMEDIDESGALVLRMPDGTIKKFYS 318

Query: 248 GDI 250
           G++
Sbjct: 319 GEV 321


>gi|167039708|ref|YP_001662693.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X514]
 gi|300915043|ref|ZP_07132358.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X561]
 gi|307724965|ref|YP_003904716.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X513]
 gi|166853948|gb|ABY92357.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X514]
 gi|300888767|gb|EFK83914.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X561]
 gi|307582026|gb|ADN55425.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X513]
          Length = 326

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 107/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              Y     I STN+   + A S       I+A  Q AGRGR    WIS K   ++ S++
Sbjct: 80  GKNYIHKLVIDSTNNFAKEMA-SKVPDGTVIIAEEQIAGRGRLGRSWISQKGCGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   A+++   I        + KIKWPNDI++  +K+ GIL E  + 
Sbjct: 139 LKPNIQPQEALNLTQVAAISVVKAIEEVF--HVESKIKWPNDIILNNKKVCGILTEMSSE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  V++GIG+NV            +          +D K + + +  ++    + + 
Sbjct: 197 IDKINYVIIGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +         +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +G
Sbjct: 257 QKGFEYIG-PICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSG 315

Query: 249 DI 250
           D+
Sbjct: 316 DV 317


>gi|298506050|gb|ADI84773.1| biotin operon repressor and biotin--acetyl-CoA carboxylase ligase
           [Geobacter sulfurreducens KN400]
          Length = 338

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 102/243 (41%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 F    STN      A  G      ++A  QT G+GR   +W S  G N+Y S++
Sbjct: 94  GTHVVCFRETVSTNTVASHLAAEGAAEGTVVLADAQTGGKGRLGRRWESPPGVNVYCSII 153

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   IS      L+   AVA    I  T        IKWPNDILV   K+AG+L E    
Sbjct: 154 LRPPISPLHSPQLTLLSAVATAEAIERTSG--LVPAIKWPNDILVNGFKVAGMLNELSAE 211

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              ++ +V+GIG+N+       P D  YP +SL  E G    +  F     +    L   
Sbjct: 212 TERVEYLVLGIGVNINMERDQFPGDLRYPASSLALEAGRTVERIPFVRALLESLDRLYDE 271

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   + + W   +  +G  + +    G + G   G+D+ G LL+    G + ++  
Sbjct: 272 YLLKGFSPVRDAWLARSAVMGRRVKVDGGAGILAGTVEGIDEIGALLVRTAGGSLERVLA 331

Query: 248 GDI 250
           GD+
Sbjct: 332 GDV 334


>gi|39997033|ref|NP_952984.1| birA biofunctional protein [Geobacter sulfurreducens PCA]
 gi|39983923|gb|AAR35311.1| birA biofunctional protein, putative [Geobacter sulfurreducens PCA]
          Length = 323

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 102/243 (41%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 F    STN      A  G      ++A  QT G+GR   +W S  G N+Y S++
Sbjct: 79  GTHVVCFRETVSTNTVASHLAAEGAAEGTVVLADAQTGGKGRLGRRWESPPGVNVYCSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   IS      L+   AVA    I  T        IKWPNDILV   K+AG+L E    
Sbjct: 139 LRPPISPLHSPQLTLLSAVATAEAIERTSG--LVPAIKWPNDILVNGFKVAGMLNELSAE 196

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              ++ +V+GIG+N+       P D  YP +SL  E G    +  F     +    L   
Sbjct: 197 TERVEYLVLGIGVNINMERDQFPGDLRYPASSLALEAGRTVERIPFVRALLESLDRLYDE 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   + + W   +  +G  + +    G + G   G+D+ G LL+    G + ++  
Sbjct: 257 YLLKGFSPVRDAWLARSAVMGRRVKVDGGAGILAGTVEGIDEIGALLVRTAGGSLERVLA 316

Query: 248 GDI 250
           GD+
Sbjct: 317 GDV 319


>gi|323705110|ref|ZP_08116686.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535536|gb|EGB25311.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 326

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 111/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLL 71
              Y +FDTISSTND   + A S       IVA  QT+GRGR    W+   K  ++ S++
Sbjct: 80  GRNYLYFDTISSTNDYAKEIA-SDSPDGTTIVAEEQTSGRGRMGRLWVSYKKQGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+ +    L+   AV++   I  T        IKWPNDI+V  +K+ GIL E    
Sbjct: 139 LKPDIAPNDAVKLTQVAAVSLVDAIKETA--NLTSYIKWPNDIIVNGKKVCGILTEMNGE 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQDVARVLDLWK 188
            + +  +VVGIG+NV            +          ID K + + +  +  +    + 
Sbjct: 197 LDKINFIVVGIGVNVNVDSFPVDLQDKATSLSIEASKKIDRKLLTASILNNFEKYYRTFL 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            +     I NL + ++  +   +   ++    +GR + +D+ G L++  K G  + I +G
Sbjct: 257 DEGFLN-IRNLCKEYSLTLEKDVKAIMNNKEYVGRAIDIDNDGNLIVMFKNGEKKAITSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|92117729|ref|YP_577458.1| biotin--acetyl-CoA-carboxylase ligase [Nitrobacter hamburgensis
           X14]
 gi|91800623|gb|ABE62998.1| Biotin--acetyl-CoA-carboxylase ligase [Nitrobacter hamburgensis
           X14]
          Length = 270

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 125/248 (50%), Gaps = 9/248 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R   FD+I STN E + RA +G+ G +W+  + QTAGRGRR   W+S +GNL +S+L 
Sbjct: 13  GYRIAAFDSIGSTNAEALMRARAGETGPIWLATTEQTAGRGRRQRAWVSPRGNLASSILE 72

Query: 73  IDSISKD---------SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           +   S            L L +    V++ + + S         +KWPND+L   +K+AG
Sbjct: 73  VIDTSPAVAATLSFAAGLALEAALQTVSLEARMRSPGSENATFHLKWPNDVLAGGKKLAG 132

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           IL+E   + +   AVVVGIG NV   P   PYP  SL+  G  I   D+F  L +     
Sbjct: 133 ILLEAETVAHDRLAVVVGIGTNVVAAPEGIPYPAVSLRDLGIDIGAADLFRALTEAWVEF 192

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
             +W    G  +I  LW   A G+G  ++++    +I G F  +D+ G L++    G   
Sbjct: 193 RQIWDGGRGFGDIRRLWLDRAAGVGQAVSVRSGASTISGLFDTIDEDGCLIVATSDGKRM 252

Query: 244 QIFTGDIF 251
            +  GD++
Sbjct: 253 AVSAGDVY 260


>gi|218289184|ref|ZP_03493420.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240767|gb|EED07946.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 335

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/259 (23%), Positives = 108/259 (41%), Gaps = 12/259 (4%)

Query: 1   MFSNLSECQNPY----SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
           + + L     P          + ++ +STND  ++ A  G      + A  QT GRGRRD
Sbjct: 72  LMAPLVRPHLPADCLLGSPILWAESRASTNDTALELAEKGLPHGAVVTAGEQTGGRGRRD 131

Query: 57  NKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
             W S +G ++ ++ + +  +      L+   A+A+   +      G  V+IKWPNDIL+
Sbjct: 132 RAWASPRGGMWFTVFVRNPCALRHAPDLTLLAALAVCRALR---GEGVPVEIKWPNDILL 188

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGCIDLKD 171
             +K  GIL +       +   V+GIGLN                 T L   G  ID   
Sbjct: 189 GGKKTGGILAQIRAEGEMVDHAVIGIGLNANFPIEELPEEIRDRATTILHATGRPIDRPK 248

Query: 172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
           + + +  ++ R+    +   G + +   W      IG  + + +    + G    ++  G
Sbjct: 249 VLARILAELDRLYRDLRDGRGFQAVHAEWTALCSTIGHEVEVAIGDQRVRGIARSIEPDG 308

Query: 232 YLLLEEKKGCVRQIFTGDI 250
            L+LE   G  R + +G++
Sbjct: 309 SLVLETSPGVTRTVVSGEV 327


>gi|194016904|ref|ZP_03055517.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
 gi|194011510|gb|EDW21079.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
          Length = 327

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     F   ++ST          G      +V+  QT G+GR    W S     ++ SL
Sbjct: 82  FGRHIYFQKEVASTQLIAHDLVNEGAPHGTLVVSDHQTNGKGRLQRMWHSPNGTGIWMSL 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   I       ++   +VA+   IA     G    IKWPNDIL+  +K+ GIL E   
Sbjct: 142 ILRPEIPLHKAPQMTLLASVAIAEAIAE--QTGLSPSIKWPNDILLNGKKVVGILTELKA 199

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLD 185
             + + AV++G G+NV     D P  +              +D   +   +     +   
Sbjct: 200 EADQVHAVIIGPGINVNQTADDFPDELKDVATSLRMELNEKVDRAALIQQIMSTFEKRYA 259

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +    G   I  LW  FA  IG  I  +   G   G+ +G+++ G LLLE ++G +++I
Sbjct: 260 DY-MKQGFAPIKQLWESFAMTIGQHIVARTVNGQYTGKALGINEEGVLLLETEEG-IQKI 317

Query: 246 FTGDI 250
           ++ DI
Sbjct: 318 YSADI 322


>gi|302390913|ref|YP_003826733.1| biotin/acetyl-CoA-carboxylase ligase [Acetohalobium arabaticum DSM
           5501]
 gi|302202990|gb|ADL11668.1| biotin/acetyl-CoA-carboxylase ligase [Acetohalobium arabaticum DSM
           5501]
          Length = 331

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 112/239 (46%), Gaps = 6/239 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
             + + + STN      A         IVA  Q  G+GR   ++    G ++ S++L  +
Sbjct: 88  VIYQEEVKSTNSLAKSEARQEAEEGTVIVAKEQVGGKGRLGREYFCPPGGIWFSVILRPN 147

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  DS +  SF   VA+   I        +  IKWPND+L+  +K++GIL E     + +
Sbjct: 148 MKPDSASQFSFVAVVALAKTIDELTDSVPE--IKWPNDVLINGKKVSGILTEMSAEIDQI 205

Query: 136 QAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             +V+GIG+N+       P D     TS+Q E G    K  F L   +         +  
Sbjct: 206 DYLVLGIGVNLNIAVDEFPSDLKNKATSIQEESGQQIPKLNFFLSLLEQLEEEYFKLQTE 265

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G E+I+  W+ +   +G+ +T+  +   + G+ V VD+ G LL+E   G ++++  GD+
Sbjct: 266 GFEKIIEGWKEYNITLGNEVTVTSNNEVLTGQAVDVDNKGRLLVELPNGTMKKVVAGDV 324


>gi|13471392|ref|NP_102958.1| biotin--protein ligase [Mesorhizobium loti MAFF303099]
 gi|14022134|dbj|BAB48744.1| biotin-protein ligase; BirA [Mesorhizobium loti MAFF303099]
          Length = 273

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 84/263 (31%), Positives = 128/263 (48%), Gaps = 13/263 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  D++ STN   +  A +GD G LW+V+  Q +GRGRR   W+
Sbjct: 1   MAFRLAPTSLSEGFRLEAHDSVGSTNTVALDHARAGDPGRLWVVSKKQESGRGRRGRAWV 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV-------------GTDVK 107
           S +GNL A+LL+I          L F   +++   + + +P                  +
Sbjct: 61  SPEGNLAATLLVITGGELRLAATLGFVAGLSLADALDAVVPKGRVAVGLDGASQGQNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L+ G  AV VGIG+NV   P D PYP TSLQ  G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAILEGGRFAVAVGIGVNVVAHPKDLPYPATSLQALGATC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   +   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGLSAVRRRWLARAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           D+    ++ + +G V  I  GD+
Sbjct: 241 DEDCRFVIRDDEGTVLTIAAGDV 263


>gi|294055645|ref|YP_003549303.1| biotin/acetyl-CoA-carboxylase ligase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614978|gb|ADE55133.1| biotin/acetyl-CoA-carboxylase ligase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 342

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 7/242 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
              +F  I STN E  ++   G      I +SCQ  GRGR   +W S    NLY S+L  
Sbjct: 95  DVLYFPVIDSTNSEADRQISFGRQSPFAIASSCQLKGRGRLGREWYSASADNLYLSVLFE 154

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I    L   +    V +   +   +P    +KIKWPND+    RK AG+L E     +
Sbjct: 155 PKIPAQQLQHFTLWAGVHICRALQRFVP-DAPLKIKWPNDLHCDGRKFAGMLTEAKMDAD 213

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           G++ +V G+G+N+   P+D P  + +         G  + L D+ + + + +        
Sbjct: 214 GIKTIVFGVGINLNSNPMDYPDELRNLATSLYAIHGEELPLNDVTAAVLKAIQTAYQYCI 273

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             +  E +   W       G  +T  +S  +I G   G+D+ G LLLE + G    +  G
Sbjct: 274 GSSDGECLSEAWAPLNALAGKSVTALMSGNAISGIATGIDESGALLLENEDGTTHTVLAG 333

Query: 249 DI 250
           D+
Sbjct: 334 DV 335


>gi|110633390|ref|YP_673598.1| biotin--acetyl-CoA-carboxylase ligase [Mesorhizobium sp. BNC1]
 gi|110284374|gb|ABG62433.1| biotin--acetyl-CoA-carboxylase ligase [Chelativorans sp. BNC1]
          Length = 274

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 85/253 (33%), Positives = 126/253 (49%), Gaps = 15/253 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E  +++ STN   ++RA+SGD G LW+V+  QT+GRGRR   W +  GNL A+LLL
Sbjct: 12  GYRLEAHESVGSTNVLALERAVSGDPGKLWVVSKNQTSGRGRRGRTWETPAGNLAATLLL 71

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLP---------------VGTDVKIKWPNDILVF 117
            D I   +   L F   +++   +    P                 T  ++KWPND+L  
Sbjct: 72  ADRIEPGAAATLGFVAGLSLSDALRQAAPSARLGIGIDGGEGKAERTRFELKWPNDVLAD 131

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLF 177
             K+AGIL+E+  L  G  AV +GIG+N+   PVDTPYP  SLQ  G   D + +F  L 
Sbjct: 132 GAKLAGILLESSVLGEGRFAVAIGIGVNIVSHPVDTPYPAISLQGLGADCDAERLFEALS 191

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
                   LW+   G   I + W   A G+G  ++++     + G F  +D+    ++ E
Sbjct: 192 AAWVENFALWQGPRGMSAIRDRWLENAAGLGSTVSVRADGRVVRGIFETIDEQCRFVVRE 251

Query: 238 KKGCVRQIFTGDI 250
             G    I  GD+
Sbjct: 252 DNGSRLLIAAGDV 264


>gi|158520408|ref|YP_001528278.1| biotin--acetyl-CoA-carboxylase ligase [Desulfococcus oleovorans
           Hxd3]
 gi|158509234|gb|ABW66201.1| biotin--acetyl-CoA-carboxylase ligase [Desulfococcus oleovorans
           Hxd3]
          Length = 240

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/236 (28%), Positives = 106/236 (44%), Gaps = 5/236 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
                T  ST D     AL G      +VA  QT GRGR D  W SD G LY +L+L   
Sbjct: 8   LHHLATTESTMDVARNLALQGCPHFTVVVADTQTGGRGRMDRTWHSDPGGLYMTLVLKPD 67

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +       L+F  ++ +   +        D  +KWPNDILV ++K+AG+L E     + +
Sbjct: 68  MPAADGLKLTFLASLTLAQTVRR--CCDIDAGVKWPNDILVKEKKLAGLLSEMQATGSRI 125

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
             V +GIG+NV + P       TS++   G    ++       +    L    ++T    
Sbjct: 126 DFVNIGIGINVNNDPARFEPGATSIKAATGATFSREGLL---DEFLGALKTGLQNTSLPS 182

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           ++  W+  A  +G  +T+     ++ G    V++ G LL+    G +R+I  GD F
Sbjct: 183 VIQQWKTLAVSLGRPVTVVTPRETVTGIAEDVNESGALLVRMSDGDLREICYGDCF 238


>gi|311030317|ref|ZP_07708407.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Bacillus sp. m3-13]
          Length = 328

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 108/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  F D+++ST     + A  G      +VA  QT+GRGR    W S K   ++ SL+
Sbjct: 83  GRKIHFEDSVTSTQKIAHQLAYDGVPEGTLVVAEEQTSGRGRLSRAWYSPKYTGVWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++       L+   AVA+   I     +  D  IKWPNDIL+ ++K  GIL E    
Sbjct: 143 LRPNLPPAKAPQLTLLTAVAITQAIEEVTGLRPD--IKWPNDILINKKKTVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + + +V++G+G+NV       P +     TSL  E G    +             L   
Sbjct: 201 ADKINSVIIGMGINVNQSLEQFPEELHSIATSLSIELGEKVNRAELIQTILMKFENLYQK 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   I  LW  +A  IG  I  +   G++ G+  G+ + G L+LE+ +  V  I +
Sbjct: 261 YLQHGFYPIKLLWESYAISIGKRIIARTITGTLEGKAKGITEDGVLMLEDDQEVVHYIHS 320

Query: 248 GDI 250
            DI
Sbjct: 321 ADI 323


>gi|308274536|emb|CBX31135.1| hypothetical protein N47_E46470 [uncultured Desulfobacterium sp.]
          Length = 305

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 108/237 (45%), Gaps = 5/237 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
              +F   SST D     A  G      ++A  Q  GRGR    W+S +G LY +L+L  
Sbjct: 73  NIHYFPETSSTMDIARDLARKGCPHYTIVIAGRQKKGRGRLSRIWLSSEGGLYFTLVLRP 132

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I     + ++F  +V +   +        D K+KWPNDILV  +KI+G+L E     + 
Sbjct: 133 DIPAAHASRITFLASVVLAQTLRKL--YDIDAKVKWPNDILVGGKKISGMLSEMEAEADM 190

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           +  + +GIG+NV + P       TSL++  G   L+     +        +        +
Sbjct: 191 VSFINIGIGVNVNNDPSIKEPVATSLKKLKGKEFLRKELLSV---FLDEFENRLNTKSFD 247

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           +I++ W+ +   +   + I     +  G  V VD+ G L+L+ + G ++++  GD F
Sbjct: 248 DIISQWKQYTMTLNQPVKIVTYRDTYEGIAVDVDENGALILKLENGTLQKVVCGDCF 304


>gi|225852332|ref|YP_002732565.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis ATCC
           23457]
 gi|256044495|ref|ZP_05447399.1| biotin--protein ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113351|ref|ZP_05454209.1| biotin--protein ligase [Brucella melitensis bv. 3 str. Ether]
 gi|256264169|ref|ZP_05466701.1| biotin-protein ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|260563849|ref|ZP_05834335.1| biotin-protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265990919|ref|ZP_06103476.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994757|ref|ZP_06107314.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 3
           str. Ether]
 gi|225640697|gb|ACO00611.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis ATCC
           23457]
 gi|260153865|gb|EEW88957.1| biotin-protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|262765870|gb|EEZ11659.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 3
           str. Ether]
 gi|263001703|gb|EEZ14278.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094387|gb|EEZ18232.1| biotin-protein ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408839|gb|ADZ65904.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis M28]
 gi|326538555|gb|ADZ86770.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis M5-90]
          Length = 265

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 128/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDPPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|153813028|ref|ZP_01965696.1| hypothetical protein RUMOBE_03436 [Ruminococcus obeum ATCC 29174]
 gi|149830830|gb|EDM85920.1| hypothetical protein RUMOBE_03436 [Ruminococcus obeum ATCC 29174]
          Length = 268

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 52/250 (20%), Positives = 104/250 (41%), Gaps = 8/250 (3%)

Query: 6   SECQNPY-SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
            E    +      F     STN+ C + +          VA  Q+AG+GR   KW++ + 
Sbjct: 13  KEINTKWAGKTVHFAKETDSTNEWCKRMSKENAEHGTLAVAEFQSAGKGRLGRKWMAPEG 72

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            ++  S+LL         ++L+  + +++   +      G +V IKWPND++V  +KI G
Sbjct: 73  SSVMMSILLKPEFEPQYASMLTLVMGLSVAQAVCEL---GVEVSIKWPNDVVVSHKKICG 129

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDV 180
           IL E       ++ VV+G+GLNV    +       +       G   D   +  L+ +  
Sbjct: 130 ILTEMGVQDGKIREVVIGVGLNVNLKEIQDELKDKATSLYLETGKTYDRNRLIGLVMEKF 189

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
               + + +      +++ +          + +        G  + +D  G LL+  + G
Sbjct: 190 EINYEKFVQTCDLSMMLDDYNMLLANKSQPVRVLDKISPYEGVALEIDKDGALLVRVQSG 249

Query: 241 CVRQIFTGDI 250
            +R++ +G++
Sbjct: 250 EIRKVCSGEV 259


>gi|17987427|ref|NP_540061.1| biotin--protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|17983119|gb|AAL52325.1| biotin operon repressor / biotin-[acetyl-CoA-carboxylase]
           synthetase [Brucella melitensis bv. 1 str. 16M]
          Length = 287

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 128/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 34  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 93

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 94  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 153

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 154 ESSILAKNLFAVAIGIGTNVVAFPDDPPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 213

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 214 WNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 273

Query: 247 TGDIF 251
            GD++
Sbjct: 274 AGDVY 278


>gi|220930914|ref|YP_002507822.1| biotin (acetyl-CoA carboxylase) synthetase [Halothermothrix orenii
           H 168]
 gi|219992224|gb|ACL68827.1| biotin (acetyl-CoA carboxylase) synthetase [Halothermothrix orenii
           H 168]
          Length = 326

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 106/241 (43%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLL 71
                 F +I STN++  + A  G  G   ++A  QT G+GR   KW       L+ S++
Sbjct: 84  GKEVRVFSSIDSTNNKARELAKGGASGGTIVIAEEQTGGKGRLGRKWYSPPYTGLWFSVI 143

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +   +  +    L+   ++ ++  I      G +V IKWPNDIL+  +K+ GIL E +  
Sbjct: 144 VRPHLPSNRAPFLTIITSLVVKKAINKL---GIEVLIKWPNDILIRGKKVCGILSEIMAT 200

Query: 132 KNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +   ++GIG+NV     P   P   +  Q  G  ++  ++   +  +     +  K 
Sbjct: 201 PDVINTAIIGIGINVNQDSFPSKIPLATSLKQVCGHNVNRIELLQDILMEFENYYNRLK- 259

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D    +++  W+     +G  + I      I G+ V +   G L+L +  G     + GD
Sbjct: 260 DGCYRDLVTEWKNSMDILGKEVDIVAGNEIISGKVVSISRRGELVLIDPDGNKHLFWAGD 319

Query: 250 I 250
           +
Sbjct: 320 V 320


>gi|327440754|dbj|BAK17119.1| biotin-(acetyl-CoA carboxylase) ligase [Solibacillus silvestris
           StLB046]
          Length = 328

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 108/244 (44%), Gaps = 6/244 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASL 70
           Y  +  +++T+ ST     +   +G      ++A  QTAGRGR   +W  ++   ++ ++
Sbjct: 82  YGRQVHYYETVESTQLVAHELIRAGAPDGTVVIAEHQTAGRGRMMREWESTEGQGIWMTV 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++   ++       +   AVA+   + S+    T  +IKWPNDIL+  +K  GIL E + 
Sbjct: 142 IIRPDVAPHQAPQFTLVTAVAIVEAMKSSFKNFT-PEIKWPNDILINGKKTTGILTEMVA 200

Query: 131 LKNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
             + +QA+++GIG+NV       P       TS+  E G    +  F     +       
Sbjct: 201 EADRIQALLIGIGINVNQKIDDFPEQLQTIATSIAIEEGEPIERVHFVANVLESLEKYSD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                G  +I  LW   +  IG  +        + G  V + + G L + +  G ++ I+
Sbjct: 261 EYVKNGFGQIKQLWEQSSGTIGKRVKATTLREVVEGEAVSITESGVLEIRQANGEIKGIY 320

Query: 247 TGDI 250
           + DI
Sbjct: 321 SADI 324


>gi|189347902|ref|YP_001944431.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium limicola DSM 245]
 gi|189342049|gb|ACD91452.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium limicola DSM 245]
          Length = 330

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 103/241 (42%), Gaps = 5/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
              + +     STN E  K A  G      IVA  Q AGRGR    W+S    NLY SL+
Sbjct: 81  GRIFHYQKETESTNLEAKKLAAEGVPEGAVIVADSQRAGRGRLGRTWVSPAGKNLYFSLI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S+    +  ++  +A A+   I    P   D  +KWPNDIL   RK+ G+L E  + 
Sbjct: 141 LRPSVVSLRIPQITLLVAAAIHQAICDLFPC-IDTGVKWPNDILAGGRKLCGVLCEMQSE 199

Query: 132 KNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWK 188
                 VVVGIG+NV     P +     TSL+ E G       + + +      +   W 
Sbjct: 200 PGMTHFVVVGIGINVNQDDFPEELRDKATSLKLETGEWFSRSRLLATVLNRFEELYLNWL 259

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++     I+     ++   G  + I      I G   G+   G L+L+ + G   +I +G
Sbjct: 260 QEDDLGFILPYLERYSLLQGKDVCIDQFSRQITGTVCGIARGGELVLQTEDGTELKISSG 319

Query: 249 D 249
           +
Sbjct: 320 E 320


>gi|260462246|ref|ZP_05810490.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium opportunistum
           WSM2075]
 gi|259032106|gb|EEW33373.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium opportunistum
           WSM2075]
          Length = 273

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 124/263 (47%), Gaps = 13/263 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  D++ STN   +  A +GD G LW+V+  Q +GRGRR   W 
Sbjct: 1   MAFRLAPTSASEGFRLEAHDSVGSTNALALDHARAGDPGRLWVVSKKQESGRGRRGRVWA 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV-------------GTDVK 107
           + +GNL A+LL++          L F   +A+   + + +P                  +
Sbjct: 61  TPEGNLAATLLVLTGGELRLAATLGFVAGLALADALDAVVPKGRIAIGLDGASQGQNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L  G  AV VGIG+NV   P D PYP TSL   G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAVLDGGRFAVAVGIGVNVVAHPQDLPYPATSLHALGAAC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   I   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGLAAIRRRWLARAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           D+    ++ +  G V  I  GD+
Sbjct: 241 DEDCRFVIRDDDGSVLTIAAGDV 263


>gi|86749706|ref|YP_486202.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
 gi|86572734|gb|ABD07291.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
          Length = 271

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 116/248 (46%), Gaps = 9/248 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
               + FD   STN + M  A +G     W V + QTAGRGRR+  W++ +GNL +S+  
Sbjct: 13  GVGLKVFDETGSTNADAMAYARAGGRTPCWFVTTMQTAGRGRRNRVWVAPRGNLASSVFE 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAST---------LPVGTDVKIKWPNDILVFQRKIAG 123
             +++      L FA  VA+   +                 D ++KWPNDIL    K+ G
Sbjct: 73  SFNVTPAVAATLGFAAGVALEKALREVSVEAAMRSPNSAANDYRLKWPNDILAGGSKLVG 132

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           + +E   L +G  AVVVG+G NV   P   P  VT L + G     +D+F+ L      +
Sbjct: 133 MNLEAETLPDGRLAVVVGMGTNVVAAPEGLPTAVTCLSQLGVSASAEDVFAALSDSWHEM 192

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
             +W    G  +I +LW   A G+G  ++I+     + G F  +D+ G ++L        
Sbjct: 193 RGIWDDGRGFAKIRDLWLDRAAGLGQTVSIRSGSSVVSGIFDTIDETGCMVLITSDRRRI 252

Query: 244 QIFTGDIF 251
            I  GD++
Sbjct: 253 PIAAGDVY 260


>gi|189424381|ref|YP_001951558.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter lovleyi SZ]
 gi|189420640|gb|ACD95038.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter lovleyi SZ]
          Length = 328

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 108/243 (44%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             R       +STN +    A  G      ++A  Q AG+GR   +W S  G NLY S++
Sbjct: 85  GRRLVCCSETASTNSDAFHLAEEGAEEGTVVLADRQLAGKGRLGRRWESPAGVNLYCSVV 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+F  AVA+   I      G    IKWPND+L+  RK+AG+L E    
Sbjct: 145 LRPELPPYEAPQLTFLSAVAVARAIH--TSTGLQPVIKWPNDLLLNGRKVAGLLNEMNAE 202

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  V++GIG+N+       P D   P TSL  E G   ++  F++          L 
Sbjct: 203 TDRVGFVILGIGVNLNMREDQFPPDLRSPATSLLLETGSAVVRQAFAVNLLRELEREYLR 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   +   W  +    G  + +++   ++ G F G+D  G LL+    G + +I +
Sbjct: 263 FTQNGFGPVREDWTRYCNAFGREVRVEMGPHTLQGPFAGIDHDGALLMTLPDGRIERILS 322

Query: 248 GDI 250
           GD+
Sbjct: 323 GDV 325


>gi|254693555|ref|ZP_05155383.1| biotin--protein ligase [Brucella abortus bv. 3 str. Tulya]
 gi|261213820|ref|ZP_05928101.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260915427|gb|EEX82288.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 265

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 78/245 (31%), Positives = 128/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++L+
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLI 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|27380014|ref|NP_771543.1| biotin--protein ligase [Bradyrhizobium japonicum USDA 110]
 gi|27353168|dbj|BAC50168.1| birA bifunctional protein [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 115/247 (46%), Gaps = 9/247 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            ++   F+   STN E ++ A  G+ G +W V S QTAGRGRR   WI+ +GNL AS+L 
Sbjct: 13  GYKLAAFERTGSTNTEAIEHARGGEPGPMWFVTSEQTAGRGRRQRAWIAPRGNLAASILE 72

Query: 73  IDSISKD--------SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           + ++           +      A+                   +KWPND+L   +K+ GI
Sbjct: 73  VMTVPPAVAATLGFAAGLAEEAALEKVSLEAALRLGEGRPRYALKWPNDVLADGKKLVGI 132

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
            +E   + + L AVVVGIG NV   P  TP P  SL   G  I  +++FS L        
Sbjct: 133 GLEAEVIGDRL-AVVVGIGTNVVAAPEGTPTPAVSLAALGVQISAEELFSALSDAWVEFR 191

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W    G  EI  LW   A G+G+ + I     ++ G F  +DD G L++    G    
Sbjct: 192 GIWDNGRGFAEIRRLWLERAAGLGERVAINTGTTTLEGIFDTIDDAGCLIVRTADGRRLP 251

Query: 245 IFTGDIF 251
           +  G++F
Sbjct: 252 VAAGEVF 258


>gi|237815252|ref|ZP_04594250.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus str. 2308
           A]
 gi|237790089|gb|EEP64299.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus str. 2308
           A]
          Length = 300

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 128/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 47  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 107 LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 166

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 167 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 226

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 227 WNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 286

Query: 247 TGDIF 251
            GD++
Sbjct: 287 AGDVY 291


>gi|62289765|ref|YP_221558.1| biotin--protein ligase [Brucella abortus bv. 1 str. 9-941]
 gi|82699693|ref|YP_414267.1| biotin protein ligase [Brucella melitensis biovar Abortus 2308]
 gi|189024010|ref|YP_001934778.1| biotin--protein ligase [Brucella abortus S19]
 gi|254689072|ref|ZP_05152326.1| biotin--protein ligase [Brucella abortus bv. 6 str. 870]
 gi|254697206|ref|ZP_05159034.1| biotin--protein ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730102|ref|ZP_05188680.1| biotin--protein ligase [Brucella abortus bv. 4 str. 292]
 gi|256257321|ref|ZP_05462857.1| biotin--protein ligase [Brucella abortus bv. 9 str. C68]
 gi|260545485|ref|ZP_05821226.1| biotin-protein ligase [Brucella abortus NCTC 8038]
 gi|260754570|ref|ZP_05866918.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 6 str.
           870]
 gi|260757791|ref|ZP_05870139.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 4 str.
           292]
 gi|260761616|ref|ZP_05873959.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883597|ref|ZP_05895211.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 9 str.
           C68]
 gi|297248170|ref|ZP_06931888.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella abortus bv. 5 str.
           B3196]
 gi|62195897|gb|AAX74197.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615794|emb|CAJ10792.1| Biotin protein ligase, C-terminal:Biotin/lipoate A/B protein ligase
           domain:Biotin--acetyl-CoA-carboxylase ligase [Brucella
           melitensis biovar Abortus 2308]
 gi|189019582|gb|ACD72304.1| biotin--protein ligase [Brucella abortus S19]
 gi|260096892|gb|EEW80767.1| biotin-protein ligase [Brucella abortus NCTC 8038]
 gi|260668109|gb|EEX55049.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 4 str.
           292]
 gi|260672048|gb|EEX58869.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674678|gb|EEX61499.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 6 str.
           870]
 gi|260873125|gb|EEX80194.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 9 str.
           C68]
 gi|297175339|gb|EFH34686.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella abortus bv. 5 str.
           B3196]
          Length = 265

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 128/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|212224051|ref|YP_002307287.1| biotin--protein ligase [Thermococcus onnurineus NA1]
 gi|212009008|gb|ACJ16390.1| biotin-protein ligase [Thermococcus onnurineus NA1]
          Length = 340

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 113/240 (47%), Gaps = 12/240 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +   F  + STN+         +     +VA  QTAG+GR+   W S +G L+ S++L
Sbjct: 106 GRKIIHFHEVDSTNEYAK-LIALDEREGTVVVADRQTAGKGRKGRTWASPEGGLWMSVIL 164

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L+ L F  A+A+   +      G +  IKWPND+ V  RKI G+L E     
Sbjct: 165 KPKAEPKHLSKLVFIGALAVVDTL---WKFGIEAGIKWPNDVWVNGRKICGVLTEGRIG- 220

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              + V++GIGLNV +   +    +  +  +  G  + L ++F  L +++     L+  +
Sbjct: 221 ---EFVILGIGLNVNNDAPEELRKMATSMREFLGREVSLSEVFHALIRNLDHWYRLFL-N 276

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               EI++  +  +  +G  + I      ++GR V +D  G L+LE  KG VR +  GD+
Sbjct: 277 GRYAEIISALKERSIVLGKEVKIIDDETELVGRAVDIDVDGALILETPKGRVRVLH-GDV 335


>gi|39936001|ref|NP_948277.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           CGA009]
 gi|39649855|emb|CAE28377.1| putative biotin-protein ligase birA [Rhodopseudomonas palustris
           CGA009]
          Length = 268

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 84/240 (35%), Positives = 129/240 (53%), Gaps = 8/240 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+  STN E +  A +G+ G +W V + QTAGRGRR   WI+ +GNL +S+L +  +  
Sbjct: 20  FDSTGSTNAEALASARAGEAGPMWFVTTEQTAGRGRRQRAWIAPRGNLASSVLEVMRVPP 79

Query: 79  DSLTLLSFAIAVAMRSVI-------ASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
            +   L FA  +A+ + +        +        ++KWPND+L   +K+AGIL+E  N+
Sbjct: 80  GTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLASGKKLAGILLEVENV 139

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            + L AVVVGIG NV   P DTPYP  SL   G  +  +D+F+ L      +L +W    
Sbjct: 140 GDRL-AVVVGIGTNVIAAPTDTPYPAVSLHDLGISVTAEDLFAALSDAWTELLGIWDNGR 198

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   W   A G+G+ ++I+    ++ G F  +DD G L++    G    +  GD++
Sbjct: 199 GFPEIRRRWLERAAGLGEPVSIRSGDSALEGVFDSIDDTGCLIVRTTDGRRVPVSAGDVY 258


>gi|91774336|ref|YP_567028.1| biotin--acetyl-CoA-carboxylase ligase [Methanococcoides burtonii
           DSM 6242]
 gi|91713351|gb|ABE53278.1| Bifunctional protein birA [Methanococcoides burtonii DSM 6242]
          Length = 321

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 108/241 (44%), Gaps = 11/241 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +FD + STND   K   S D     ++A  Q +GRGR+   W+S +G ++ S++L
Sbjct: 82  GGDIRYFDEVDSTNDVAKKMGSSSD-EGTVVIAEMQDSGRGRKGGHWMSPRGGVWMSVIL 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             ++        +    VA+   I      G +  +KWPND+L+  +K+ GIL E     
Sbjct: 141 KPNVVPAYAPRFTLMAGVAVAKAIRGL---GVEASLKWPNDVLIGDKKVCGILTEMDAEC 197

Query: 133 NGLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
           + +  V++GIG+NV                +  + +G  +D       L + +       
Sbjct: 198 DQINFVIIGIGINVNVLIEELSEDLRSSSTSLSEIKGEELDRIAFVQALLRALEDEYIR- 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            K +G + I+  WR  +  IG  + +      I G+ VG+ + G LL+E  +G + +I  
Sbjct: 257 SKTSGFDSILEEWRSLSSTIGRDVDVVTPQRIIRGKAVGITENGTLLVETAEG-LEEIVA 315

Query: 248 G 248
           G
Sbjct: 316 G 316


>gi|99080602|ref|YP_612756.1| biotin--acetyl-CoA-carboxylase ligase [Ruegeria sp. TM1040]
 gi|99036882|gb|ABF63494.1| Biotin--acetyl-CoA-carboxylase ligase [Ruegeria sp. TM1040]
          Length = 249

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 119/248 (47%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + ST DE  + A +   G  WI+A  QT GRGRR   W   KGN   +
Sbjct: 4   WPIGYGRRVLAEVDSTLDEAARLAPAL-SGPEWILALRQTKGRGRRGRAWTDPKGNFAGT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+     + D + L SF  A+A+   + +     T + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVYRPEGAPDQIALRSFVAALALYDAVETVTGRTTGLALKWPNDVLLNGGKLAGILLESS 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
            +K+G+  + +GIG+N+   P+         +PV+     G  +D +   S L    AR 
Sbjct: 123 GVKSGVDHLAIGIGVNLAETPMKEWLEPGAVWPVSLQSETGVRVDPETFLSALALAFARY 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            D +        I  LW   A  +G++IT + +     G F  +DD G L+L+  KG + 
Sbjct: 183 EDQFTTYG-FGPIRELWLSRAAKLGEVITARTAREETSGTFETIDDAGNLVLKTAKG-IV 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|51892538|ref|YP_075229.1| transcriptional repressor, BirA-like [Symbiobacterium thermophilum
           IAM 14863]
 gi|51856227|dbj|BAD40385.1| transcriptional repressor, BirA-like [Symbiobacterium thermophilum
           IAM 14863]
          Length = 335

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 101/246 (41%), Gaps = 11/246 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E+ +T+ STND   + A  G    L ++A  QTAG+GR    W +     +  SL+
Sbjct: 83  GRVVEYRETVGSTNDLAKEMARQGAPEGLLVLAEQQTAGKGRLGRSWTTPPGAAIAMSLV 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +   +   ++ A AVA+   +           IKWPND+ V  RK+ GIL E    
Sbjct: 143 LRPDLPPHAAPRITLAAAVAVTEAVREAAG--VAAGIKWPNDVQVNGRKLCGILTEMEAE 200

Query: 132 KNGLQAVVVGIGLNV-----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VV+GIGLNV     +  P       +        +    +   +      V D 
Sbjct: 201 MDRVAFVVLGIGLNVTLRREQMDPSFRETATSLALEGAPPVRRAALVQAILARFEAVYDE 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITI--KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                  + +++ WR  +  +G  +          + G    VD  G LL+ +  G V +
Sbjct: 261 LL-GDRFDRVLDRWRALSVTLGQAVRALGLDGQPVLEGVAEEVDQEGALLVRDGAGQVHR 319

Query: 245 IFTGDI 250
           + +G++
Sbjct: 320 VVSGEV 325


>gi|197105253|ref|YP_002130630.1| biotin protein ligase [Phenylobacterium zucineum HLK1]
 gi|196478673|gb|ACG78201.1| biotin protein ligase [Phenylobacterium zucineum HLK1]
          Length = 246

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 110/238 (46%), Gaps = 4/238 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
            E ++ + STN E  +RA +G+ G +WI A+ QTAGRGRR   W + KGNL A+LL +  
Sbjct: 7   IEAYEALDSTNAEARRRAEAGEAGPVWITAAVQTAGRGRRGRAWSTRKGNLAATLLTVTD 66

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +   +       +A      +A         ++KWPND+L+  RK  GIL+E+    +G 
Sbjct: 67  V-PAAEAAQLSFVAALAACDLADACLGEGTARLKWPNDVLIHGRKAVGILVESGARPDGR 125

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREG--GCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             + VGIG+N+ H P D   P  +          + +    +L     R    W    G 
Sbjct: 126 LWLAVGIGVNLAHAPQDVERPAAAFAEYMAGPPPEPRAALEVLAAAFERWRRTWA-AGGF 184

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I   W   A G+G+    +L   ++ G    +D  G L L    G + +I  GD+F
Sbjct: 185 APIAQAWTARAMGLGERCEARLPGRTLAGVAEALDSDGALRLRLDDGSLERITAGDVF 242


>gi|259418714|ref|ZP_05742631.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter sp. TrichCH4B]
 gi|259344936|gb|EEW56790.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter sp. TrichCH4B]
          Length = 249

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 119/248 (47%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + ST DE  + A S   G  WI+A  QT GRGRR   W   KGN   +
Sbjct: 4   WPIGYGRRVLAEVDSTLDEAARLAPSL-TGPEWILALRQTKGRGRRGRAWTDPKGNFAGT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+     + D + L SF  A+A+   + +     + + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVYRPKGTPDQIALRSFIAALALYDAVETVTGRTSGLALKWPNDVLLNGGKLAGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
            +K+G+  + +GIG+N+   P+         +PV+     G  +D +   S L    AR 
Sbjct: 123 GVKSGVDHLSIGIGVNLAETPMKEWLEPGAVWPVSLQSETGVRVDPETFLSALALAFARH 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            D +        I  LW   A  +G++IT + +     G F  +DD G L+L+  KG V 
Sbjct: 183 EDQFTTYG-FAPIRELWLSRAAKLGEVITARTAREETSGTFETIDDAGNLVLKTAKGKV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|254445666|ref|ZP_05059142.1| biotin-(acetyl-CoA-carboxylase) ligase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259974|gb|EDY84282.1| biotin-(acetyl-CoA-carboxylase) ligase [Verrucomicrobiae bacterium
           DG1235]
          Length = 329

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 113/257 (43%), Gaps = 11/257 (4%)

Query: 3   SNLSECQNPY---SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
            +L + +  +   SF     D + STN E  +R  +G+     +++  QT GRGR    W
Sbjct: 69  ESLIQARLTHAAASFTATVLDEVDSTNSEAERRIANGEPTPFVVLSRLQTIGRGRLGRVW 128

Query: 60  ISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
            S +  NLYAS      IS   ++L +  + + +   I S        K+KWPND+ +  
Sbjct: 129 HSPQNGNLYASFAFRPQISPTQMSLFTLWMGINICECINSV--CRVSCKVKWPNDLHIEG 186

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIF 173
           +KIAGIL E     + ++ VV+GIGLNV                +  Q  G   D+  + 
Sbjct: 187 KKIAGILTEARMEADQVRDVVLGIGLNVNSDGKDWPEELKSIATSLRQSSGETFDINRLV 246

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           S +   +A      +  + ++ + + W  +   +G  +++      I G   G+D  G L
Sbjct: 247 SAITGRIAIAYKQLEDGSHKKALKDKWPRYDSLVGKQVSLLQGESRISGTANGIDANGSL 306

Query: 234 LLEEKKGCVRQIFTGDI 250
           ++E + G       G++
Sbjct: 307 VIEREDGTRYLARAGEV 323


>gi|254294088|ref|YP_003060111.1| biotin/acetyl-CoA-carboxylase ligase [Hirschia baltica ATCC 49814]
 gi|254042619|gb|ACT59414.1| biotin/acetyl-CoA-carboxylase ligase [Hirschia baltica ATCC 49814]
          Length = 253

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 115/249 (46%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
            + L E    +++  +++D + STN E  +RA +G+ G  WI A  Q  G+GR    W +
Sbjct: 1   MTKLIESALAHAWPVQWYDELDSTNAEAKRRASTGEFGPCWIAARKQINGKGRLGRPWQA 60

Query: 62  DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
            +GNL A+ L     S D ++ LSF   +A+           + +++KWPND+   + K 
Sbjct: 61  PEGNLSATALFPFDGSFDQISKLSFLAGLAIYDAALLEGVPASKLQLKWPNDVRCERHKF 120

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           +G+LIET  +   L  V +G+G+N+   P      V         I   D F    +   
Sbjct: 121 SGVLIETGQVSKDLSWVALGVGVNILRAPEIDQPTVCLKDLSANAIVNADNFLDSLKVTF 180

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
                     G E I   W   A G    I++K S  ++ G   G+++ G L+LE   G 
Sbjct: 181 GNRLHSLIKFGFEPIRQDWLANAEGYNHSISVKDSQSTMTGIMRGINETGALMLEMGDGT 240

Query: 242 VRQIFTGDI 250
           ++ + TGD+
Sbjct: 241 IKLVTTGDV 249


>gi|153009737|ref|YP_001370952.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum anthropi ATCC
           49188]
 gi|151561625|gb|ABS15123.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum anthropi ATCC
           49188]
          Length = 265

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 83/245 (33%), Positives = 130/245 (53%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+T+ STN   ++RA SGD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EDYRLETFETVGSTNAVALERAASGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPLTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PY  TSLQ  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYAATSLQALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    I GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLQRAHGLGQNVTMQVEGRIIEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|256031417|ref|ZP_05445031.1| biotin--protein ligase [Brucella pinnipedialis M292/94/1]
 gi|265988506|ref|ZP_06101063.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M292/94/1]
 gi|264660703|gb|EEZ30964.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M292/94/1]
          Length = 265

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 131/252 (51%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPAAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F   +++   + +        V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|306841946|ref|ZP_07474624.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO2]
 gi|306287979|gb|EFM59387.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO2]
          Length = 265

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKRQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRIVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|226312088|ref|YP_002771982.1| BirA bifunctional protein [Brevibacillus brevis NBRC 100599]
 gi|226095036|dbj|BAH43478.1| BirA bifunctional protein [Brevibacillus brevis NBRC 100599]
          Length = 327

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +D + ST     + A  G +    ++A  QT G+GR    W S K   ++ SL+
Sbjct: 81  GQNVIAYDEVVSTQPLAHEAAAKGAVEGTIVLAELQTGGKGRLGRPWHSPKGTGIWMSLI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +  SI       ++   AVA+   I      G  VKIKWPNDI +  +K+ GIL E    
Sbjct: 141 IRPSIPLPKTPQMTLLTAVAVAKTIRE--ETGLPVKIKWPNDIFIGDKKVCGILTELNAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFSLLFQDVARVLDL 186
            + +  +V+GIGLN      D P  +  +                    L +      D 
Sbjct: 199 SDRVNYLVIGIGLNANSLESDFPSELAQIVTSLRIESGESLKRVTFIQRLCRIFEEEYDH 258

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + +    E +   W   +  IG  +T++     + GR VG+D+ G L++E++ G + +++
Sbjct: 259 YLRAG-FERVKQEWENHSYTIGKWVTLQTISQQLEGRAVGLDEEGVLMVEDQAGQIHKVY 317

Query: 247 TGDI 250
           + D+
Sbjct: 318 SADV 321


>gi|196232981|ref|ZP_03131830.1| biotin/acetyl-CoA-carboxylase ligase [Chthoniobacter flavus
           Ellin428]
 gi|196222959|gb|EDY17480.1| biotin/acetyl-CoA-carboxylase ligase [Chthoniobacter flavus
           Ellin428]
          Length = 325

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 73/256 (28%), Positives = 114/256 (44%), Gaps = 12/256 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW- 59
           +FS L  C+   +     F   +STND  M+R   G  G + I A  QTAGRGR    W 
Sbjct: 71  IFSRLGTCEL--AREIVVFAETASTNDSAMQRGRQGAEGGIVIFAERQTAGRGRFGRAWA 128

Query: 60  ISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
            +    L+ S+L+   +   +   L+   AV++ S I +   +G  V IKWPNDI +  R
Sbjct: 129 SAPYRGLWFSMLMRPDLPPSAWPRLTTWAAVSLASTIEN--SLGLPVSIKWPNDIYLSGR 186

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFS 174
           KIAGIL E+    NG    VVGIG+NV        P       +     G  ID   + +
Sbjct: 187 KIAGILAESGADVNGRPFAVVGIGVNVNQSQAEFPPELATKAASLSMITGRLIDRPTLAA 246

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            L +++               ++   R  +  +G  + ++  +  + GR   +D  G LL
Sbjct: 247 HLLRELGTRFPQIL--ADFPAMIAAARRRSLLLGHWVQVQSGHNILEGRAEELDPDGQLL 304

Query: 235 LEEKKGCVRQIFTGDI 250
           L    G + ++  G++
Sbjct: 305 LRRSDGTLSRLSAGEV 320


>gi|310816698|ref|YP_003964662.1| biotin--acetyl-CoA-carboxylase ligase [Ketogulonicigenium vulgare
           Y25]
 gi|308755433|gb|ADO43362.1| biotin--acetyl-CoA-carboxylase ligase [Ketogulonicigenium vulgare
           Y25]
          Length = 253

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P       FD+I ST  E  ++   G    LWI+A  QTAG GRR   W    GN   +
Sbjct: 7   WPAGVDRIIFDSIDSTMLEARRQLALGLTRPLWILAHDQTAGHGRRGRAWTHPAGNFAGT 66

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++     +  S  L SF ++ A+R+ +++ +     + +KWPND+L+   KIAGIL+E+ 
Sbjct: 67  VVFRPGGTPHSAGLRSFLMSNALRTALSAFVD-PARLGLKWPNDVLLDGGKIAGILLESS 125

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                +  + +G+G+N+   P         +         +   + L +  A    ++  
Sbjct: 126 AQGAAVDWLAIGVGVNLAMAPDSDGAAFAPVALGAHPPHPEVFLTHLARAFAAQEAIFAT 185

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D     I N W   A   G  IT +L   +  GRF G+DD G L+L    G  R I   +
Sbjct: 186 DG-FAPIRNEWLKHAVMRGKTITARLPNVTYEGRFDGIDDDGNLMLTCADGP-RTIAAAE 243

Query: 250 I 250
           +
Sbjct: 244 V 244


>gi|158319495|ref|YP_001512002.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus oremlandii
           OhILAs]
 gi|158139694|gb|ABW18006.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus oremlandii
           OhILAs]
          Length = 326

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 106/246 (43%), Gaps = 7/246 (2%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLY 67
            +        FD+I STN      A    +    I++  Q AGRGRR   W S K   ++
Sbjct: 75  GHTMGRELIVFDSIDSTNTYGKNNA-DHLMDGTIILSEEQLAGRGRRGKDWSSPKGTGIW 133

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
            S++L   I        +   A A+   I        D  IKWPNDI+V  RK+ GIL E
Sbjct: 134 MSMVLKPDIPPTEGVKTTQIAAAAVCKAIRDLTG--LDALIKWPNDIVVNGRKVCGILTE 191

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYP---VTSLQREGGCIDLKDIFSLLFQDVARVL 184
                N +  +VVGIG+NV +            +     G  ID K++   + ++   + 
Sbjct: 192 MAGQLNKIDYIVVGIGINVNNTEFPEGISAVATSLQIEYGKKIDRKELIVRIIKNFEALY 251

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             + ++    E++ + R ++  IG  I +       +     +D+ G+L++E   G    
Sbjct: 252 HSYIENLNLTEVVAIVRDYSAVIGKEIKVIHGTSERIVTVHDIDEEGFLIVESGDGKREV 311

Query: 245 IFTGDI 250
           IF+G++
Sbjct: 312 IFSGEV 317


>gi|161510992|ref|YP_087967.2| biotin--protein ligase [Mannheimia succiniciproducens MBEL55E]
          Length = 313

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 61/250 (24%), Positives = 106/250 (42%), Gaps = 7/250 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + LS+   P+  R      I STN   +             ++  QTAGRGRR  +W+S 
Sbjct: 63  ARLSKALFPH--RVVIQPVIDSTNQYILNHLAELKK-GDLCLSEHQTAGRGRRGRQWLSP 119

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
                   +     ++  L  LS  I +A+   I S      ++ +KWPND+L+  RK+A
Sbjct: 120 FAGQLILSIYWTLNARKPLDGLSLVIGMAIADAIKSAGG--KEINLKWPNDLLLNGRKLA 177

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP--VDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           GILIE  N +     +V+GIG+N+           P   L      +D  ++   + + +
Sbjct: 178 GILIEIANRQQDQLNLVIGIGINLSLPKLKAQIDQPWAELCEILPQLDRNELLIRVVKHL 237

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L  ++++         W          + I     +I G   G+D+ GY+L++ K G
Sbjct: 238 YLYLAAFEREGINAVFREKWAETDYYFNKEVNIITEKQTITGINQGIDENGYILIKTKNG 297

Query: 241 CVRQIFTGDI 250
            + +   G++
Sbjct: 298 ELLKFNGGEV 307


>gi|146341099|ref|YP_001206147.1| putative biotin--[acetyl-CoA-carboxylase] synthetase
           [Bradyrhizobium sp. ORS278]
 gi|146193905|emb|CAL77922.1| putative Biotin--[acetyl-CoA-carboxylase] synthetase
           (Biotin--protein ligase), birA-like protein
           [Bradyrhizobium sp. ORS278]
          Length = 269

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 82/242 (33%), Positives = 121/242 (50%), Gaps = 10/242 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            FD   STN E +  A +G     W V + QTAGRGRR   WI+ +GNL +S+L +  + 
Sbjct: 18  VFDQAGSTNVEALVAARNGAKAPCWFVTTEQTAGRGRRHRPWIAPRGNLASSVLEVLDVI 77

Query: 78  KDSLTLLSFAIAVAMRSVIASTL---------PVGTDVKIKWPNDILVFQRKIAGILIET 128
                 L FA  +A+ + +                 D+ +KWPND+L   RKI G+L+E 
Sbjct: 78  PAVAATLGFAACLAIENALRQVSLEAVLRSGGSPALDLAVKWPNDVLAGGRKIVGMLLEA 137

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             + +GL AVV GIG NV   P DTP P  SL+  G  +  +D+F+ L  +      +W 
Sbjct: 138 EQVASGL-AVVAGIGTNVVAAPTDTPTPAVSLRDLGVEVSAEDLFTALSDNWVEYFGIWN 196

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G  +I  LW   A G+G  + I+  +  I G F  +D+ G +L+   +G +  I  G
Sbjct: 197 AGRGFGDIRKLWLERAAGLGQPVAIRSGHAIIEGIFDTIDEQGCMLVRTAEGRLEPITAG 256

Query: 249 DI 250
           D+
Sbjct: 257 DV 258


>gi|209885066|ref|YP_002288923.1| biotin-[acetyl-CoA-carboxylase] ligase [Oligotropha carboxidovorans
           OM5]
 gi|209873262|gb|ACI93058.1| biotin-[acetyl-CoA-carboxylase] ligase [Oligotropha carboxidovorans
           OM5]
          Length = 259

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 119/238 (50%), Gaps = 2/238 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   F++  STN E   R   G+ G LW+  + QTAG GRR   WIS  GNL  S++  
Sbjct: 14  YRLASFESAGSTNAEARARVRDGERGPLWLATAHQTAGHGRRQRAWISPPGNLACSVIET 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
               +     L FA  +A+ + +          ++KWPND+L  + K+AGILIE     +
Sbjct: 74  IETDQAHAATLGFAAGLALETALRRVCGEAASFQLKWPNDVLAGEAKLAGILIEAEQSPD 133

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           GL AVV G+G+N+   P DTPYP TSL   G   D   +F+ L    A    LW    G 
Sbjct: 134 GLAAVV-GMGVNIVVAPDDTPYPATSLAALGITADAPALFAALSDAWAEWFALWDHGRGF 192

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I   W   A G+G  + ++     + G F  +D+ G+L+L  + G   +I  GD++
Sbjct: 193 AAIRAQWLTRAAGLGAPLKVRQGERLVEGYFETIDEGGHLVL-SRDGQQTRIAAGDVY 249


>gi|239831700|ref|ZP_04680029.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum intermedium LMG
           3301]
 gi|239823967|gb|EEQ95535.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum intermedium LMG
           3301]
          Length = 265

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/245 (31%), Positives = 130/245 (53%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+T+ STN   ++RA +GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLESFETVGSTNAVALERAAAGDPGRLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+L+   K++GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAIFAATGPAVPPTIGLKWPNDVLLNGAKLSGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  +  GL AV +GIG NV   P D PY  TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSIMGKGLFAVAIGIGTNVVAFPDDLPYAATSLRSLGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + G F  +D+    ++ E  G    + 
Sbjct: 192 WNEGRGLDDIRKRWLERAHGLGQRVTMQVEGRIVEGHFDTIDEACRFVIREDDGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|306843753|ref|ZP_07476352.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO1]
 gi|306275944|gb|EFM57657.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO1]
          Length = 265

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW++   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLITKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|254718925|ref|ZP_05180736.1| biotin--protein ligase [Brucella sp. 83/13]
 gi|265983912|ref|ZP_06096647.1| biotin-acetyl-CoA-carboxylase ligase [Brucella sp. 83/13]
 gi|306838227|ref|ZP_07471079.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. NF 2653]
 gi|264662504|gb|EEZ32765.1| biotin-acetyl-CoA-carboxylase ligase [Brucella sp. 83/13]
 gi|306406671|gb|EFM62898.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. NF 2653]
          Length = 265

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRIVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|225627313|ref|ZP_03785350.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ceti str. Cudo]
 gi|225617318|gb|EEH14363.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ceti str. Cudo]
          Length = 300

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 47  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 106

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 107 LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 166

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 167 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 226

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 227 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 286

Query: 247 TGDIF 251
            GD++
Sbjct: 287 AGDVY 291


>gi|163843089|ref|YP_001627493.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis ATCC 23445]
 gi|163673812|gb|ABY37923.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis ATCC 23445]
          Length = 265

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAGTGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|23501703|ref|NP_697830.1| biotin--protein ligase [Brucella suis 1330]
 gi|254701584|ref|ZP_05163412.1| biotin--protein ligase [Brucella suis bv. 5 str. 513]
 gi|254704131|ref|ZP_05165959.1| biotin--protein ligase [Brucella suis bv. 3 str. 686]
 gi|254706968|ref|ZP_05168796.1| biotin--protein ligase [Brucella pinnipedialis M163/99/10]
 gi|254709924|ref|ZP_05171735.1| biotin--protein ligase [Brucella pinnipedialis B2/94]
 gi|254713925|ref|ZP_05175736.1| biotin--protein ligase [Brucella ceti M644/93/1]
 gi|254717017|ref|ZP_05178828.1| biotin--protein ligase [Brucella ceti M13/05/1]
 gi|256060928|ref|ZP_05451086.1| biotin--protein ligase [Brucella neotomae 5K33]
 gi|256159538|ref|ZP_05457306.1| biotin--protein ligase [Brucella ceti M490/95/1]
 gi|256254825|ref|ZP_05460361.1| biotin--protein ligase [Brucella ceti B1/94]
 gi|256369248|ref|YP_003106756.1| biotin--protein ligase [Brucella microti CCM 4915]
 gi|260168551|ref|ZP_05755362.1| biotin--protein ligase [Brucella sp. F5/99]
 gi|261218824|ref|ZP_05933105.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M13/05/1]
 gi|261222006|ref|ZP_05936287.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti B1/94]
 gi|261314431|ref|ZP_05953628.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261317470|ref|ZP_05956667.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis B2/94]
 gi|261321677|ref|ZP_05960874.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M644/93/1]
 gi|261324928|ref|ZP_05964125.1| biotin-acetyl-CoA-carboxylase ligase [Brucella neotomae 5K33]
 gi|261752137|ref|ZP_05995846.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 5 str. 513]
 gi|261754797|ref|ZP_05998506.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 3 str. 686]
 gi|261758024|ref|ZP_06001733.1| biotin-protein ligase [Brucella sp. F5/99]
 gi|265997970|ref|ZP_06110527.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M490/95/1]
 gi|294852173|ref|ZP_06792846.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella sp. NVSL 07-0026]
 gi|23347626|gb|AAN29745.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis 1330]
 gi|255999408|gb|ACU47807.1| biotin--protein ligase [Brucella microti CCM 4915]
 gi|260920590|gb|EEX87243.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti B1/94]
 gi|260923913|gb|EEX90481.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M13/05/1]
 gi|261294367|gb|EEX97863.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M644/93/1]
 gi|261296693|gb|EEY00190.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis B2/94]
 gi|261300908|gb|EEY04405.1| biotin-acetyl-CoA-carboxylase ligase [Brucella neotomae 5K33]
 gi|261303457|gb|EEY06954.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261738008|gb|EEY26004.1| biotin-protein ligase [Brucella sp. F5/99]
 gi|261741890|gb|EEY29816.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 5 str. 513]
 gi|261744550|gb|EEY32476.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 3 str. 686]
 gi|262552438|gb|EEZ08428.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M490/95/1]
 gi|294820762|gb|EFG37761.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella sp. NVSL 07-0026]
          Length = 265

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|150392216|ref|YP_001322265.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus metalliredigens
           QYMF]
 gi|149952078|gb|ABR50606.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus metalliredigens
           QYMF]
          Length = 326

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 107/242 (44%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               ++FDTI STN      AL        +++  Q  GRGR    W S K   ++ SL+
Sbjct: 79  GKEIKYFDTIDSTNTYSKTIALE-VPHGTIVMSDEQVGGRGRLGRNWSSPKGEGIWMSLI 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I  +    +S   A A+   I        +  +KWPNDI++  +K+ GIL E    
Sbjct: 138 LKPGIPPNEGMKVSHIAAAAVCKGIREITG--LEALVKWPNDIVINGKKVCGILTEVAGE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWK 188
            N +  ++VGIG+NV +    T     +           D K++   +     +  D + 
Sbjct: 196 LNEIHYLIVGIGINVNNIDFPTELEEKASSLLIEGKKKYDRKELIVKIISIFEKFYDSFI 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K+   EE++ L R ++  IG  + I         + +G+ D G+L +E   G +  IF+G
Sbjct: 256 KEGSLEEVLRLCRQYSALIGREVVIIKGGSQEAAKVLGMTDEGFLEVELSDGRIEHIFSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|161618780|ref|YP_001592667.1| biotin--acetyl-CoA-carboxylase ligase [Brucella canis ATCC 23365]
 gi|260566620|ref|ZP_05837090.1| biotin-protein ligase [Brucella suis bv. 4 str. 40]
 gi|161335591|gb|ABX61896.1| biotin--acetyl-CoA-carboxylase ligase [Brucella canis ATCC 23365]
 gi|260156138|gb|EEW91218.1| biotin-protein ligase [Brucella suis bv. 4 str. 40]
          Length = 265

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 130/245 (53%), Gaps = 5/245 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+  + ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACHFVIREDEGSRVAVT 251

Query: 247 TGDIF 251
            GD++
Sbjct: 252 AGDVY 256


>gi|297617464|ref|YP_003702623.1| biotin/acetyl-CoA-carboxylase ligase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145301|gb|ADI02058.1| biotin/acetyl-CoA-carboxylase ligase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 349

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/252 (25%), Positives = 109/252 (43%), Gaps = 15/252 (5%)

Query: 11  PYSFRYEF------FDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDK 63
           P   +  F       D  SSTN    + A  G       ++A+ QT G+GRR  +W S  
Sbjct: 98  PGPRKVRFGSQRLQLDETSSTNTVAWEMADQGRLAEGGIVIAARQTQGKGRRGRRWESPA 157

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           G L+ S++L   +    +  LS   A+A+   +   +     V  KWPND+L+  +K+AG
Sbjct: 158 GGLWLSIVLYPELQVRDVVPLSLVFALAVACALQRFITAPVKV--KWPNDVLLGGKKVAG 215

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVD-----TPYPVTSLQREGGCIDLKDIFSLLFQ 178
           IL+E     + ++ VV GIG+NV     D          +     G   DL+ + S +  
Sbjct: 216 ILLEINTEFDMIKYVVAGIGVNVNLRAEDLPAALRDQATSLYLETGQEFDLEAVLSAILA 275

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
           ++ +    + +   +      +       G  +T+      + G   G+DD G L L+ K
Sbjct: 276 ELEKAYARYLETGFKGLRRQ-FMERCAHFGQPVTVHTQGRDLSGIDQGIDDHGCLRLKLK 334

Query: 239 KGCVRQIFTGDI 250
            G + ++  GD+
Sbjct: 335 DGRLVRVTAGDV 346


>gi|315634470|ref|ZP_07889755.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Aggregatibacter segnis ATCC 33393]
 gi|315476697|gb|EFU67444.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Aggregatibacter segnis ATCC 33393]
          Length = 310

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 107/248 (43%), Gaps = 7/248 (2%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            L+E   P  +       ISSTN   ++            +A  QTAGRGRR  +WIS  
Sbjct: 64  RLAEALKP--YHVVVKPVISSTNQYLLENVAHLQK-GALCLAEYQTAGRGRRGRQWISPF 120

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
                         +  L  LS  I +A+   +      G  V  KWPNDILV +RK+AG
Sbjct: 121 AGQIIMSFYWQLDPRKPLDGLSTVIGLAIVQALVELDMYGFQV--KWPNDILVNERKLAG 178

Query: 124 ILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +N  NG   +VVGIG+NV          P   L      ID + +   +   + R
Sbjct: 179 ILVEIVNRPNGKLNLVVGIGMNVSLGQEKQIDQPWAELAEFFPHIDRERLIIQMVNTIYR 238

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L  +++     E+   W  +   +G  + +     +I G   G++  G+L L  +KG V
Sbjct: 239 YLARFEQHGIDAEMQQQWLEYDAYLGTEVNVISEKNTISGIEQGINAQGHLCLMTEKG-V 297

Query: 243 RQIFTGDI 250
           +    G++
Sbjct: 298 QYFNAGEV 305


>gi|188584727|ref|YP_001916272.1| biotin--acetyl-CoA-carboxylase ligase [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349414|gb|ACB83684.1| biotin--acetyl-CoA-carboxylase ligase [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 323

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 115/242 (47%), Gaps = 15/242 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            ++  +FD I STN+               ++A  QT GRGR    W S  G +Y SL++
Sbjct: 87  DYQITYFDNIDSTNNYARSL-----QPPQVVIAEQQTKGRGRMGRAWFSAPGGIYFSLVI 141

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
               S D +  +   I+ A+  V+     +G   +IKWPNDILV  +K+ GIL+E     
Sbjct: 142 TPRCSVDEIPTIPLLISTAITKVLKR--ELGIQAEIKWPNDILVQGQKVTGILVELAGET 199

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDLW 187
           +  Q  V+G+G+N        P  +        +     ++ K + + + +++ ++   +
Sbjct: 200 DAPQKAVIGVGINANQNTNLFPEELKKSVTSLRELNCSPVNRKLMLNSILEEITQLF--F 257

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +      +++N W+ ++C +G  IT+K    +I G    +D  G L++E  +G  R I T
Sbjct: 258 ELPNCIPKVLNTWKEYSCTLGKKITVKQVSKTITGIAKDIDRSGALIVETPQGEQR-ILT 316

Query: 248 GD 249
           GD
Sbjct: 317 GD 318


>gi|71281377|ref|YP_271389.1| biotin--protein ligase [Colwellia psychrerythraea 34H]
 gi|71147117|gb|AAZ27590.1| birA bifunctional protein [Colwellia psychrerythraea 34H]
          Length = 333

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/260 (25%), Positives = 107/260 (41%), Gaps = 13/260 (5%)

Query: 1   MFSNLSECQNPYSFR------YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGR 54
           + S L++ +NP + +       E    I STND  M+R  +        +A  Q+AGRGR
Sbjct: 71  IISLLADEKNPQAEKQSDLPLIEVHSLIDSTNDYLMRRLPNQVTSGQVCLAEYQSAGRGR 130

Query: 55  RDNKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPND 113
           R  +WIS  G+ +Y S+             LS   A+A+   + +       V++KWPND
Sbjct: 131 RGRQWISPFGSQIYLSMYWYLEQGLSGAMGLSLLTALAVSDAVKA--HSNVQVQLKWPND 188

Query: 114 ILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLK 170
           I +   K+AGILI+           V+GIGLN+              T LQ        +
Sbjct: 189 IYLDGVKLAGILIDLEGQALEPSHCVIGIGLNLHMPVDAGKLIEQKWTDLQSHSKVKIDR 248

Query: 171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDF 230
           +  S       R      +  G   ++  W      +   + +        G   GV++ 
Sbjct: 249 NGLSAQLISCLRKRLQQHQQVGLVPMLEEWHAHDAFLNKRVKLITGERVTHGICRGVNNQ 308

Query: 231 GYLLLEEKKGCVRQIFTGDI 250
           G LLLE   G V+ ++ G++
Sbjct: 309 GALLLE-VDGQVKPVYGGEV 327


>gi|317128613|ref|YP_004094895.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus cellulosilyticus DSM
           2522]
 gi|315473561|gb|ADU30164.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus cellulosilyticus DSM
           2522]
          Length = 323

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 112/239 (46%), Gaps = 5/239 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + DT++ST     K    G      IVA+ QT+GRGR   +W S     ++ SL++ 
Sbjct: 81  NIIYEDTVTSTQQVAYKLLGEGAPHGTLIVANEQTSGRGRLGREWYSPANTGIWMSLIMR 140

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       L+   AVA+   I        DV+IKWPND++   +KIAGIL E  +  +
Sbjct: 141 PNIEMQQTPQLTLVAAVALARAIKEATNY--DVQIKWPNDLIFNGKKIAGILTEMQSDPD 198

Query: 134 GLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +++V++GIG+NV     P       +SL  E      +      F    + L     + 
Sbjct: 199 RVKSVIIGIGINVNQQTFPESIANIASSLSLETRETFHRVAIIEHFLREFQWLYHTYLEK 258

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW   A  IG+ I  K + G + G   G+ D G LLL++ +G   +I++ DI
Sbjct: 259 GFSFIKPLWEARAISIGEEILAKTANGELKGVAEGISDEGVLLLKDSEGNSHRIYSADI 317


>gi|160893120|ref|ZP_02073908.1| hypothetical protein CLOL250_00666 [Clostridium sp. L2-50]
 gi|156865203|gb|EDO58634.1| hypothetical protein CLOL250_00666 [Clostridium sp. L2-50]
          Length = 326

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 100/242 (41%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                ++D   STN        +        VA+ Q AGRGRR   W + K  ++  + L
Sbjct: 78  GRELYYYDETDSTNIRAKLAGETDGTHGALFVANEQNAGRGRRGRAWSTPKGTSIAMTFL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +  ++++ L+   A+A    +A T       +IKWPND++V  +KI GIL E  + 
Sbjct: 138 LRPDVPIENVSRLTILSALATARALADTAG--LQAQIKWPNDVVVGGKKICGILTEMSSE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDLWK 188
              ++  VVGIG+NV            +   +       D   + + +      + D + 
Sbjct: 196 GMDIKYAVVGIGINVSMMEFPEELADKATSIKLENGTGCDRSKLVASVANHFEELYDAFV 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K    + +++ +        + + +   Y       +G+   G L +++K G    I +G
Sbjct: 256 KCQDLQFMLDEYNSILVNKDEQVYVIEGYNRTEYTALGLAPNGGLRVKDKDGQESIIISG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|52306882|gb|AAU37382.1| BirA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 360

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/250 (24%), Positives = 106/250 (42%), Gaps = 7/250 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + LS+   P+  R      I STN   +             ++  QTAGRGRR  +W+S 
Sbjct: 110 ARLSKALFPH--RVVIQPVIDSTNQYILNHLAELKK-GDLCLSEHQTAGRGRRGRQWLSP 166

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
                   +     ++  L  LS  I +A+   I S      ++ +KWPND+L+  RK+A
Sbjct: 167 FAGQLILSIYWTLNARKPLDGLSLVIGMAIADAIKSAGG--KEINLKWPNDLLLNGRKLA 224

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP--VDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           GILIE  N +     +V+GIG+N+           P   L      +D  ++   + + +
Sbjct: 225 GILIEIANRQQDQLNLVIGIGINLSLPKLKAQIDQPWAELCEILPQLDRNELLIRVVKHL 284

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L  ++++         W          + I     +I G   G+D+ GY+L++ K G
Sbjct: 285 YLYLAAFEREGINAVFREKWAETDYYFNKEVNIITEKQTITGINQGIDENGYILIKTKNG 344

Query: 241 CVRQIFTGDI 250
            + +   G++
Sbjct: 345 ELLKFNGGEV 354


>gi|294498155|ref|YP_003561855.1| bifunctional protein BirA [Bacillus megaterium QM B1551]
 gi|294348092|gb|ADE68421.1| bifunctional protein BirA [Bacillus megaterium QM B1551]
          Length = 329

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 111/241 (46%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             + +++ ST     + A  G      +VA  QTAGRGR D  W S K    + S++L  
Sbjct: 86  IHYEESVHSTQKIAHRIAQEGAKEGTVVVAEEQTAGRGRLDRAWYSPKYTGAWMSIILRP 145

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           SI       L+   AVA+   I     +  D  IKWPND+L+  +K+ GIL E     + 
Sbjct: 146 SIPPQQAPQLTLLSAVAVVQAIQEVTNLSPD--IKWPNDVLLNGKKLVGILTEMQADFDR 203

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWKK 189
           + +V++GIG+NV     D    +  +       +G  I+   +    F  +  + + + K
Sbjct: 204 IHSVIIGIGINVNQQETDFNEQIKHIATSLRIEKGEEINRAALMQAFFLKLETLYEEYLK 263

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +     I  LW  +A  IG  I  +    +I G   G+ D G LL+E+ +G + +I + D
Sbjct: 264 NG-FGLIKVLWETYAISIGKRIIARTMTANIEGFAKGITDEGVLLIEDDEGVIHRIHSAD 322

Query: 250 I 250
           I
Sbjct: 323 I 323


>gi|295703506|ref|YP_003596581.1| bifunctional protein BirA [Bacillus megaterium DSM 319]
 gi|294801165|gb|ADF38231.1| bifunctional protein BirA [Bacillus megaterium DSM 319]
          Length = 329

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 111/241 (46%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             + +++ ST     + A  G      +VA  QTAGRGR D  W S K    + S++L  
Sbjct: 86  IHYEESVHSTQKIAHRIAQEGAKEGTVVVAEEQTAGRGRLDRAWYSPKYTGAWMSIILRP 145

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +I       L+   AVA+   I     +  D  IKWPND+L+  +K+ GIL E     + 
Sbjct: 146 AIPPQQAPQLTLLSAVAVVQAIQEVTNLSPD--IKWPNDVLLNGKKLVGILTEMQADFDR 203

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWKK 189
           + +V++GIG+NV     D    +  +       +G  I+   +    F  +  + + + K
Sbjct: 204 IHSVIIGIGINVNQQETDFNEQIKHIATSLRIEKGEEINRAALMQAFFLKLETLYEEYLK 263

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +     I  LW  +A  IG  I  +    +I G   G+ D G LL+E+ +G + +I + D
Sbjct: 264 NG-FGLIKVLWETYAISIGKRIIARTMTANIEGFAKGITDEGVLLIEDDEGVIHRIHSAD 322

Query: 250 I 250
           I
Sbjct: 323 I 323


>gi|150015901|ref|YP_001308155.1| biotin--acetyl-CoA-carboxylase ligase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902366|gb|ABR33199.1| biotin--acetyl-CoA-carboxylase ligase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 323

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                +FD I STN +  + A         ++A  QT G GR + KW+S  G L+ SL+L
Sbjct: 78  GKSIVYFDKIDSTNIKAKELAQKEIEHGTIVIAEKQTLGSGRFNRKWVSPNGGLWFSLIL 137

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +       ++   A ++   +++    G +  IKWPNDIL+  +K  GIL E     
Sbjct: 138 RPKLPPTEAPKITQIAAASVYKTLSNL---GINSTIKWPNDILLNDKKFCGILAEMKCDM 194

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLW 187
           + +  +V+G+G+N+     D    + ++               +I S    +   + + +
Sbjct: 195 DSVHYLVLGVGMNINIDESDFDDNIKAIATSLKIEYDKDFKRSEILSAFLNNFEVLYNNF 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
                  E +++ R  +  +G    +       +   V V D G L++ +  G  + + T
Sbjct: 255 INKLDLSETISICRNHSNILGRKAKLITYNNEEIVTCVSVSDNGDLMVIDSNGNEKAVIT 314

Query: 248 GDI 250
           G+I
Sbjct: 315 GEI 317


>gi|260654182|ref|ZP_05859672.1| biotin-[acetyl-CoA-carboxylase] ligase [Jonquetella anthropi E3_33
           E1]
 gi|260631167|gb|EEX49361.1| biotin-[acetyl-CoA-carboxylase] ligase [Jonquetella anthropi E3_33
           E1]
          Length = 328

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
               E    + STN  C  RA  G    L I A  QTAGRGR    W SD+   L  SLL
Sbjct: 83  GRSCEILAQVDSTNTLCRTRAREGASDGLVIAAEHQTAGRGRSGRTWHSDQCQALQFSLL 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++      L++   A AM   + S      + +IKWPND+L+  +K+ GIL E    
Sbjct: 143 LRPALPPSRAALITQIGAAAMAQALVSAGF---EPQIKWPNDLLLNGKKVCGILTEMSCE 199

Query: 132 KNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  V++G+GLNV      P       +     G   D   + +        + D + 
Sbjct: 200 LDRIHWVIMGVGLNVNQTDFPPDIEGIATSLAAVSGKTHDRTALLAKFLNAFEPLFDDYL 259

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +    + + + R  +   G  I+     G +     +G+D  G L +    G +R++ +
Sbjct: 260 ANPASPQALEICRRRSSLTGREISFTDDAGLAQKAIVLGIDSVGRLEVRLADGQLRRLLS 319

Query: 248 GDI 250
           G++
Sbjct: 320 GEV 322


>gi|319651318|ref|ZP_08005448.1| biotin synthetase [Bacillus sp. 2_A_57_CT2]
 gi|317397098|gb|EFV77806.1| biotin synthetase [Bacillus sp. 2_A_57_CT2]
          Length = 327

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 105/243 (43%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +    +++ ST     + A  G      I+A  Q +GRGR D +W S K   ++ S++
Sbjct: 83  GRQIHHEESVDSTQKIAHRLAYEGAQEGTVIIAEEQLSGRGRMDRRWHSPKSTGVWMSVI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+   AVA+   I          +IKWPNDIL+  +K+ GIL E    
Sbjct: 143 LRPNIPPPKAPQLTLITAVAVVQAIEEL--TDLTPQIKWPNDILMNGKKVTGILTELQAD 200

Query: 132 KNG----LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            +     +  + + +   +   P +     TS+  E G    +     +       L   
Sbjct: 201 ADRIISIIIGIGINVNQELDDYPDELKDIATSISIEKGEKLSRAELIRVLLAKLENLYKL 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D G   I  LW  +A  IG  +T +   GSI G+ +G+ + G L++E+  G V  +++
Sbjct: 261 YLDKGFYPIKLLWESYAVSIGKNLTARTITGSIYGKALGITEDGVLMIEDSSGKVHHVYS 320

Query: 248 GDI 250
            DI
Sbjct: 321 ADI 323


>gi|170761513|ref|YP_001786507.1| birA bifunctional protein [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169408502|gb|ACA56913.1| birA bifunctional protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 327

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKCIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVVT---ALLHNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEKEDLPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I       LG+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRNRESLGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|218135125|ref|ZP_03463929.1| hypothetical protein BACPEC_03030 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990510|gb|EEC56521.1| hypothetical protein BACPEC_03030 [Bacteroides pectinophilus ATCC
           43243]
          Length = 341

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 102/247 (41%), Gaps = 11/247 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +    D + STN+   K A         +VA  QT G+GRR   W S     ++ + +L 
Sbjct: 86  KLVCRDIVDSTNNVARKLAEDMACHGTLVVAEQQTGGKGRRGRHWESPAGTGIWMTYVLR 145

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLP---VGTDVKIKWPNDILVFQRKIAGILIETLN 130
             IS D  ++L+   A+A+   I   L       +  IKWPNDI++  RKI GIL E   
Sbjct: 146 PDISPDRASMLTLVAALAVADGIKEQLHAAGCDCEFGIKWPNDIVLNGRKIVGILTEMSA 205

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG---CIDLKDIFSLLFQDVARVLDLW 187
             + +  VVVGIG+NV     D     T+          I    I + + +      +++
Sbjct: 206 TPDSVNYVVVGIGINVNTTEFDDSIKATASSILVQTGLHIQRSRIIASVSRRFEEYYNIF 265

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYG----SILGRFVGVDDFGYLLLEEKKGCVR 243
            K    E ++  +       G  + +  S         G   G+D  G L++    G ++
Sbjct: 266 IKTANLEGLIEQYNSALINAGREVRLISSDNGTEHEETGVAKGIDMNGELIVRLDDGTMK 325

Query: 244 QIFTGDI 250
            +  G++
Sbjct: 326 NVIAGEV 332


>gi|194337809|ref|YP_002019603.1| biotin/acetyl-CoA-carboxylase ligase [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194310286|gb|ACF44986.1| biotin/acetyl-CoA-carboxylase ligase [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 328

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 98/242 (40%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +     +    +STN E    A  G      + A CQ+ GRGR    W+S  G NLY SL
Sbjct: 80  FGRNILYHPLTTSTNIEAKALAAEGAPEGSVVAADCQSGGRGRMGRSWVSPPGVNLYFSL 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  ++    +  L+  +A A+   +           IKWPNDIL   +K+ G+L E  +
Sbjct: 140 ILRPAVPSVRVPQLTLLVAAAIHQALCR-HSSDLVAMIKWPNDILADGKKLCGVLCEMQS 198

Query: 131 LKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             +    VVVGIG+NV      P       +     G      ++ + +      + D W
Sbjct: 199 EPDCTHFVVVGIGINVNQSEFPPDLQQSATSLFLESGQLFSRPELLASVLNHFEPLYDAW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +     I+      A      +TI     S+ G   G+  FG L LE  +G    + +
Sbjct: 259 LLEDDLGFILPYLEEHALLQSKEVTIDQLKRSVRGTVRGISRFGELKLESAEGETILVSS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|288940040|ref|YP_003442280.1| biotin/acetyl-CoA-carboxylase ligase [Allochromatium vinosum DSM
           180]
 gi|288895412|gb|ADC61248.1| biotin/acetyl-CoA-carboxylase ligase [Allochromatium vinosum DSM
           180]
          Length = 332

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 109/242 (45%), Gaps = 10/242 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R +    I STN E M+ A  G       +A  QTAGRGRR  +W+S  G NLY SLL  
Sbjct: 85  RLDIHPLIGSTNSELMRLAAEGAPSGSVCLAERQTAGRGRRGREWVSPFGVNLYLSLLWR 144

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
              +  +L   S A+   +   +           +KWPND+L  +RK+AG+L+E      
Sbjct: 145 YPFAPSNLGGASLAVGAVLADALNGL--GTEGPALKWPNDLLWRRRKLAGLLLEVAGESQ 202

Query: 134 GLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           G   +VVG+GLN++        +D P+           I    + + L + +   LD + 
Sbjct: 203 GPCHLVVGLGLNLRMTAGQGSAIDQPWTSLETMLGTAMIGRNALVARLLEALLEALDRY- 261

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G    +  WR     +G+ + + +    I G   GV + G LLLE  +GC R    G
Sbjct: 262 GREGLSPFLTRWRAHDAYLGEPVRLLIGERVIEGVHAGVGEDGSLLLETSEGC-RTFQAG 320

Query: 249 DI 250
           ++
Sbjct: 321 EV 322


>gi|330962541|gb|EGH62801.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 319

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 115/249 (46%), Gaps = 5/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           S +++   P  +    +D+I STN E  +    G    L ++A  QT+GRGRR  KW+S 
Sbjct: 65  SAITQSGLPEGWTVRTYDSIDSTNAEAARLIAEGISMPLLVLAEQQTSGRGRRGRKWVSP 124

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY S++L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSVVLRIDGGMRQLEGLSLLVGLAVMNVLRDLGVSG--AGLKWPNDVLVGKQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           AGIL+E +     +  V++GIG+NV      +     TS++ E G +  ++  +      
Sbjct: 183 AGILLELIGDPADVCHVIIGIGVNVNMQASTEVDQSWTSIRLETGNLADRNEVAARISAR 242

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L    +D G       W       G  +T+     ++ G  +GVD  G L LE   G
Sbjct: 243 LDALLHVHRDKGFAAFREDWERGHLWQGSAVTLLSGVQTVEGVVLGVDLLGALRLE-VNG 301

Query: 241 CVRQIFTGD 249
             +    G+
Sbjct: 302 VEKSFSGGE 310


>gi|169830343|ref|YP_001716325.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637187|gb|ACA58693.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 325

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 107/242 (44%), Gaps = 9/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
              Y +  T+SSTND+  + A  G      IVA  Q+ GRGR    W S +G L+ S++L
Sbjct: 78  GRNYLYHPTLSSTNDQAKESARRGAPEGTTIVAEEQSGGRGRLGRSWHSPRGGLWFSVVL 137

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +         F  AVA    +A+       V +KWPND +   RK+ GIL E     
Sbjct: 138 RPPLPPARAPEAVFVAAVAGVEALAAYPG--VQVGLKWPNDFVWRGRKLGGILTEVTGEL 195

Query: 133 NGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
           + +  +VVGIGLNV        P       +  +  GG +   ++   L   +     +W
Sbjct: 196 DQINHLVVGIGLNVNLDLQDFPPELRTGVTSVREITGGDVSRSELLRQLLAALEHWYLVW 255

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            K      ++  W+     +  L+ +    G ++GR V VD  G LLL    G VR++ T
Sbjct: 256 LKQG-FTPVLAAWKRHNACLDRLLRVLTPEGELVGRAVDVDADGALLLATA-GGVRRVVT 313

Query: 248 GD 249
           G+
Sbjct: 314 GE 315


>gi|332533465|ref|ZP_08409328.1| biotin-protein ligase / biotin operon repressor [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037012|gb|EGI73470.1| biotin-protein ligase / biotin operon repressor [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 330

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 106/242 (43%), Gaps = 10/242 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGD--LGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             E    I STN E M+R  +         IVA  Q AGRGRR   W S    NLY S  
Sbjct: 86  DVEVHPIIDSTNSELMRRIQAKTTLESGTVIVAEMQQAGRGRRGRVWQSPFGANLYYSYF 145

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                   +   +S A+ +A+   I +      DV++KWPNDI + ++K+AG+L+E    
Sbjct: 146 WRLDDGLQAAMGVSIAVGLAVYDAIKALY--QVDVELKWPNDIYINKQKLAGVLVELDGQ 203

Query: 132 KNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             G   +V+GIG+N++             T L +    +D   + + L   + R L  ++
Sbjct: 204 PQGPCQLVIGIGINLQMPESFSQHIDQAWTDLNQHTQKLDKNQLVASLTHHLERRLAQYR 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +    + +   W       G+ + +   + S  G   G+D  G + + +  G V+  + G
Sbjct: 264 QTG-LQAMYEQWNSLNAFAGEYVELNTGHRSWRGICEGIDPQGGIRIRQ-DGEVKSYYGG 321

Query: 249 DI 250
           ++
Sbjct: 322 EV 323


>gi|237794411|ref|YP_002861963.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Clostridium botulinum Ba4 str. 657]
 gi|229261428|gb|ACQ52461.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Clostridium botulinum Ba4 str. 657]
          Length = 327

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI++  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVVT---ALLHNNIKAYIKWPNDIIINNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEKEDLPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I       LG+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRNRESLGKAVGLNSNGELLVQFENGEIKSLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|168182970|ref|ZP_02617634.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Clostridium botulinum Bf]
 gi|182673739|gb|EDT85700.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Clostridium botulinum Bf]
          Length = 327

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVVT---ALLHNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEKEDLPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I       LG+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRNRESLGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|251796454|ref|YP_003011185.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. JDR-2]
 gi|247544080|gb|ACT01099.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. JDR-2]
          Length = 326

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 108/245 (44%), Gaps = 10/245 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +    E+ + + ST +   K A  G      ++A  Q  GRGR    W+S +   ++ S+
Sbjct: 79  FGSAIEWHEAVDSTQNLAQKLAEEGAPEGTLVIAEQQHNGRGRMGRGWVSPQGKGIWMSM 138

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  S+       L+   AVA+   +         + IKWPND+L+  +KI+GIL+E+  
Sbjct: 139 VLRPSVPIHFAPQLTLLTAVALCRSLRRI--TSLPIGIKWPNDLLIEGKKISGILLESTA 196

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPV------TSLQREGGCIDLKDIFSLLFQDVARVL 184
            +  L+ V+ GIG++V     D P  +        +   G   D   + +   Q+  ++ 
Sbjct: 197 EEERLRYVIAGIGISVNLEKTDYPEEMLEKVTSLRIANGGDGFDRITVITDFLQEWEQLY 256

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +L+        I+ LW   +  +     +    G+I G  +G+D  G L + +  G    
Sbjct: 257 NLYLDKG-FAPIITLWEALSVSLNKPARLITPQGTIDGVPIGLDASGALTVRKDDGSTVV 315

Query: 245 IFTGD 249
           +F+ +
Sbjct: 316 VFSAE 320


>gi|116751138|ref|YP_847825.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700202|gb|ABK19390.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 344

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 106/241 (43%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLLLID 74
             + D   STN      A  G      ++A  QTAGRGR+   W    +  +Y SL+L  
Sbjct: 90  IVYLDATDSTNLRAKDLAAGGASEGTIVIAEMQTAGRGRKGRGWFSPPRQGIYVSLILRP 149

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +++      ++    VA    + S      DV+I+WPND++V  RKIAGIL E     + 
Sbjct: 150 TMTPSEAPGITLMTGVAAAEALLSL--TDLDVRIRWPNDLMVGGRKIAGILTEISTEMDR 207

Query: 135 LQAVVVGIGL-----NVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           +  VVVG+G+     +    P       + L   G  +    +   + +       ++ +
Sbjct: 208 IDHVVVGLGVNVNNRHEDLHPQIRESATSVLIETGQVLARAGLIRAILEHFETSYAIFSQ 267

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
               E     W+  +  IG  I +++   ++ G  + +D  G L+L + +GC  +I +GD
Sbjct: 268 KG-FEPFRQRWKELSGIIGRCIVVEMIGRTLAGEVLDIDPEGLLILRDDEGCRHRIVSGD 326

Query: 250 I 250
           +
Sbjct: 327 V 327


>gi|293394011|ref|ZP_06638316.1| biotin--[acetyl-CoA-carboxylase] ligase [Serratia odorifera DSM
           4582]
 gi|291423482|gb|EFE96706.1| biotin--[acetyl-CoA-carboxylase] ligase [Serratia odorifera DSM
           4582]
          Length = 320

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      + STN   + R           VA  Q AGRGRR   W+S    NLY S+   
Sbjct: 80  RVTVLPVVDSTNQYLLDRIAELA-SGDACVAEYQQAGRGRRGRHWVSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMTEVLQRLG--AEKVRVKWPNDLYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+     +         +LQ  G  ID  ++ ++L  ++ R L  ++++
Sbjct: 197 DAAQLVIGAGINLAMRETNADAINQGWINLQEAGITIDRNELAAMLLNEMRRALRQFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ WR     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPFISRWRNLDNFIDRPVKLLIGEQQIFGIARGIDQQGALLLEQ-DGELKPFIGGEI 314


>gi|329121219|ref|ZP_08249846.1| biotin--[acetyl-CoA-carboxylase] ligase [Dialister micraerophilus
           DSM 19965]
 gi|327470153|gb|EGF15616.1| biotin--[acetyl-CoA-carboxylase] ligase [Dialister micraerophilus
           DSM 19965]
          Length = 334

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 104/243 (42%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R  + +   S+N+E    A  G      ++A  QT GRGR    + S     ++ SL+
Sbjct: 87  GKRIVYMEITKSSNNEAKMIAAQGAENGTLVIAEEQTGGRGRLTRNFYSPFAKGIWMSLI 146

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L         +  +   AVA+   +        +  IKWPND+L   +K+ GIL E  + 
Sbjct: 147 LRPKFLPMEASKCTLMAAVAVCKAVRQFGLT--EAGIKWPNDVLYKGKKLVGILTEMSSS 204

Query: 132 KNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  +VVGIG+N        P +     TS   EG  I  K++ + +  ++ +     
Sbjct: 205 MEKIDYIVVGIGINTGIKENEFPEEVRGRATSFLNEGIEISRKELLAAVLFELEKNYIEV 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +K      I+  WR     +G  + I     +  G+   +D  G LL++  KG ++++  
Sbjct: 265 EKYG-FANILEEWRKLTVTLGKNVQIISYGETYTGKAQDIDQDGCLLVKTDKG-IKRVIV 322

Query: 248 GDI 250
           GD+
Sbjct: 323 GDV 325


>gi|313892595|ref|ZP_07826182.1| biotin--[acetyl-CoA-carboxylase] ligase [Dialister microaerophilus
           UPII 345-E]
 gi|313118992|gb|EFR42197.1| biotin--[acetyl-CoA-carboxylase] ligase [Dialister microaerophilus
           UPII 345-E]
          Length = 326

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 104/243 (42%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R  + +   S+N+E    A  G      ++A  QT GRGR    + S     ++ SL+
Sbjct: 79  GKRIVYMEITKSSNNEAKMIAAQGAENGTLVIAEEQTGGRGRLTRNFYSPFAKGIWMSLI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L         +  +   AVA+   +        +  IKWPND+L   +K+ GIL E  + 
Sbjct: 139 LRPKFLPMEASKCTLMAAVAVCKAVRQFGLT--EAGIKWPNDVLYKGKKLVGILTEMSSS 196

Query: 132 KNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  +VVGIG+N        P +     TS   EG  I  K++ + +  ++ +     
Sbjct: 197 MEKIDYIVVGIGINTGIKENEFPEEVRGRATSFLNEGIEISRKELLAAVLFELEKNYIEV 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +K      I+  WR     +G  + I     +  G+   +D  G LL++  KG ++++  
Sbjct: 257 EKYG-FANILEEWRKLTVTLGKNVQIISYGETYTGKAQDIDQDGCLLVKTDKG-IKRVIV 314

Query: 248 GDI 250
           GD+
Sbjct: 315 GDV 317


>gi|119471499|ref|ZP_01613940.1| hypothetical protein ATW7_16780 [Alteromonadales bacterium TW-7]
 gi|119445598|gb|EAW26883.1| hypothetical protein ATW7_16780 [Alteromonadales bacterium TW-7]
          Length = 334

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 110/255 (43%), Gaps = 10/255 (3%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGD--LGNLWIVASCQTAGRGRRDNKW 59
           F+ L+          E    I STN E M+R  +         IVA  Q AGRGRR   W
Sbjct: 77  FNQLTSQLKSQPVNVEVHPLIDSTNSELMRRIQAKTALESGTVIVAEMQQAGRGRRGRVW 136

Query: 60  ISDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
            S    NLY S          +   +S A+ +A+   I +      ++++KWPNDI + +
Sbjct: 137 QSPFGANLYYSYFWRLDDGLQAAMGVSIAVGLAVYDTIKALYD--IELELKWPNDIYLNK 194

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSL 175
           +K+AG+L+E      G   +V+GIG+N++             T L +    +D  ++ + 
Sbjct: 195 QKLAGVLVELDGQPQGPCQLVLGIGINLQMPQSFSQHIDQAWTDLSQHTQQLDKNELVAS 254

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           L   +   LD ++K      +   W       G+ + +   + S  G   G+D  G + +
Sbjct: 255 LTYHLEHRLDQYRKSG-LHTMHEQWNSLNAFAGECVELNTGHRSWRGICEGIDPQGGIRI 313

Query: 236 EEKKGCVRQIFTGDI 250
            +  G V+  + G+I
Sbjct: 314 RQ-DGEVKSYYGGEI 327


>gi|257483169|ref|ZP_05637210.1| biotin--protein ligase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331012396|gb|EGH92452.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 319

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 116/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIARGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G     + W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|218672169|ref|ZP_03521838.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           GR56]
          Length = 254

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 146/240 (60%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L  L  A+AVA+   I     P    +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLGSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+NV   P +  YPVT L++        ++F+ LF  +A VLD W +  
Sbjct: 133 PDGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPDELFAHLFAAMADVLDQWDQGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|330988298|gb|EGH86401.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 319

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 116/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G     + W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|320322338|gb|EFW78432.1| biotin--protein ligase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331996|gb|EFW87932.1| biotin--protein ligase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330879341|gb|EGH13490.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 319

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 116/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G     + W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|289623865|ref|ZP_06456819.1| biotin--protein ligase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648958|ref|ZP_06480301.1| biotin--protein ligase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330869447|gb|EGH04156.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 319

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 116/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G     + W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|193213651|ref|YP_001999604.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobaculum parvum NCIB
           8327]
 gi|193087128|gb|ACF12404.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobaculum parvum NCIB
           8327]
          Length = 329

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 101/242 (41%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +   +   + + STN + +  A  G      +VA  QT GRGR    W+S  G NLY S+
Sbjct: 80  FGRTFIGLEQVDSTNVKALALAREGAAEGTVVVADSQTGGRGRMRRAWVSPPGVNLYCSI 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  +    A A+   +    P      IKWPND++V  RK+ GIL E  +
Sbjct: 140 VLRPPLPSVRVPEIPLVAAAAIHGAVTQECP-ELQAFIKWPNDLIVAGRKVCGILCEMES 198

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLW 187
             +    VVVG GLNV   PV       +       G  +    + + +     R+   W
Sbjct: 199 EPDFTHFVVVGFGLNVNLDPVPDELQGIATSLAIETGRQVSRARLLAAILNRFERLYREW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +     ++      A   G  + I+     + G   G+   G+LLL ++ G V  + +
Sbjct: 259 LDEEDLGSLLPALEEHAWLKGRALQIEQFNRVLTGTEAGLSPQGHLLLRQEDGTVVPVAS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|225375156|ref|ZP_03752377.1| hypothetical protein ROSEINA2194_00780 [Roseburia inulinivorans DSM
           16841]
 gi|225213030|gb|EEG95384.1| hypothetical protein ROSEINA2194_00780 [Roseburia inulinivorans DSM
           16841]
          Length = 325

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 105/242 (43%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  FFD + STN    + A  G     +++A  Q AG+GRR   + S     ++ +L+
Sbjct: 78  GEKIAFFDVVDSTNTRAKQLAEEGAPNGTYVIAERQDAGKGRRGRGFDSPAGQGIWMTLV 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I  +  ++++   A+A+   I  T   G    IKWPNDI++  +K+ GIL E    
Sbjct: 138 LKPEIDPNHASMITLVTALAVSKAI--TDMTGRPAGIKWPNDIIMSGKKVCGILTEMSAQ 195

Query: 132 KNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  +VVGIG+NV+             +            ++   +++      +++ 
Sbjct: 196 FDYVNHIVVGIGVNVQNKSFPKDIESVATSLFIETKEHYHRAELVERIWEAFEHYYEIFL 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +      ++N +      +   + +        G+ +G+   G L+++  +   + + TG
Sbjct: 256 QTEDLSGLVNEYNSHLVNMHQQVKVLDPKEPFEGKAMGITPKGELIVDTWE-SRKLVSTG 314

Query: 249 DI 250
           ++
Sbjct: 315 EV 316


>gi|88861232|ref|ZP_01135865.1| hypothetical protein PTD2_00522 [Pseudoalteromonas tunicata D2]
 gi|88816825|gb|EAR26647.1| hypothetical protein PTD2_00522 [Pseudoalteromonas tunicata D2]
          Length = 334

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 116/242 (47%), Gaps = 10/242 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDL--GNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           ++E F  I STN E M+R  SG L      +V+  QTAGRGRR  +W S    NLY S  
Sbjct: 86  QFELFPVIDSTNSELMRRIQSGQLPDSGTVVVSESQTAGRGRRGRQWQSPFGSNLYFSYY 145

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
            +      +   +S A+ +A+   + +      DV++KWPNDILV ++K+AG+L+E    
Sbjct: 146 WLLDDGLQAAMGVSIAVGLAVYDALKAL--YQIDVQLKWPNDILVHEQKLAGVLVELDGQ 203

Query: 132 KNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            +G   +V+GIGLN+        +     T L   G  +D   + ++L   + + L  ++
Sbjct: 204 PDGPCHLVIGIGLNLNMPVTASANIDQAWTDLALLGCEVDKSKLVAVLTHCLEQRLKQYR 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +    +E+   W       G  + +     S  G   G+D  G + + +  G V+  F G
Sbjct: 264 QSG-LDEMHQQWNQVHAFQGQRVNLITGLRSWQGICEGIDPQGGIKIRQ-NGEVKSYFGG 321

Query: 249 DI 250
           +I
Sbjct: 322 EI 323


>gi|226948391|ref|YP_002803482.1| birA bifunctional protein [Clostridium botulinum A2 str. Kyoto]
 gi|226841960|gb|ACO84626.1| birA bifunctional protein [Clostridium botulinum A2 str. Kyoto]
          Length = 327

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            N +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 INKVNYVVVGMGINVNCEEEDIPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDASIEICKENSILIGKEVRIINRNRESFGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|126179592|ref|YP_001047557.1| biotin--acetyl-CoA-carboxylase ligase [Methanoculleus marisnigri
           JR1]
 gi|125862386|gb|ABN57575.1| biotin--acetyl-CoA-carboxylase ligase [Methanoculleus marisnigri
           JR1]
          Length = 326

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 105/247 (42%), Gaps = 11/247 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL---GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
             +   FD+ +ST     K A   D      + I+A  QT G GR    W+S  G ++A+
Sbjct: 81  GRQIRQFDSTASTGWVAKKLAAETDPENLHGMVIIAEEQTGGVGRLGRAWVSPAGGIWAT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +LL   I  D L +++ A +VA+   I           IKWPNDI +  +K+AG+L+E  
Sbjct: 141 ILLKPKIPLDHLFMITMAGSVAIARAIRK--EYDISALIKWPNDIFIGDKKVAGLLLELA 198

Query: 130 NLKNGLQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +   ++G+G++                 T     G  +D   + + + ++     
Sbjct: 199 AEADTVHYALLGLGIDANVSLDDLSSNLRETVTTLQAEVGREVDRVALLARVLREFELRY 258

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
              +       I+  W+  +  +   + IK    +  G  + +D+ G L++ +  G + +
Sbjct: 259 QQLEDGEYD-SIIREWKSLSRTLDHRVAIKTVNKTFSGEAIDIDEHGALIIRKDNGKIER 317

Query: 245 IFTGDIF 251
           +  GD F
Sbjct: 318 VIAGDCF 324


>gi|168178538|ref|ZP_02613202.1| birA bifunctional protein [Clostridium botulinum NCTC 2916]
 gi|182670526|gb|EDT82500.1| birA bifunctional protein [Clostridium botulinum NCTC 2916]
          Length = 327

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            N +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 INKVNYVVVGMGINVNCEEEDIPKDLLSKATSLKIEKEREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDASIEICKENSILIGKEVRIINRNRESFGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|170754620|ref|YP_001780748.1| birA bifunctional protein [Clostridium botulinum B1 str. Okra]
 gi|169119832|gb|ACA43668.1| birA bifunctional protein [Clostridium botulinum B1 str. Okra]
          Length = 327

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKTYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEKEDLPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINKNRESFGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|49474191|ref|YP_032233.1| biotin-protein ligase birA [Bartonella quintana str. Toulouse]
 gi|49239695|emb|CAF26070.1| Biotin-protein ligase birA [Bartonella quintana str. Toulouse]
          Length = 269

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 88/250 (35%), Positives = 129/250 (51%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++ + STN    +RA +G  G LWIVA  Q+ G  RR   W S KG
Sbjct: 7   LSDFAQKQGYAVESYENVDSTNLIAQRRAYAGHRGYLWIVAQEQSQGMARRGRTWYSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILVFQRK 120
           NLY SLLLID I   +   LSF   V+M   I   +         V +KWPNDIL+ + K
Sbjct: 67  NLYCSLLLIDDIVHQTAAQLSFVAGVSMVEAIKQFVKDENQANSIVSLKWPNDILLKESK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +GIL+E   L     A+V+GIG+NV     D PYP +SL+  G  ++ + +F++L +  
Sbjct: 127 SSGILLEIFKLTFQQYALVIGIGMNVNCHYEDAPYPTSSLKNIGLHVETEQLFTVLTEYF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G + I   W  ++  +G  I I      I G F G+D     ++++K G
Sbjct: 187 SKNYLLWKQPGGCDIIRKKWLLYSAHVGQHIKIINDKKVIEGIFDGLDSAFNCIIKQKNG 246

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 247 QQVTITAGDV 256


>gi|218462143|ref|ZP_03502234.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           Kim 5]
          Length = 254

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 149/240 (62%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +D   +D L  L  A+AVA+   I     P    +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  VDPAPRDRLGSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD+W +  
Sbjct: 133 PDGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDIWDQGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIIPIAAGDVF 252


>gi|319782996|ref|YP_004142472.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168884|gb|ADV12422.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 273

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 127/263 (48%), Gaps = 13/263 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  +++ STN   +  A +GD G LW+V+  Q +GRGRR   W 
Sbjct: 1   MAFRLAPTSASEGFRLEAHESVGSTNALALDHARAGDSGKLWVVSKKQESGRGRRGRVWA 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV-------------GTDVK 107
           + +GNL A+LL+I          L F   +A+   + + +P                  +
Sbjct: 61  TPEGNLAATLLVITKAELRLAATLGFVAGLALADALDAVVPKGRIAIGLDGGSEGKNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L+ G   V VGIG+NV   P D PYP TSL+  G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAILEGGRFGVAVGIGVNVVAYPEDLPYPATSLRALGAAC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   +   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGVAAVRRRWLDRAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           D+    ++ + +G VR I  GD+
Sbjct: 241 DEDCRFVIRDDEGSVRTIAAGDV 263


>gi|300710759|ref|YP_003736573.1| biotin--[acetyl-CoA-carboxylase] ligase [Halalkalicoccus jeotgali
           B3]
 gi|299124442|gb|ADJ14781.1| biotin--[acetyl-CoA-carboxylase] ligase [Halalkalicoccus jeotgali
           B3]
          Length = 307

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 116/240 (48%), Gaps = 13/240 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +  E+ + I STN    + A +G  G + ++A  QTAGRGR +  W +  G +Y S++L
Sbjct: 73  PYEIEYHEAIDSTNARARELAKAGA-GRVAVLAGEQTAGRGRLERAWSAPSGGIYLSIVL 131

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ--RKIAGILIETLN 130
             +++     LL+ A AVA    +      G D  IKWPNDIL+     K+ GIL E   
Sbjct: 132 RPTMTPMQAPLLTLAGAVATTRALREA---GVDAGIKWPNDILLASSGEKLVGILTEMEG 188

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             + +  VV GIG+N        P   TS++ + G ID +     L ++   +       
Sbjct: 189 EADRVSWVVCGIGVNANVDAAALPEGATSVREQVGDIDRRVFTQRLLEEFTTL------R 242

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + I++ WR  A  +G  + ++   G ++GR + ++  G L++   +G VR +  GD 
Sbjct: 243 ADPDAILDRWREHALTLGQRVRVETGAGDVVGRALDIESPGRLVIGTDEGEVR-VHAGDC 301


>gi|118579093|ref|YP_900343.1| biotin--acetyl-CoA-carboxylase ligase [Pelobacter propionicus DSM
           2379]
 gi|118501803|gb|ABK98285.1| biotin--acetyl-CoA-carboxylase ligase [Pelobacter propionicus DSM
           2379]
          Length = 324

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 109/244 (44%), Gaps = 8/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             R    +  +STN +  + A  G      ++A  Q+ G+GR    W S  G NLY S++
Sbjct: 80  GSRIVCLEQTASTNGDAFRLAEQGAAEGTVVLADTQSGGKGRMGRVWSSPPGVNLYCSII 139

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I       L+F  AVA+   I          +IKWPND+L+  +K+AG+L E    
Sbjct: 140 LRPAIMPYEAPQLTFLSAVAVARSIERI--SAIVPEIKWPNDVLIKGQKVAGLLNEMSAE 197

Query: 132 KNGLQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  V++GIG+N+       P D  +P TS+  E G    +  F  +  +    L   
Sbjct: 198 TDAVNFVILGIGVNLNMTAGQFPDDLRHPATSILLESGRPVGRAGFCAIMLNELDRLYAD 257

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSY-GSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  G   +   W+      G  +++       + G F G+D  G LL+    G + +I 
Sbjct: 258 FRTHGFGPVREEWQRRCNAHGRELSVSDGGSEVVRGMFAGIDGSGALLVSGADGAISKIL 317

Query: 247 TGDI 250
           +GD+
Sbjct: 318 SGDV 321


>gi|110597308|ref|ZP_01385596.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium ferrooxidans DSM
           13031]
 gi|110341144|gb|EAT59612.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium ferrooxidans DSM
           13031]
          Length = 327

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 102/242 (42%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     + +T  STN +    A+ G +    + A  QT GRGR    W S    NLY +L
Sbjct: 80  FGRNLFYHETTDSTNLQAKALAVRGSVEGTVVAADSQTGGRGRMGRSWNSPAGKNLYFTL 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  L+  +AVA+   +   +P     KIKWPNDILV ++KI G+L E  +
Sbjct: 140 ILRPEVPSLRVPQLTLLVAVALHRALVRFVP-DLQPKIKWPNDILVNEKKICGVLCEMQS 198

Query: 131 LKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             +    VVVG+G+NV              +     G      ++ +        + D W
Sbjct: 199 EPDCTHFVVVGLGINVNQSEFPAELEGRATSLFLECGRSFSKPELLAAFLNQFEPLYDRW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +     +++     +     ++ ++    +I G   G+   G L+LE   G    + +
Sbjct: 259 LIEEDLGFVLSYIEGHSLLQSRVVMVEQFNRTISGTVSGIAKGGELMLEGDDGGTVLVSS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|240137568|ref|YP_002962039.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens AM1]
 gi|240007536|gb|ACS38762.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens AM1]
          Length = 279

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 81/271 (29%), Positives = 123/271 (45%), Gaps = 22/271 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAQGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLLID-SISKDSLTLLSFAIAVAMRSVIASTL------------------- 100
           S +GNL ASLL+    ++ + +  L F   VA+   +                       
Sbjct: 61  SPEGNLAASLLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPRAEMGDAPLPQGI 120

Query: 101 -PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
            P    + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L           +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAFSAADAP-MLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           + G F  +D+ G L++    G  R +  G++
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEV 270


>gi|225020634|ref|ZP_03709826.1| hypothetical protein CORMATOL_00641 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946580|gb|EEG27789.1| hypothetical protein CORMATOL_00641 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 261

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 103/246 (41%), Gaps = 11/246 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
              PY  R E+F  +SSTN E +  A  G       +   QTAGRGR    + +   +  
Sbjct: 18  ANGPYQ-RIEYFPEVSSTNTELVAAAHDGAPAWTAFLTDHQTAGRGRMGRSFSAPPRSQM 76

Query: 68  A--SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
               L+     S   L  +  A  +A+   +A        +++KWPND+++  RK+ GIL
Sbjct: 77  PLSILIRPPHESVTRLGTMPLATGLALIDALA-----TPQIQLKWPNDLVIDGRKLCGIL 131

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
            E ++L +    V+                  TSL  EG   +  ++   +   +   L 
Sbjct: 132 AEAVSLGDQPAVVIGLGLNTSLTKEELPVPHATSLHLEGIPYERNELAIRVLNALHHRLT 191

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQ 244
            W+ +     +M  +R  +  IG  + + L     +LG   GV D G L + ++ G + +
Sbjct: 192 QWETND--PALMPDYRAVSATIGQNVRVILPNDTELLGTAEGVADDGRLQVRDQTGTLHE 249

Query: 245 IFTGDI 250
           +  GD+
Sbjct: 250 LTAGDV 255


>gi|301064832|ref|ZP_07205203.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
 gi|300441077|gb|EFK05471.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
          Length = 330

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 5/240 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
               +    +STN +    A  G      ++A  QT GRGR    W S     +Y S+++
Sbjct: 83  RDMVYHPETASTNTDAKILATQGAPEGTVVIAEHQTRGRGRLGRDWYSPHSRGIYISVII 142

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
               S     +L+   AV M   +  T   G +V +KWPNDI+V  RKI GIL E  +  
Sbjct: 143 RPRFSLQDAPILTPLTAVVMAEAL--TEETGLEVLLKWPNDIVVSGRKIGGILTEIGSEM 200

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDL--KDIFSLLFQDVARVLDLWKKD 190
           + +   V+G+GLNV+ C         +   E        +      +      +   KK 
Sbjct: 201 DQIDFAVIGLGLNVRRCRFPEDLKSKATSIEEETSRRVSRAGLVRSYLGKFETVYEQKKT 260

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   ++  +      +G  +T+      + GR   +D+ G L++E   G   ++ +GD+
Sbjct: 261 WGFGPLLKRYEALTAVVGKEVTVNSGGRRLSGRVRDLDEHGALIVEGGGGTTIRVVSGDV 320


>gi|258511620|ref|YP_003185054.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478346|gb|ACV58665.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 333

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                + ++ +STND  ++ A  G      + A  QT GRGRRD  W S +G ++ ++ +
Sbjct: 86  GSPILWAESRASTNDTALELAEKGLPHGAVVTAGEQTGGRGRRDRAWASPRGGMWFTVFV 145

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
            +  +      L+   A+A+   +      G  V+IKWPNDIL+  +K  GIL +     
Sbjct: 146 RNPCALRHAPDLTLLAALAVCRALR---GEGVPVEIKWPNDILLGGKKTGGILAQIRAEG 202

Query: 133 NGLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             +   V+GIGLN                 T L   G  ID     + +  ++ R+    
Sbjct: 203 ELVDHAVIGIGLNANFPIEELPEEIRDRATTILHAMGRPIDRPKALARILMELDRLYRDL 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +   G + +   W      IG  + + +    + G    ++  G L++E   G  R + +
Sbjct: 263 RDGRGFQAVHAEWTALCSTIGHEVEVAIGDQRVRGMARSIEPDGSLVIETSPGVTRTVVS 322

Query: 248 GDI 250
           G++
Sbjct: 323 GEV 325


>gi|292669423|ref|ZP_06602849.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas noxia ATCC
           43541]
 gi|292648944|gb|EFF66916.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas noxia ATCC
           43541]
          Length = 323

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 98/244 (40%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +   +D + STN      A  G      +VA  Q  GRGR +  + S     +Y S+L
Sbjct: 78  GRKIICYDAVGSTNLLLKDMARQGAENGTVVVADTQGMGRGRMERAFFSPPGKGIYVSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +         +   AVA+   +      G    IKWPNDI+   RK+ GIL E    
Sbjct: 138 LRPNFLPQDAPKCTLMAAVAVARAMEKF---GLRAAIKWPNDIMHDGRKMVGILTEMSAE 194

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  VV+GIG+NV       P +     TSL +  G    +  F          L   
Sbjct: 195 MDRVNYVVIGIGINVNIASEDFPEELRPIATSLMQMKGEPLPRVAFLQELLRALDALYAC 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  G   ++  WR +A  +G  + +      S  G    +D  G LL++   G  R++ 
Sbjct: 255 AQQEGFAPVLAAWREYAVTLGQQVRVIGPAGESFEGMAADIDAEGALLIDTSTGR-RRVL 313

Query: 247 TGDI 250
            GD+
Sbjct: 314 AGDV 317


>gi|187935435|ref|YP_001886756.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium botulinum B
           str. Eklund 17B]
 gi|187723588|gb|ACD24809.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium botulinum B
           str. Eklund 17B]
          Length = 322

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 113/242 (46%), Gaps = 9/242 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
             ++F  I STN    + A + ++     IVA  QT G+GR D KW S    ++ SL+L 
Sbjct: 80  DIQYFSEIPSTNKAAKQLADNSNINDGTLIVAEKQTLGKGRFDRKWTSPSSGIWMSLILK 139

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I     + +     +A  SV  S L  G +V IKWPNDI +  +K+ GIL E     +
Sbjct: 140 PNIPPSEASKI---TQIAAASVYKSLLNFGINVSIKWPNDIFINDKKLCGILTEMKCDID 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWK 188
            +  +V+GIGLNV    VD    +  +            +   I S +  +   + + + 
Sbjct: 197 RIHYLVLGIGLNVNLDSVDFADELKDIATSLKLEFNKTFNKSLILSEILNNFEPLYEKFI 256

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            +   +E++++ R  +  +     +   +   +   +G++D G L++++  G  + + +G
Sbjct: 257 LENDIDEVLDICRENSNLLNQKAKLITYHKEEIVTCIGINDSGELIVKDADGHEKAVTSG 316

Query: 249 DI 250
           +I
Sbjct: 317 EI 318


>gi|116750036|ref|YP_846723.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699100|gb|ABK18288.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 335

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 110/241 (45%), Gaps = 7/241 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLLI 73
            Y +  T+ STND  ++ AL G      + A  QT GRGR    W  S +  +Y ++LL 
Sbjct: 87  NYHYLATVGSTNDVALQLALEGAPHGTVVSAEEQTRGRGRLRRDWLSSPRRGIYMTILLR 146

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +     +   +  A+A+   + ST        IKWPND+LV  +K+AGIL E  + + 
Sbjct: 147 TPLPVREASQSVYIAALALAKTLHST--FRLPSSIKWPNDVLVRHKKVAGILTEMQSDQE 204

Query: 134 GLQAVVVGIGLNVKHCPV----DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
             + +V+GIG+NV H          YP TS+  E G    +      F +   +      
Sbjct: 205 QTRFLVIGIGINVNHTQEELAGPFRYPATSVAVELGRPIRRQELMKSFLERFEMEYDRFL 264

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D G   I+     F+  +G  +++      I GR +G    G L+L  ++G  + I+ GD
Sbjct: 265 DEGFGAILPELEEFSDILGKNVSVLCGKEEIEGRALGFTPEGALVLLTREGRKQSIWAGD 324

Query: 250 I 250
           +
Sbjct: 325 V 325


>gi|330969838|gb|EGH69904.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 319

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 112/249 (44%), Gaps = 5/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +++ +   P  +    +D+I STN E  +    G    L +VA  QT+GRGRR  KWIS 
Sbjct: 65  ADIMQSGFPAGWSVRTYDSIDSTNAEAARLIAQGVPMPLLVVAEQQTSGRGRRGRKWISP 124

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+        D  +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQ--DAGLKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           AGIL+E +     +  V++GIG+NV      +     TS++ E G +  ++  +      
Sbjct: 183 AGILLELIGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSVRLETGGLVDRNQVAARISTQ 242

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L    +  G       W       G  + +      + G  +GVD  G L LE   G
Sbjct: 243 LEALMAVHRKEGFAAFQKEWERGHVWQGAAVKLLSGVEVVEGLVLGVDSLGALRLE-VNG 301

Query: 241 CVRQIFTGD 249
             +    G+
Sbjct: 302 VEKSFSGGE 310


>gi|66047791|ref|YP_237632.1| biotin--protein ligase [Pseudomonas syringae pv. syringae B728a]
 gi|63258498|gb|AAY39594.1| Biotin--acetyl-CoA-carboxylase ligase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 335

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 112/249 (44%), Gaps = 5/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +++ +   P  +    +D+I STN E  +    G    L +VA  QT+GRGRR  KWIS 
Sbjct: 81  ADIMQSGFPAGWSVRTYDSIDSTNAEAARLIAQGVPMPLLVVAEQQTSGRGRRGRKWISP 140

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+        D  +KWPND+LV ++KI
Sbjct: 141 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQ--DAGLKWPNDVLVGRQKI 198

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           AGIL+E +     +  V++GIG+NV      +     TS++ E G +  ++  +      
Sbjct: 199 AGILLELIGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSVRLETGGLVDRNQVAARISTQ 258

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L    +  G       W       G  + +      + G  +GVD  G L LE   G
Sbjct: 259 LEALMAVHRKEGFAAFQKEWERGHVWQGAAVKLLSGVEVVEGLVLGVDSLGALRLE-VNG 317

Query: 241 CVRQIFTGD 249
             +    G+
Sbjct: 318 VEKSFSGGE 326


>gi|254560039|ref|YP_003067134.1| biotin-protein ligase [Methylobacterium extorquens DM4]
 gi|254267317|emb|CAX23149.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens DM4]
          Length = 279

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 82/271 (30%), Positives = 123/271 (45%), Gaps = 22/271 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAHGGETGPLWVTTQRQEAGRGRRGNAWA 60

Query: 61  SDKGNLYASLLLID-SISKDSLTLLSFAIAVAMRSVIASTL------------------- 100
           S +GNL ASLL+    ++ + +  L F   VA+   +                       
Sbjct: 61  SPEGNLAASLLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPNPERGYAPLPQGI 120

Query: 101 -PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
            P    + +KWPNDIL   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDILADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L           +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAFSAADAP-MLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           + G F  +D+ G L++    G  R +  G++
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEV 270


>gi|167768158|ref|ZP_02440211.1| hypothetical protein CLOSS21_02714 [Clostridium sp. SS2/1]
 gi|317499621|ref|ZP_07957883.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167709682|gb|EDS20261.1| hypothetical protein CLOSS21_02714 [Clostridium sp. SS2/1]
 gi|291560184|emb|CBL38984.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region
           [butyrate-producing bacterium SSC/2]
 gi|316893096|gb|EFV15316.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 326

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 109/242 (45%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 ++T+ STN E  + A +G       +   QT G+GRR   W+++    +  S L
Sbjct: 78  GKDLHCYETMDSTNLEIRRLAEAGAGHGTVAITEEQTMGKGRRGRSWLAEAGAGIAMSFL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I   + ++L+   A+A+   I  T       KIKWPNDI+V  +KI GIL E    
Sbjct: 138 LKPQIEAQNSSMLTLVTALAVNEAICETTG--IRAKIKWPNDIIVNGKKICGILTEMSLQ 195

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR-VLDLWK 188
            + +  +VVG+G+NV   H P D     TSLQ EGG    +   +    +      D++ 
Sbjct: 196 MDEINYIVVGLGINVNIDHFPEDLSDKATSLQIEGGRKIKRAPLAAKVLECFEKYYDMFL 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      + + +          I +       +    G++  G LL+E++ G V ++ +G
Sbjct: 256 KTEDLSMLQDEYNKLLVHTDQKIKVVRGSKEEIFLSRGINHRGELLVEDEDGKVSEVSSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|86357253|ref|YP_469145.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CFN 42]
 gi|86281355|gb|ABC90418.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CFN 42]
          Length = 254

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 146/240 (60%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L  L  A+AVA+   I     P    +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLGSLPLAVAVAVHQTIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+NV   P +  YPVT L++        ++F+ LF  +A VLD W +  
Sbjct: 133 PDGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPDELFAHLFAAMADVLDQWDQGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIVPIAAGDVF 252


>gi|116754104|ref|YP_843222.1| biotin--acetyl-CoA-carboxylase ligase [Methanosaeta thermophila PT]
 gi|116665555|gb|ABK14582.1| biotin--acetyl-CoA-carboxylase ligase [Methanosaeta thermophila PT]
          Length = 336

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 105/239 (43%), Gaps = 14/239 (5%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R    +++ STN+   + A         ++A  QTAGRGR   KW S  G ++ S++L  
Sbjct: 81  RLIQLESVGSTNEFAREIANE-AENWTVVIAEVQTAGRGRLGRKWFSPSGGVWMSIILKP 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            ++       + A +VA+   +        D + KWPND+LV  RKI G+L E     + 
Sbjct: 140 RVTPSEAFRYTMAGSVAVCRALRDLYG--LDARTKWPNDVLVNGRKICGVLTEISAELDV 197

Query: 135 LQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           +  +++GIG+N         +     T  +     +   ++ + + +++  +L+      
Sbjct: 198 INYMIIGIGINANMSASSLPEEWNATTIYEELHREVPRGELVAKVLEEMRALLE------ 251

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              ++ + W   +  +   + +K  +  + G    +D  G L++ +  G + +I  GD 
Sbjct: 252 -SGDLYHQWVRLSDTLNRRVRVK-GFDEVTGIAESLDPDGALVVRKDDGGIVRILAGDC 308


>gi|322805444|emb|CBZ03008.1| biotin-protein ligase [Clostridium botulinum H04402 065]
          Length = 327

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEEEDIPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ K G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRNRESFGKAVGLNSNGELLVQFKNGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|114566313|ref|YP_753467.1| transcriptional repressor of the biotin operon / biotin
           acetyl-CoA-carboxylase synthetase; RBL03563
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337248|gb|ABI68096.1| transcriptional repressor of the biotin operon / biotin
           acetyl-CoA-carboxylase synthetase; RBL03563
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 325

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 111/256 (43%), Gaps = 11/256 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKW 59
           + + LS  +    ++   F  + STN+   K    G       I++  Q+ G+GRR   W
Sbjct: 69  IKAALSTARL--DWKLHLFPELDSTNEMAKKLIREGQAAEGTVIISRQQSRGKGRRGRSW 126

Query: 60  ISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
            S  G L+ S++L   ++   + LLS   AVA+   + S         IKWPND+ +  +
Sbjct: 127 QSPLGGLWFSIILRPELALSEVVLLSLVFAVAISQALDSFQFFDPQ-MIKWPNDVYINGK 185

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-----LKDIFS 174
           K+AGIL+E          +VVGIG+NV          +                + ++  
Sbjct: 186 KVAGILLELSGELEQADYLVVGIGINVNMDRASLGRGLAKTATSLWEESGTYYQMGEVLL 245

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            + Q +      + K+   E+I   ++     +G +I +    GS+ G  + +D+ G L+
Sbjct: 246 RVLQSIEEYYYEFLKNG-FEDIRKEYKSRCFHLGKMIRLDTPRGSVEGLNLNIDEQGNLI 304

Query: 235 LEEKKGCVRQIFTGDI 250
           ++     +  + TGD+
Sbjct: 305 IDSGD-SIECLNTGDV 319


>gi|89099891|ref|ZP_01172763.1| biotin [acetyl-CoA carboxylase] synthetase [Bacillus sp. NRRL
           B-14911]
 gi|89085449|gb|EAR64578.1| biotin [acetyl-CoA carboxylase] synthetase [Bacillus sp. NRRL
           B-14911]
          Length = 327

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 105/243 (43%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + +++ ST     + A         +VA  Q  GRGR D KW S K   ++ S++
Sbjct: 83  GTEIHYEESVDSTQKIAHRLAYDDAPEGTIVVAEEQLNGRGRMDRKWHSPKYTGIWMSVI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I          +IKWPNDIL+  +K+ GIL E    
Sbjct: 143 LRPEIPLPRAPQLTLLAAVAVVQSIEE--CTALSPQIKWPNDILIGGKKVTGILTELQAE 200

Query: 132 KNGLQAVVV----GIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + + ++++     +   ++  P +     TSL  E G    +     +       L   
Sbjct: 201 ADRIFSIIIGIGINVNQQLEDYPEELRGTATSLAIEKGGNLSRAELVRVVLQKLENLYKL 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             + G   I  LW  +A  IG  IT +   GSI G+ +G+ + G L +E++ G +  +++
Sbjct: 261 YMEKGFYPIRLLWESYAVSIGKQITARTISGSISGKALGITEEGVLRIEDEAGEIHHVYS 320

Query: 248 GDI 250
            DI
Sbjct: 321 ADI 323


>gi|218529200|ref|YP_002420016.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium
           chloromethanicum CM4]
 gi|218521503|gb|ACK82088.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium
           chloromethanicum CM4]
          Length = 279

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 80/271 (29%), Positives = 123/271 (45%), Gaps = 22/271 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSDGHRLHSHDRLGSTNSEAMRLAHGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLLID-SISKDSLTLLSFAIAVAMRSVIASTL------------------- 100
           S +GNL AS+L+    ++ + +  L F   VA+   +                       
Sbjct: 61  SPEGNLAASVLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPHAERGDAPLPQGI 120

Query: 101 -PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
            P    + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLAGCQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L           +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAFSAADAP-MLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           + G F  +D+ G L++    G  R +  G++
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEV 270


>gi|167462325|ref|ZP_02327414.1| BirA [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322381851|ref|ZP_08055805.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon
           repressor-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154239|gb|EFX46561.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon
           repressor-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 326

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 104/245 (42%), Gaps = 9/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +     + +  +ST +        G      +VA  Q  GRGR    W S K   +Y SL
Sbjct: 78  FGQTVHYAEETASTQNLAASLVSEGAKHGTLVVADAQNQGRGRHGRHWFSPKGKGIYMSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL   +       L+   AVA+   I        ++ IKWPND+L+  RK++GIL+E   
Sbjct: 138 LLRPKVPIFFAPQLTLVAAVALCRTIQKLYG--LNIGIKWPNDLLIGGRKVSGILLEISG 195

Query: 131 LKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
               L+ ++ GIG++                 +     G  +D +++ +   Q+  ++  
Sbjct: 196 EDERLKHIIAGIGISANIEAGDFPEDLREVATSLEAELGYKVDREELIAAFLQEFEQIYV 255

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L+  + G   I  LW   +  +   I ++ S G   G    +DD G L++      + ++
Sbjct: 256 LY-MEKGFAPIRTLWEAQSISLHRTIRVRTSDGEFEGIAECLDDAGALVVRTPGNKIYKM 314

Query: 246 FTGDI 250
           ++G++
Sbjct: 315 YSGEV 319


>gi|242398221|ref|YP_002993645.1| Biotin-(Acetyl-coA carboxylase) ligase [Thermococcus sibiricus MM
           739]
 gi|242264614|gb|ACS89296.1| Biotin-(Acetyl-coA carboxylase) ligase [Thermococcus sibiricus MM
           739]
          Length = 248

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 116/240 (48%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +  +F  I STN+   + A   +     IVA  Q  G GR+   W S +G L+ S++L
Sbjct: 10  GKKIIYFKKIDSTNEYAKRIAAH-EEEGTVIVADVQETGYGRKFRAWASPQGGLWMSVIL 68

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             + + + +  L F  A+A+   +      G + KIKWPND+LV ++KI GIL+E    +
Sbjct: 69  KPNTTPEHMIKLVFLGALAVVETLEQL---GIEGKIKWPNDVLVNEKKICGILVEGSFSE 125

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG--GCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  +V+GIG+NV +         ++  RE     I + ++F +L + +      +   
Sbjct: 126 KEVYYIVLGIGMNVNNSLPQELVSTSTSLREVLGVEIPIIEVFKILVERLEHWYREFLA- 184

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                I+  WR  A  +   + +     ++ G+ + +D+FG L+LE + G   +I  GD+
Sbjct: 185 GKDALILQKWRENAI-LRRKVKLITEDKTLTGKALDIDEFGALILELEDGKKEKILYGDV 243


>gi|209548878|ref|YP_002280795.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534634|gb|ACI54569.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 254

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 148/240 (61%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGDGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L+ L  A+AVA+   I     P    +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLSSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGERL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD W +  
Sbjct: 133 PDGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDQWDEGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIAEITARWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGTGRIMPIAAGDVF 252


>gi|153955035|ref|YP_001395800.1| bifunctional BirA-related protein [Clostridium kluyveri DSM 555]
 gi|146347893|gb|EDK34429.1| Bifunctional BirA-related protein [Clostridium kluyveri DSM 555]
          Length = 328

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 105/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  + +++ STN++  + A  G+     ++A  Q  GRGR    W S K   ++ S++
Sbjct: 79  GKKIVYLESVDSTNNKAKELASKGENHGTLVIAEEQLGGRGRLGRAWCSPKYKGIWLSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +        +A  SVI S      +  IKWPNDI++  +KI GIL E    
Sbjct: 139 LRPDINPMQIPK---LTQIAAASVIESLKDFKIEATIKWPNDIILNGKKICGILTEMNAE 195

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  VV+GIG+N      D    + S            +D K     L      + + 
Sbjct: 196 MNKVHYVVLGIGINANLGEEDFQKDILSKATSIKIETGLTLDRKSFVGNLVNKFEYLYEE 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++K    E  + + R  +  IG +I I         + + +D  G L+++ + G    + 
Sbjct: 256 FEKTQNIESSIKICRTNSAVIGKIIRIIRGENETFAKALDLDKNGGLIVQYENGTRENLI 315

Query: 247 TGDI 250
           +G+I
Sbjct: 316 SGEI 319


>gi|312898243|ref|ZP_07757634.1| biotin-[acetyl-CoA-carboxylase] ligase [Megasphaera micronuciformis
           F0359]
 gi|310620740|gb|EFQ04309.1| biotin-[acetyl-CoA-carboxylase] ligase [Megasphaera micronuciformis
           F0359]
          Length = 323

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 108/243 (44%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + +  +STN      A  G +    +++  QT G+GR D  + S     ++ S++
Sbjct: 79  GKNVVYEERTASTNTVAKDLAHKGAVEGTVVISEEQTGGKGRLDRSFFSPYAKGIWFSVI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L        ++ ++   AVA+  V  S         IKWPNDILV  +K+ GIL E    
Sbjct: 139 LRPDFPPVEVSKMTLLTAVALTRVFRSF--GLEKCVIKWPNDILVDGKKLVGILTELSAT 196

Query: 132 KNGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              +  VV G+G+N        P D     TS   EG  +   +++  + +++ R  ++ 
Sbjct: 197 MEKVNYVVTGMGINTSFTRDELPADLQDKATSFLIEGVTVGRNELWQAVMEELERYYEM- 255

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            K  G   I++ WR  +  +   + I  + G   G+ V +DD G L++    G VR I  
Sbjct: 256 AKHEGFSCILDEWRSLSVTLNQDVEIVKTQGVTYGKAVDIDDDGNLIVVGPDGPVR-IVA 314

Query: 248 GDI 250
           GD+
Sbjct: 315 GDV 317


>gi|219855475|ref|YP_002472597.1| hypothetical protein CKR_2132 [Clostridium kluyveri NBRC 12016]
 gi|219569199|dbj|BAH07183.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 332

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 105/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +  + +++ STN++  + A  G+     ++A  Q  GRGR    W S K   ++ S++
Sbjct: 83  GKKIVYLESVDSTNNKAKELASKGENHGTLVIAEEQLGGRGRLGRAWCSPKYKGIWLSII 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +        +A  SVI S      +  IKWPNDI++  +KI GIL E    
Sbjct: 143 LRPDINPMQIPK---LTQIAAASVIESLKDFKIEATIKWPNDIILNGKKICGILTEMNAE 199

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDL 186
            N +  VV+GIG+N      D    + S            +D K     L      + + 
Sbjct: 200 MNKVHYVVLGIGINANLGEEDFQKDILSKATSIKIETGLTLDRKSFVGNLVNKFEYLYEE 259

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++K    E  + + R  +  IG +I I         + + +D  G L+++ + G    + 
Sbjct: 260 FEKTQNIESSIKICRTNSAVIGKIIRIIRGENETFAKALDLDKNGGLIVQYENGTRENLI 319

Query: 247 TGDI 250
           +G+I
Sbjct: 320 SGEI 323


>gi|260583440|ref|ZP_05851188.1| biotin-[acetyl-CoA-carboxylase] ligase [Granulicatella elegans ATCC
           700633]
 gi|260158066|gb|EEW93134.1| biotin-[acetyl-CoA-carboxylase] ligase [Granulicatella elegans ATCC
           700633]
          Length = 331

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 104/255 (40%), Gaps = 10/255 (3%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD- 62
            L +  +P  +  +  ++ +STND     A          ++  QTAGRGR   K++S  
Sbjct: 74  ELIQQHHPIDWVIQTMESTTSTNDLAKLYANQNSTTPAIFISEEQTAGRGRLGRKFVSPS 133

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           K  LY SL L  +I+ + L+L++ A AVA    +        +  IKW ND+    +K+ 
Sbjct: 134 KTGLYISLCLFPTIALEDLSLITCATAVACVETLEELTGKSLN--IKWVNDLFYQDKKVG 191

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           GIL E ++     Q   + +G+ +        +P       G     +  +     +  +
Sbjct: 192 GILTEVISDFESQQVQALIVGMGINLIENPQSFPKELHSIVGSIFSSRKEYEAHSFNRNQ 251

Query: 183 VLDLWKKDTGRE-------EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
            +  + +            + +  ++  +  IG  + +             +D+ G+L++
Sbjct: 252 FIATFLEKWAFYYQNLSKRDFIKSYKEHSNVIGKSVKVIEGNLVYDAFAKDIDENGHLII 311

Query: 236 EEKKGCVRQIFTGDI 250
           E++   +  +  G++
Sbjct: 312 EKEDNTLHSLSYGEV 326


>gi|157368517|ref|YP_001476506.1| biotin--protein ligase [Serratia proteamaculans 568]
 gi|157320281|gb|ABV39378.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Serratia proteamaculans 568]
          Length = 320

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 103/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      + STN   + R           VA  Q AGRGRR  +WIS    NLY S+   
Sbjct: 80  RVTVLPVVDSTNQYLLDRITELQ-SGDACVAEYQQAGRGRRGRQWISPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        DV++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LDQGPAAAMGLSLVIGIVMAEVLKDLGAQ--DVRVKWPNDLYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+     +         +LQ  G  ID  ++ + L  ++ + L  ++ D
Sbjct: 197 DAAQLVIGAGINLAMRETNANAINQGWINLQEAGINIDRNELAATLLNELRQSLRQFEID 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  WR     I   + + +    I G   G+D  G LLL ++ G ++    G+I
Sbjct: 257 G-LAPFIARWRALDNFIDRPVKLLIGEQQIFGIARGIDQQGALLL-DQDGVIKPFIGGEI 314


>gi|192291656|ref|YP_001992261.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           TIE-1]
 gi|192285405|gb|ACF01786.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           TIE-1]
          Length = 268

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 8/240 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+  STN E +  A +G+ G +W V + QTAGRGRR   WI+ +GNL +S+L +  +  
Sbjct: 20  FDSTGSTNAEALISARAGEAGPMWFVTTEQTAGRGRRQRAWIAPRGNLASSVLEVMRVPP 79

Query: 79  DSLTLLSFAIAVAMRSVI-------ASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
            +   L FA  +A+ + +        +        ++KWPND+L   +K+AGIL+E  N+
Sbjct: 80  GTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLASGKKLAGILLEAENV 139

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            + L AVVVGIG NV   P DTPYP  SL+  G  +  +D+F+ L      +  +W    
Sbjct: 140 GDRL-AVVVGIGTNVVAAPTDTPYPAVSLRDLGISVTAEDLFAALSDAWTELRGIWDDGR 198

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   W   A G+G+ ++I+    ++ G F  +DD G L++    G    +  GD++
Sbjct: 199 GFPEIRRRWLERAAGLGEPVSIRSGDSALEGVFDSIDDTGCLIVRTTDGRRVPVSAGDVY 258


>gi|15602161|ref|NP_245233.1| biotin--protein ligase [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|12720530|gb|AAK02380.1| BirA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 312

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 105/250 (42%), Gaps = 8/250 (3%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           S L++   PY         I+STN   +      +      +A  QTAGRGRR  +W+S 
Sbjct: 63  SYLTQALAPYP--LYIKPIINSTNQFLLDNIAHLEK-GAICLAEYQTAGRGRRGRQWLSP 119

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
                   L      K +L  LS  + +A+   +        ++ +KWPND+L+  RK+A
Sbjct: 120 FAGQVIMSLYWTCDQKVNLEGLSLVVGMAIAETLKQAG--ALNIGLKWPNDVLLHGRKLA 177

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           GIL+E  N +N    +V+G G+N+           P   L      ID   + + L + +
Sbjct: 178 GILVEIANRQNNQHNLVIGFGINLSFPKQTQQIYQPWAELIEVLPTIDRNKLIAELGKKL 237

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L  +++    E     WR      G+ + +      I G   G+D  GYL L   +G
Sbjct: 238 IARLQHFEQAGIDEAFRQDWRDMDAYFGEEVHVLTENQKITGIAQGIDKRGYLQLITSEG 297

Query: 241 CVRQIFTGDI 250
            ++    G++
Sbjct: 298 -IQYFNGGEV 306


>gi|126740395|ref|ZP_01756083.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. SK209-2-6]
 gi|126718531|gb|EBA15245.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. SK209-2-6]
          Length = 249

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 117/248 (47%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     + + ST DE  + A     G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 4   WPEGYGKRILEEVDSTLDEAARIAPELA-GPEWILAKRQTKGRGRRGRDWKDPKGNFAAA 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L  S + + + L SF  A+A+     +       + +KWPND+L+   K++GIL+E+ 
Sbjct: 63  LVLRPSEAPNVVALRSFVAALAVADACEALTGQSARISLKWPNDVLLNGGKLSGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + VGIG+N+   P+         +PV+ L   G  +  +   + L    AR 
Sbjct: 123 GQGAGVTHLAVGIGVNLIETPMKEWLEPGAVWPVSLLSETGVQVTPEGFLTELAAAYAR- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +L     G E I   W   A  +G++IT + +     G F  VD+ G L+L   KG + 
Sbjct: 182 YELQFTTYGFEPIRKAWLARAAKLGEVITARTASSETEGTFETVDEEGNLVLNSAKGRI- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|148379105|ref|YP_001253646.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Clostridium botulinum A str. ATCC 3502]
 gi|153932168|ref|YP_001383486.1| birA bifunctional protein [Clostridium botulinum A str. ATCC 19397]
 gi|153935394|ref|YP_001387035.1| birA bifunctional protein [Clostridium botulinum A str. Hall]
 gi|148288589|emb|CAL82670.1| BirA bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152928212|gb|ABS33712.1| birA bifunctional protein [Clostridium botulinum A str. ATCC 19397]
 gi|152931308|gb|ABS36807.1| birA bifunctional protein [Clostridium botulinum A str. Hall]
          Length = 327

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKAKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            N +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 INKVNYVVVGMGINVNCEEEDIPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ + G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRTRESFGKAVGLNSNGELLVQFENGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|330839241|ref|YP_004413821.1| biotin/acetyl-CoA-carboxylase ligase [Selenomonas sputigena ATCC
           35185]
 gi|329747005|gb|AEC00362.1| biotin/acetyl-CoA-carboxylase ligase [Selenomonas sputigena ATCC
           35185]
          Length = 326

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 106/243 (43%), Gaps = 11/243 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
              FF+ I STN    + A  G      +VA  Q  GRGR +  + S     ++ S++L 
Sbjct: 81  DIVFFEEIDSTNQVAKQLAQKGAAAGTVVVAESQGKGRGRLERSYFSPAGKGIWFSVILR 140

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I        +   AVA+   +      G   +IKWPNDIL   +K+ GIL E     +
Sbjct: 141 PHILPQEAPKCTLLAAVAVAMAMKRF---GLQAEIKWPNDILHEGKKLTGILTEMSAEID 197

Query: 134 GLQAVVVGIGLNVKHCPVDT----PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            +  +V+G G+NV     +         TSL    G    +  F     +    L +  +
Sbjct: 198 RINYIVIGTGINVNMEEEEFPEELRDKATSLSIMKGERLPRVAFFQAVLEALDELCIVLE 257

Query: 190 DTGREEIMNLWRCFACGIGDLITIK--LSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + G   I+  WR +A  +G  + +   +   S  GR V +D+ G LL+E  +G VR++  
Sbjct: 258 EDGFAPIIARWREYAVTLGQEVHVIGAIGKDSFDGRAVDIDEEGALLVE-AEGGVRRVLA 316

Query: 248 GDI 250
           GD+
Sbjct: 317 GDV 319


>gi|330812092|ref|YP_004356554.1| bifunctional protein (birA): biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380200|gb|AEA71550.1| putative bifunctional protein (birA): biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 318

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/239 (28%), Positives = 107/239 (44%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +    FDTI STN E ++    G      ++A  Q AGRGRR  KW+S    NLY SL+L
Sbjct: 75  WPVHIFDTIDSTNAEALRLIERGVAAPFMVLAERQVAGRGRRGRKWVSPFAENLYHSLVL 134

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   +  LS  + +A+   +        +  +KWPND+LV ++KIAGIL+E +   
Sbjct: 135 RIDGGMRQIEGLSLVVGLAVMHALRDMGI--AEAGLKWPNDVLVGEKKIAGILLELVGDP 192

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+G+G+NV     D       +     G   D  ++ + L   +   L+L +  
Sbjct: 193 ADVCHVVLGVGINVNMQSTDEVDQQWTSMCLEAGRNFDRNELVARLGAKLQHYLELHRAS 252

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                I + W       G  +++      I G  +G+D  G L L+ + G  +    G+
Sbjct: 253 G-FAAIQSEWEQHHLWQGRAVSLIAGVNKIDGIVLGIDHQGALRLKVE-GVEKNFSGGE 309


>gi|260886973|ref|ZP_05898236.1| biotin-[acetyl-CoA-carboxylase] ligase [Selenomonas sputigena ATCC
           35185]
 gi|260863035|gb|EEX77535.1| biotin-[acetyl-CoA-carboxylase] ligase [Selenomonas sputigena ATCC
           35185]
          Length = 328

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 106/243 (43%), Gaps = 11/243 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
              FF+ I STN    + A  G      +VA  Q  GRGR +  + S     ++ S++L 
Sbjct: 83  DIVFFEEIDSTNQVAKQLAQKGAAAGTVVVAESQGKGRGRLERSYFSPAGKGIWFSVILR 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I        +   AVA+   +      G   +IKWPNDIL   +K+ GIL E     +
Sbjct: 143 PHILPQEAPKCTLLAAVAVAMAMKRF---GLQAEIKWPNDILHEGKKLTGILTEMSAEID 199

Query: 134 GLQAVVVGIGLNVKHCPVDT----PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            +  +V+G G+NV     +         TSL    G    +  F     +    L +  +
Sbjct: 200 RINYIVIGTGINVNMEEEEFPEELRDKATSLSIMKGERLPRVAFFQAVLEALDELCIVLE 259

Query: 190 DTGREEIMNLWRCFACGIGDLITIK--LSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + G   I+  WR +A  +G  + +   +   S  GR V +D+ G LL+E  +G VR++  
Sbjct: 260 EDGFAPIIARWREYAVTLGQEVHVIGAIGKDSFDGRAVDIDEEGALLVE-AEGGVRRVLA 318

Query: 248 GDI 250
           GD+
Sbjct: 319 GDV 321


>gi|163741473|ref|ZP_02148864.1| biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           2.10]
 gi|161385207|gb|EDQ09585.1| biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           2.10]
          Length = 249

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 115/248 (46%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     + + ST DE  +RA +   G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 4   WPEGYGRSLLEEVDSTLDEAARRAPTL-TGPEWIMAKRQTKGRGRRGRAWKEPKGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++      D + L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVMRPEGPPDQVALRSFVAALALYDACVALCGETAGLALKWPNDVLLNGGKLAGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +GIG+N+   P+         +PV+ L   G  +  +D  + L       
Sbjct: 123 GAVGGVTHLSIGIGVNLIETPMQEWLEPGAVWPVSLLSETGIHVTPEDFLTELAAAY-NR 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            ++     G E I   W   A  +G++I  + S     G F  VD  G L+L+  KG V 
Sbjct: 182 YEIQFVTYGFEPIRTAWLARAARLGEVIIARTSNSETEGTFETVDANGNLVLKTAKGRV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 NIPAADIF 248


>gi|167044635|gb|ABZ09307.1| putative biotin/lipoate A/B protein ligase family protein
           [uncultured marine crenarchaeote HF4000_APKG7F19]
          Length = 332

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 107/244 (43%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R  +FD+  ST +  MK A +       +++  QT GRGR   KW S  G ++ S+++
Sbjct: 88  GKRVYYFDSTDSTQNFAMKIASNDKENGTVVISKKQTGGRGRMKRKWKSPTGGIWMSIII 147

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                    TL+  A ++A+   I   L      ++KWPND+ +  +K+AG+LI+T  + 
Sbjct: 148 HPKFDVSYTTLVPIATSLALCMAIEKILK--IKPELKWPNDVTLKGKKVAGVLIDTSIIS 205

Query: 133 NGLQAVVVGIGLNVKHCPV------DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           N ++ +V+GIG+N K  P               +       +        F      +  
Sbjct: 206 NEIENMVLGIGINFKIKPHELASTIKKTPNFYGVATLVKKNERALPLVHQFLYELENVFQ 265

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                   +I N W   +  IG  ++I  S G++ G+ V +D  G L++  K     +I 
Sbjct: 266 LINSRRIRKIKNEWTKRSSTIGRNVSIITSEGNVNGKAVKIDSDGALII-SKGKKAERIL 324

Query: 247 TGDI 250
            GDI
Sbjct: 325 VGDI 328


>gi|146278027|ref|YP_001168186.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556268|gb|ABP70881.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 251

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 112/248 (45%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P        +T+ STN    + A S   G  WI A  QTAGRGRR   W S +GN YA+
Sbjct: 6   WPEGVARHALETVDSTNAMAARLAPSL-SGPAWIQAGEQTAGRGRRGRHWTSPRGNFYAT 64

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
            L+  + + + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E++
Sbjct: 65  YLMHPTETPEVVALRSFVAALALRDACVALTGLPQAFALKWPNDVLLNGGKLAGILLESI 124

Query: 130 NLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
                +Q + +GIG+N+   P           PV+ L   G  +D       L    AR 
Sbjct: 125 GQGARVQHLAIGIGVNLIGAPAVAEVEPGAVPPVSLLAETGLRVDPVAFLDRLAPAYARR 184

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            + + +          W   A  +G+ I  +  +    G F  VD  G L+L+   G V 
Sbjct: 185 EESFARYG-FAPTREAWLAHAARLGEPIRARTGHDLREGIFETVDASGALVLKTCDGRV- 242

Query: 244 QIFTGDIF 251
            I   ++F
Sbjct: 243 AIPAAEVF 250


>gi|126727172|ref|ZP_01743009.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2150]
 gi|126703600|gb|EBA02696.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2150]
          Length = 250

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 115/250 (46%), Gaps = 9/250 (3%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
            + P          I STN E  + A S   G  WI+A  QTA RGRR   W   +GN  
Sbjct: 3   IKFPQGVGRIVHAEIDSTNAEAARIAASL-SGPTWILALSQTAARGRRGRPWAHQQGNFS 61

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
           A+L++  + + D + L SF  ++A+     +       + +KWPND+L+   K+AGIL+E
Sbjct: 62  ATLVMQPTETPDRVALRSFVTSLALYDAFVAVTGRTDGLALKWPNDVLMQGGKVAGILLE 121

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDT------PYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           ++ + +G+  + +G+G+N+   P           PV+     G  +  +D   +L    A
Sbjct: 122 SIGIGSGVNHLAIGVGVNLLTAPDSELLETKAVAPVSLAGAMGVQVSPEDFLDVLAASYA 181

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           +    +      E I   W   A  +G+ I  + +     G F  VD+ G L+L   +G 
Sbjct: 182 KWEAQFVTYG-FEPIRTAWLARAARLGERIIARTTREEFEGTFDTVDEQGALVLLTAQGR 240

Query: 242 VRQIFTGDIF 251
           V  I  GD+F
Sbjct: 241 V-SIPAGDVF 249


>gi|298489112|ref|ZP_07007134.1| Biotin-protein ligase / Biotin operon repressor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156424|gb|EFH97522.1| Biotin-protein ligase / Biotin operon repressor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 319

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 115/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G       W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQGEWERGHLWQGAAVRLLSGAEAVEGLVLGVDSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|182417138|ref|ZP_02948511.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium butyricum 5521]
 gi|237667514|ref|ZP_04527498.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium butyricum E4
           str. BoNT E BL5262]
 gi|182378980|gb|EDT76486.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium butyricum 5521]
 gi|237655862|gb|EEP53418.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium butyricum E4
           str. BoNT E BL5262]
          Length = 322

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 99/254 (38%), Gaps = 10/254 (3%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
           FS L   +      +  FD I STN +  + A +       IVA  Q+   GR    W S
Sbjct: 69  FSKLKTKEL--GRNFIHFDLIDSTNLKAKELAKNNCPNGTIIVAEEQSMANGRFKRVWNS 126

Query: 62  DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
            KG ++ +L+L   I       ++   A  +   +        D KIKWPNDI +  +K+
Sbjct: 127 PKGGIWFTLILRPHIPTSEAPKITQIAAACIYKTLQEL---NIDSKIKWPNDIHLNNKKL 183

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
            GIL E     + +  + +GIG+N+                +         D  +I +  
Sbjct: 184 CGILGEMSCDMDTINYLAIGIGMNINLDITLLDEEVQKTATSLKNEYNIEFDRNEILANF 243

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +     + + KD   E  + + R  +   G    +       L   + + + G L+++
Sbjct: 244 LNNFEIEYEKFSKDLNLENTIKICREHSNIWGKKAKLITYANEELVTCISLSNQGDLIIQ 303

Query: 237 EKKGCVRQIFTGDI 250
           +  G  R + +G+I
Sbjct: 304 DADGNERTVLSGEI 317


>gi|49475644|ref|YP_033685.1| biotin-protein ligase birA [Bartonella henselae str. Houston-1]
 gi|49238451|emb|CAF27679.1| Biotin-protein ligase birA [Bartonella henselae str. Houston-1]
          Length = 269

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 84/250 (33%), Positives = 132/250 (52%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++ + STN    ++A +G  G LW+VA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQKQGYAVESYEIVDSTNYIAQQKAHAGHHGYLWVVAKEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD----VKIKWPNDILVFQRK 120
           NLY+SLLL++ I   +   L F   V++   I   +         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLVEDIVHQTAAQLGFVAGVSVVETIKQFIKDEKQTSDIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +GIL+E   L +   A+V+GIG+NVK+   D PYP +SL+  G  I+ + +F++L +  
Sbjct: 127 SSGILLEIFKLPSQQYALVIGIGINVKYHYEDAPYPTSSLKNIGLDIETEQLFTVLTEYF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G + I   W  ++   G  + I      I G F G+D+    ++++K G
Sbjct: 187 SKNYLLWKQLGGCDRIREKWLLYSAHSGQYVKIVNDEKIIEGIFDGLDNDFNCVIKQKNG 246

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 247 QQAVITAGDV 256


>gi|188589802|ref|YP_001921714.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium botulinum E3
           str. Alaska E43]
 gi|188500083|gb|ACD53219.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium botulinum E3
           str. Alaska E43]
          Length = 322

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 108/241 (44%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRA-LSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
            +++  + STN    + A  +       I+A  QT G+GR D KW S    ++ SL+L  
Sbjct: 81  IQYYFELPSTNKTAKQLADNNNANNGTLIIAEKQTLGKGRFDRKWTSPSSGIWMSLILKP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +I     + ++   A ++   + +    G +V IKWPNDI +  +K+ GIL E     + 
Sbjct: 141 NIPPSEASKITQIAAASVYKALLNF---GINVSIKWPNDIFINGKKLCGILTEMKCDIDR 197

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWKK 189
           +  +V+GIGLNV     +    +  +                I S +  +   + + +  
Sbjct: 198 IHYLVLGIGLNVNLNAEEITDELKDIATSLKLEFNKTFSKSLILSEILNNFEPLYEKFIL 257

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +    E++N+ R  +  +     +   +   +   +G++D G L++++  G  + + +G+
Sbjct: 258 ENNICEVLNICRQNSNLLNQKAKLITYHKEEIVTCIGINDNGELIVKDADGYEKAVTSGE 317

Query: 250 I 250
           I
Sbjct: 318 I 318


>gi|86137579|ref|ZP_01056156.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. MED193]
 gi|85825914|gb|EAQ46112.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. MED193]
          Length = 249

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 116/248 (46%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     D + ST DE  + A     G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 4   WPEGYGKRILDAVDSTLDEAARIASDL-SGPEWILAKRQTKGRGRRGRDWKEPKGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++  +     + L SF  A+A+     +     + + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVMRPTEPPQVVALRSFLAALALYDACEALTGRTSGLALKWPNDVLLNGGKLAGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +GIG+N+   P+         +PV+ L   G  +  +D  + L    AR 
Sbjct: 123 GAAQGVTHLAIGIGVNLVETPMKEWLEPGAVWPVSLLSETGVQVTPEDFLTALAAAYAR- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +L     G E I   W   A  +G++IT + +     G F  VD  G L+L   KG V 
Sbjct: 182 YELQFTTYGFEPIRTAWLARAAKLGEVITARTTNSETTGTFETVDAEGNLVLNSAKGRV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|163738816|ref|ZP_02146230.1| Biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           BS107]
 gi|161388144|gb|EDQ12499.1| Biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           BS107]
          Length = 249

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 116/248 (46%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     + + ST DE  +RA +   G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 4   WPEGYGRSLLEEVDSTLDEAARRAPTL-TGPEWIMAKRQTKGRGRRGRAWKEPKGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++      D + L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVMRPEGPPDQVALRSFVAALALYDACVALCGETAGLALKWPNDVLLNGGKLAGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +G+G+N+   P+         +PV+ L   G  +  +D  + L     R 
Sbjct: 123 GAAGGVTHLSIGLGVNLIETPMQEWLEPGAVWPVSLLSETGIHVTPEDFLTELAAAYDR- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            ++     G E I   W   A  +G++I  + S     G F  VD  G L+L+  KG V 
Sbjct: 182 YEIQFVTYGFEPIRTAWLARAARLGEVIIARTSNSETEGTFETVDANGNLVLKTAKGRV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 NIPAADIF 248


>gi|124441833|gb|ABN11532.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. 168]
 gi|124441837|gb|ABN11535.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|124441853|gb|ABN11547.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441857|gb|ABN11550.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441861|gb|ABN11553.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441865|gb|ABN11556.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. SMY]
          Length = 319

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 114/244 (46%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D +SST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 77  GQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLI 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I           IKWPNDIL+  +K  GIL E    
Sbjct: 137 LRPDIPLQKTPQLTLLAAVAVVQGIEEAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV   P D P  +  +     Q  G  ID   +   +     +    
Sbjct: 195 EDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAGVIQHILLCFEKRYRD 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE  +G +++I+
Sbjct: 255 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETNEG-IKKIY 312

Query: 247 TGDI 250
           + DI
Sbjct: 313 SADI 316


>gi|16079301|ref|NP_390125.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|221310160|ref|ZP_03592007.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221314482|ref|ZP_03596287.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319404|ref|ZP_03600698.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323680|ref|ZP_03604974.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|317374856|sp|P0CI75|BIRA_BACSU RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|1146239|gb|AAB38447.1| biotin [acetyl-CoA-carboxylase] ligase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|2634662|emb|CAB14160.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 325

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 114/244 (46%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D +SST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I           IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPDIPLQKTPQLTLLAAVAVVQGIEEAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV   P D P  +  +     Q  G  ID   +   +     +    
Sbjct: 201 EDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAGVIQHILLCFEKRYRD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE  +G +++I+
Sbjct: 261 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETNEG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|321311713|ref|YP_004204000.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis BSn5]
 gi|320017987|gb|ADV92973.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis BSn5]
          Length = 325

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 114/244 (46%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D +SST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I           IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPDIPLQKTPQLTLLAAVAVVQGIEEAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV   P D P  +  +     Q  G  ID   +   +     +    
Sbjct: 201 EDRVRSVIIGIGINVNQQPNDFPEELKDIATSLSQAAGEKIDRAGVIQHILLCFEKRYRD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE  +G +++I+
Sbjct: 261 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETNEG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|225026965|ref|ZP_03716157.1| hypothetical protein EUBHAL_01221 [Eubacterium hallii DSM 3353]
 gi|224955701|gb|EEG36910.1| hypothetical protein EUBHAL_01221 [Eubacterium hallii DSM 3353]
          Length = 326

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 108/237 (45%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
            F++I STN+E  +R  +G       VA  QT G+GRR   W+S    +++ ++LL   +
Sbjct: 83  CFESIDSTNEEAKRRGEAGAPDGSIYVADNQTNGKGRRGRTWLSPSGEDIFFTILLRPDL 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             +S+++L+   A A+   +        + +IKWPNDI++ ++K+ GIL E     + + 
Sbjct: 143 PLNSVSMLTLVAASAVAEAVDKVTGQ--ECQIKWPNDIVLNRKKVCGILTEMNMEIDSIA 200

Query: 137 A---VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
                V      ++          +  +  G  I+  ++ S +     R   L+ +    
Sbjct: 201 YVVVGVGINVNRMEFREDIAETATSLKKESGHSIERAELLSEILSAFFRDYKLFLEKQDL 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +  +      +G  + I      I+   +G++D G L++++ +G    IF+G++
Sbjct: 261 SPFLESYNQKLVNVGREVKIIKKGEEIIRTAIGINDRGELIVQDAEGNTEHIFSGEV 317


>gi|163850503|ref|YP_001638546.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium extorquens
           PA1]
 gi|163662108|gb|ABY29475.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium extorquens
           PA1]
          Length = 279

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 80/271 (29%), Positives = 123/271 (45%), Gaps = 22/271 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E  + A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEATRLAQGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLLIDS-ISKDSLTLLSFAIAVAMRSVIASTL------------------- 100
           S +GNL ASLL+  + ++ + +  L F   VA+   +                       
Sbjct: 61  SPEGNLAASLLMPVTGVAPEMVATLGFVAGVALVDALRDACRLALSPHAERGDAPLPQGI 120

Query: 101 -PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
            P    + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L           +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAFSAADAP-MLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           + G F  +D+ G L++    G  R +  G++
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEV 270


>gi|76802823|ref|YP_330918.1| biotin--[acetyl-CoA-carboxylase] ligase [Natronomonas pharaonis DSM
           2160]
 gi|76558688|emb|CAI50280.1| biotin--[acetyl-CoA-carboxylase] ligase [Natronomonas pharaonis DSM
           2160]
          Length = 306

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/236 (28%), Positives = 110/236 (46%), Gaps = 11/236 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
             E+ D I+STND   + A  G    + ++A  QT  RGR D  W S  G ++ SL+   
Sbjct: 76  DIEYHDRIASTNDRARELAADGA-EGVCVLADEQTGARGRLDRPWESPAGGVWLSLVYRP 134

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +    + + + A AVA  + +      G   +IKWPNDILV   K+ GIL E     + 
Sbjct: 135 DLPPSQVPVYTLAAAVAATAALREV---GVSAEIKWPNDILVDGEKLVGILTEMEGEADR 191

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           +  VVVGIG+N        P   T+++ + G ID   + + +   +  + +  +      
Sbjct: 192 VSWVVVGIGINANIDAASVPDHATTVKEQVGDIDRGALTASIIDRLEALRNAPEDVP--- 248

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                WR  +  IG ++ ++    ++ G  VG++  G L++E   G  R+I  GD 
Sbjct: 249 ---EAWRELSTTIGQIVRVETPGETVTGEAVGIEFPGTLVVETDDGK-RRIAAGDC 300


>gi|332654407|ref|ZP_08420150.1| biotin-[acetyl-CoA-carboxylase] ligase [Ruminococcaceae bacterium
           D16]
 gi|332516371|gb|EGJ45977.1| biotin-[acetyl-CoA-carboxylase] ligase [Ruminococcaceae bacterium
           D16]
          Length = 335

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 113/251 (45%), Gaps = 12/251 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
                  +    DT+ STN EC ++A++G    L +++  QT GRGR    + S K   L
Sbjct: 80  AGCHLGGKLLCLDTVDSTNTECKRQAMAGAPDGLVVISEEQTGGRGRLGRTFQSPKGRGL 139

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           Y S LL   +    +T  +  +AVA+   I +        +IKW NDI++  +K+ GIL 
Sbjct: 140 YVSALLRPQLPPAEVTDFTAWVAVAVCDGIEAACG--LRPQIKWTNDIILNGKKVCGILT 197

Query: 127 ET--LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQD 179
           E    +  N LQ ++ GIG+N  H P D    V  +     Q  G  +   ++   + + 
Sbjct: 198 EMGLESESNALQYLIPGIGINANHAPEDFSEDVRPMATSLAQELGHPVRRSELAVQVIRA 257

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + R+   +    G++E ++ +R      G+ + +         + V +DD   L++E   
Sbjct: 258 LDRMYAAF--PQGKQEYLDKYRADCLTPGNQVQLITPVSRREAKAVAIDDEFRLVVEYPD 315

Query: 240 GCVRQIFTGDI 250
           G    +  G++
Sbjct: 316 GSREALSAGEV 326


>gi|114569919|ref|YP_756599.1| biotin--acetyl-CoA-carboxylase ligase [Maricaulis maris MCS10]
 gi|114340381|gb|ABI65661.1| biotin--acetyl-CoA-carboxylase ligase [Maricaulis maris MCS10]
          Length = 249

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 115/237 (48%), Gaps = 1/237 (0%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R E+ +  SSTN +  +RAL+G+ G LW+ A  QTAGRGRR   W    GNL+ + L   
Sbjct: 9   RIEWIEETSSTNADIRERALAGERGPLWLAARRQTAGRGRRGRVWSGLTGNLFTTGLYTL 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                    LSFA A+A+ +V  S     +  ++KWPND LV  RK+AGIL+E+     G
Sbjct: 69  QSDPGRAAELSFAAALAVAAVCDSATRDPSVTRLKWPNDALVHGRKVAGILLESGPAPEG 128

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
              + VGIG+N+   P D   P TSL R G  +        L     R    W+   G  
Sbjct: 129 GLWLAVGIGINLAAAPDDVERPATSLDRHGATLSPDAALETLVNAFERERQAWQ-LGGFG 187

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I + W   A G+G     +L   ++ G F  +   G L L+   G  R I  GD+F
Sbjct: 188 PIRDRWLTRAHGLGQPCEARLEGETVKGVFADLGPDGALRLDLVGGGRRYISAGDVF 244


>gi|116251481|ref|YP_767319.1| biotin transcriptional regulator bifunctional protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256129|emb|CAK07210.1| putative biotin transcriptional regulator bifunctional protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 254

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 150/240 (62%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +G  GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGGGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L  L  AIAVA+   I   LP     +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLGSLPLAIAVAVHQAIRRVLPLRAEPLEVKWPNDILIGRKKTCGILVEGEGL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+N+   P +  YPVT L+++G     +++F+ LF   A VL++W +  
Sbjct: 133 PDGRYALIVGIGINISVMPDNPLYPVTCLRQQGSAASPEELFAHLFAATAEVLEIWDEGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI  LWR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIGEITALWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|328543701|ref|YP_004303810.1| Biotin-(acetyl-CoA-carboxylase) ligase [polymorphum gilvum
           SL003B-26A1]
 gi|326413445|gb|ADZ70508.1| Biotin-(Acetyl-CoA-carboxylase) ligase [Polymorphum gilvum
           SL003B-26A1]
          Length = 261

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 94/242 (38%), Positives = 124/242 (51%), Gaps = 3/242 (1%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR EF D++ STN   M  A +GD G LWI+A  QTAGRGRR   W S +GNL+AS+LL
Sbjct: 15  GFRVEFHDSVPSTNSLAMAAARAGDAGRLWILAHEQTAGRGRRGRAWASSRGNLFASVLL 74

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           ID   K  +  L    AVA+   +         V +KWPND+LV   K++GIL+E   L 
Sbjct: 75  IDPQPKARIAELPLVAAVALAEAVERAAGAHGLVGLKWPNDLLVEGAKLSGILLEAETLA 134

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  AVV G G+N    P    Y  T L   G  I    +F  L       LD W  D G
Sbjct: 135 DGRLAVVCGFGVNCVSHPEPDGYKATDLAALGYRIGAGLLFDRLAATFGAWLDTWSADNG 194

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGS---ILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            + +   W   A  +G+ IT++    S   + GRF  +D  G L+L+   G +R I  GD
Sbjct: 195 FDVVRRAWMGRALRLGETITVRTGTESAADLTGRFCEIDGRGQLVLQLDDGTIRTISAGD 254

Query: 250 IF 251
           +F
Sbjct: 255 VF 256


>gi|261867631|ref|YP_003255553.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412963|gb|ACX82334.1| biotin-[acetyl-CoA-carboxylase] ligase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 310

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 107/249 (42%), Gaps = 7/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + L++   PY    +    ISSTN   +             +A  QT GRGRR  +WIS 
Sbjct: 63  ARLTQALAPYGVTLK--PVISSTNQYLLDHLEQLQK-GDLCLAEYQTTGRGRRGRQWISP 119

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
                            SL  LS  I +A+   +A     G  V  KWPNDILV  RK+A
Sbjct: 120 FAGQIIMSFYWQLNPTKSLDGLSSVIGLAIVQALAELDMYGFQV--KWPNDILVNDRKLA 177

Query: 123 GILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           GIL+E +N KNG+  ++VGIG+N+          P   L      +D + I   + + + 
Sbjct: 178 GILVEIVNRKNGMLNLIVGIGMNISLGQNKKIDQPWAELSEFFPQVDREQIIIKMTKTIY 237

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           R L+ +++     E+   W       G  + +     +I G   G+D  G+L +  + G 
Sbjct: 238 RYLERFEQHGIDAELQQQWLNHDAYFGAEVNVITEKSAISGTEQGIDAAGHLCVITENGR 297

Query: 242 VRQIFTGDI 250
            +    G++
Sbjct: 298 -QYFNAGEV 305


>gi|310829636|ref|YP_003961993.1| BirA bifunctional protein [Eubacterium limosum KIST612]
 gi|308741370|gb|ADO39030.1| BirA bifunctional protein [Eubacterium limosum KIST612]
          Length = 325

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 99/240 (41%), Gaps = 6/240 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLI 73
           R E + ++ STN    +RAL+G      I+A  QT GRGR    + S     +Y S++L 
Sbjct: 83  RLEVYPSLDSTNSLGKERALAGAPDGTVIIAESQTGGRGRMGRTFFSPGGSGIYLSMILR 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
              +      ++ A +V +R  IA       + +IKW ND+ +  +KI GIL E      
Sbjct: 143 PGTAISQSLFITIAASVLIRQAIADVTG--LEPEIKWVNDLYIKDKKICGILTEAAADFE 200

Query: 134 --GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA-RVLDLWKKD 190
              +  +V+G G+N        P  +  +                        L      
Sbjct: 201 TGNIDYIVLGAGINFTEPKQGFPEELQPVAGALFKEAPNGQLRSRLAAELVNCLSRLTCI 260

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +M  +R  +  IG  +TI     ++ G    ++D G+L+L++  G  + I +G++
Sbjct: 261 PEAGAVMADYRKHSMVIGKPVTILNGRETLEGVVSDINDAGHLILKKDDGTFQSIVSGEV 320


>gi|308174035|ref|YP_003920740.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens DSM 7]
 gi|307606899|emb|CBI43270.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens DSM 7]
 gi|328552839|gb|AEB23331.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens TA208]
 gi|328912365|gb|AEB63961.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens LL3]
          Length = 325

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 116/244 (47%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
             +  + D + ST     + A  G      +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GKQLYYRDVLPSTQKTAHELANDGAPEGTLVVADKQTAGRGRMSRVWHSQEGNGIWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   AVA+   I +         IKWPND+++  +K  GIL E    
Sbjct: 143 LRPDVPLQKTPQLTLLSAVAVVQAIEAFTG--VQPAIKWPNDLMIHGKKAVGILTELQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-----GGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV     D P  +  +        GG ID   +   +     +    
Sbjct: 201 EDRVRSVILGIGINVNQQETDFPGELQEIATSLSLEAGGKIDRAGLIQEILLTFEKRYQD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K      I  LW  +A G+G+ +  +   G+  G+ +G+DD G LLLE K G +++I+
Sbjct: 261 YLKHG-FTPIKLLWESYAVGLGNELRARTLQGTFYGKSLGIDDEGVLLLETKDG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|237797416|ref|ZP_04585877.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331020266|gb|EGI00323.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 319

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 113/249 (45%), Gaps = 5/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           S + +   P  +    +D+I STN E ++         L ++A  QT+GRGRR  KW+S 
Sbjct: 65  SAIEKAGLPADWSVRTYDSIDSTNAEAVRLIGQDVSMPLLVLAERQTSGRGRRGRKWVSP 124

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVHG--AGLKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           AGIL+E +     +  VV+GIG+NV      +     TS++ E G    ++  +      
Sbjct: 183 AGILLELIGDPADVCHVVIGIGVNVNMRASAEVDQQWTSVRLETGHFVDRNDIAARISSQ 242

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L    +  G       W       G  +T+    G++ G  +G+D  G L LE   G
Sbjct: 243 LNALLAVHRKEGFAAFREEWEQGHLWQGAKVTLLSGVGAVEGVVLGIDSLGALRLE-VSG 301

Query: 241 CVRQIFTGD 249
             +    G+
Sbjct: 302 IEKSFSGGE 310


>gi|218778235|ref|YP_002429553.1| biotin/acetyl-CoA-carboxylase ligase [Desulfatibacillum
           alkenivorans AK-01]
 gi|218759619|gb|ACL02085.1| biotin/acetyl-CoA-carboxylase ligase [Desulfatibacillum
           alkenivorans AK-01]
          Length = 312

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 111/237 (46%), Gaps = 8/237 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
             F++  +ST       A S       +VA  QT GRGR +  W S  G LY +++L  S
Sbjct: 74  IHFYEEATSTMTIARDLAESDCPHMTTVVAQRQTKGRGRLNRVWDSQDGGLYFTVILRPS 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  + +  + F  +V++  V+ +      +  +KWPNDILV ++K+ G+L E       +
Sbjct: 134 LPINQVYKVLFTASVSLALVVRNLTG--INATVKWPNDILVGEKKLNGMLSEMATQDEFV 191

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           Q V +GIG+NV + P        S++   G     + I +     +   L         E
Sbjct: 192 QYVNLGIGVNVNNNPSKAEPNAVSIRDLLGQEFPRRKILTGFLDSMEERLK-----NKDE 246

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           +++  W+ +   IG  + I+ +   + GR V V+  G L++E   G + ++F GD F
Sbjct: 247 DVIAQWKQYTSTIGRPVRIQTTRDVLEGRAVDVNSQGSLIVELADGRLEEVFHGDCF 303


>gi|251779293|ref|ZP_04822213.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243083608|gb|EES49498.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 322

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 110/241 (45%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLG-NLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
            +++  + STN    + A + ++     I+A  QT G+GR D KW S    ++ SL+L  
Sbjct: 81  IQYYFELPSTNKTAKQLADNNNVNNGTLIIAEKQTLGKGRFDRKWTSPSSGIWMSLILKP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +I     + ++   A ++   + +    G +V IKWPNDI +  +K+ GIL E     + 
Sbjct: 141 NIPPSEASKITQIAAASVYKALLNF---GINVSIKWPNDIFINGKKLCGILTEMKCDIDR 197

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWKK 189
           +  +V+GIGLNV     +    +  +                I S +  +   + + +  
Sbjct: 198 IHYLVLGIGLNVNLNAEEITDELKDIATSLKLEFNKTFSKSLILSEILNNFEPLYEKFIL 257

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +    E++N+ R  +  +     +   +   +   +G++D G L++++  G  + + +G+
Sbjct: 258 ENNICEVLNICRQNSNLLNQKAKLITYHKEEIVTCIGINDNGELIVKDADGYEKAVTSGE 317

Query: 250 I 250
           I
Sbjct: 318 I 318


>gi|291484666|dbj|BAI85741.1| bifunctional protein BirA [Bacillus subtilis subsp. natto BEST195]
          Length = 325

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 114/244 (46%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D +SST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GQHLIYHDVLSSTQKTAHELANNNSPEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I           IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPDIPLQKTPQLTLLAAVAVVQGIEEAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV   P D P  +  +     Q  G  ID   +   +     +    
Sbjct: 201 EDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAGVIQHILLCFEKRYRD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE  +G +++I+
Sbjct: 261 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETNEG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|307353844|ref|YP_003894895.1| biotin/acetyl-CoA-carboxylase ligase [Methanoplanus petrolearius
           DSM 11571]
 gi|307157077|gb|ADN36457.1| biotin/acetyl-CoA-carboxylase ligase [Methanoplanus petrolearius
           DSM 11571]
          Length = 332

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 100/246 (40%), Gaps = 11/246 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLG---NLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
                +F    ST           D        ++A  QT G GR    W S  G ++ +
Sbjct: 87  GKDIRYFKNTPSTTWVAKDLCSKKDAENFNGTILIAEEQTGGVGRLGRAWFSPSGGIWTT 146

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++L  +I  D L  ++ + ++A+   I           IKWPNDI +  +K++GIL+E  
Sbjct: 147 IILKPTIPIDKLFFVTMSASIAVARTIRR--MYDIGALIKWPNDIYIGDKKVSGILLELA 204

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD-----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +   ++GIG++    P D          +     G  ID     + +  +  R  
Sbjct: 205 AEADQIHYCLLGIGIDANIKPEDLQCSLQTPITSLNIEIGHDIDRAKFLATMLGEFERRY 264

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            L ++   +      W+  +  +   + I     +  G  + +D++G L++++  G V +
Sbjct: 265 KLVEEGEYKAISRE-WKSLSLTLEKRVRITTPRRTFEGEAIDLDEYGALIIKKDNGKVER 323

Query: 245 IFTGDI 250
           I +GD 
Sbjct: 324 ILSGDC 329


>gi|284165938|ref|YP_003404217.1| biotin/acetyl-CoA-carboxylase ligase [Haloterrigena turkmenica DSM
           5511]
 gi|284015593|gb|ADB61544.1| biotin/acetyl-CoA-carboxylase ligase [Haloterrigena turkmenica DSM
           5511]
          Length = 312

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 17/244 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            F  ++ +TI STN+   + A +G    + ++A  QT  RGR D +W S  G ++ S++ 
Sbjct: 74  PFSVDYHETIGSTNNRARELAANGAAD-VAVLADEQTGSRGRLDREWSSPSGGVWVSIVS 132

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF------QRKIAGILI 126
             +I+     L + A AVA+     +    G D +IKWPND++V        RK+AGIL 
Sbjct: 133 RPTITPAQAPLYTLAAAVAIAR---AAREAGVDARIKWPNDVVVPVGDDGDYRKLAGILT 189

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E     + +  ++ GIG+N        P   TS++ E G +D +     L ++     + 
Sbjct: 190 EMEGETDRVDWIIPGIGVNANIDVDALPEGATSIRDEAGDVDRRLFVQRLLEEFDDYRND 249

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +        +  WR  A  +G  + +    G ++G  V + D G L++E   G    + 
Sbjct: 250 LETV------IPAWRDLALTLGQRVRVDRPAGEVVGEAVDITDSGALVIETDDGQ-ETVS 302

Query: 247 TGDI 250
            GD 
Sbjct: 303 AGDC 306


>gi|304413255|ref|ZP_07394728.1| biotin-(acetyl-CoA carboxylase) ligase [Candidatus Regiella
           insecticola LSR1]
 gi|304284098|gb|EFL92491.1| biotin-(acetyl-CoA carboxylase) ligase [Candidatus Regiella
           insecticola LSR1]
          Length = 322

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/241 (27%), Positives = 109/241 (45%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R           VA  Q +GRGRR  +W+S    N+Y S+   
Sbjct: 82  NIEVLSVIDSTNQYLLERMNELQ-SGDACVAEHQYSGRGRRGRQWVSPFGSNIYFSMFWR 140

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                +S+T LS  I  A+  V+        D+++KWPND+ +  +K+AGIL+E      
Sbjct: 141 LEQGPESVTGLSLVIGTAIAEVLKQ--MGVEDIRVKWPNDLYLHGKKLAGILVELTGKMG 198

Query: 134 GLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
               +V+G+G+N+               T+LQ  G  ID   + + +F  + R +  ++K
Sbjct: 199 DAVQLVMGVGINILMPITAQKESINQDWTTLQEAGITIDRNKLTAEVFAALKRDMTQFEK 258

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +      ++ WR      G  + + +    I G   G+D  G LLLE+  G V+    G+
Sbjct: 259 EG-LTAFIDRWRQLDNYCGCPVKLIVGKKEIRGIARGIDSQGALLLEQ-NGTVKAYSGGE 316

Query: 250 I 250
           I
Sbjct: 317 I 317


>gi|323138159|ref|ZP_08073232.1| biotin/acetyl-CoA-carboxylase ligase [Methylocystis sp. ATCC 49242]
 gi|322396621|gb|EFX99149.1| biotin/acetyl-CoA-carboxylase ligase [Methylocystis sp. ATCC 49242]
          Length = 266

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/246 (28%), Positives = 111/246 (45%), Gaps = 9/246 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           +  R    D + STN E  +    G+ G LW+VA+ QT GRGR   +W+S  GNL+AS +
Sbjct: 10  HGVRLLALDEVDSTNSEARRLIEGGERGPLWVVAARQTKGRGRMGREWLSPAGNLHASFI 69

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           + D         L F   VA    + S    G    +KWPND+++   K+ GIL+E + +
Sbjct: 70  ISDFGETLVAPQLGFVAGVAAMRALVSAAGRG-RFGLKWPNDLMLDGAKLGGILLENVIV 128

Query: 132 KNG----LQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVL 184
             G      A V  IG+ V         P  +               +F+ L   +   L
Sbjct: 129 PTGDARAPAASVAIIGIGVNCANAPDDLPYEARALAALGAEAPSAATVFAHLSDALVETL 188

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           ++W+   G  ++   W  +A G+G  I + L+  ++ GRF  +D  G L+L    G  R 
Sbjct: 189 EIWRGGAGFAQLREEWLTYASGLGADIRVALARETVEGRFETIDSSGRLVLATSDGA-RV 247

Query: 245 IFTGDI 250
           +  GD+
Sbjct: 248 VEAGDV 253


>gi|293392143|ref|ZP_06636477.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952677|gb|EFE02796.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 310

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 105/249 (42%), Gaps = 7/249 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + L++   PY    +    ISSTN   +             +A  QT GRGRR  +WIS 
Sbjct: 63  ARLTQALAPYGVTLK--PVISSTNQYLLDHLEQLQK-GDLCLAEYQTTGRGRRGRQWISP 119

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
                            SL  LS  I +A    +A     G  V  KWPNDILV  RK+A
Sbjct: 120 FAGQIIMSFYWQLNPTKSLDGLSSVIGLATVQALAELDMYGFQV--KWPNDILVNDRKLA 177

Query: 123 GILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           GIL+E +N KNG+  ++VGIG+N+          P   L      +D + I   + + + 
Sbjct: 178 GILVEIVNRKNGMLNLIVGIGMNISLGQNKKIDQPWAELSEFFPQVDREQIIIKMTKTIY 237

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
             L+ +++     E+   W       G  + +     +I G   G+D  G+L +  + G 
Sbjct: 238 CYLERFEQHGIDAELQQQWLNHDAYFGAEVNVITEKSAISGIEQGIDAAGHLCVITENGR 297

Query: 242 VRQIFTGDI 250
            +    G++
Sbjct: 298 -QYFNAGEV 305


>gi|154686491|ref|YP_001421652.1| hypothetical protein RBAM_020590 [Bacillus amyloliquefaciens FZB42]
 gi|154352342|gb|ABS74421.1| BirA [Bacillus amyloliquefaciens FZB42]
          Length = 325

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
             +  + D + ST     + A  G      +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GKQLHYRDVLPSTQKTAHELANDGAPEGTLVVADKQTAGRGRMARVWHSQEGNGIWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   AVA+   I +         IKWPND+++  +K  GIL E    
Sbjct: 143 LRPDVPLQKTPQLTLLSAVAVVQAIEAFTG--VQPAIKWPNDLMIHGKKAVGILTELQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV     D P  +  +        G  ID   +   +     +    
Sbjct: 201 EDRVRSVILGIGINVNQQETDFPGELQDIATSLSMEAGEKIDRAGLIQEILLTFEKRYQD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A G+G+ +  +   G+  G+ +G+DD G LLLE + G +++I+
Sbjct: 261 YLNHG-FTPIKLLWESYAVGLGNELRARTLQGTFYGKSLGIDDEGVLLLETRDG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|320161292|ref|YP_004174516.1| biotin--[acetyl-CoA-carboxylase] ligase [Anaerolinea thermophila
           UNI-1]
 gi|319995145|dbj|BAJ63916.1| biotin--[acetyl-CoA-carboxylase] ligase [Anaerolinea thermophila
           UNI-1]
          Length = 258

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 15/242 (6%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLLLID 74
            ++     STND+ M  A +G    + ++A  Q  GRGR    W+     +L  S++   
Sbjct: 18  IQYLPETYSTNDDAMAWAQAGAPEGVVVIADKQLKGRGRLGRMWVTQPGTSLAFSMIFRP 77

Query: 75  SI-SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           ++   + L+L S   A+A+   +      G   +IKWPND+L+ ++K+ G+L ET+ + +
Sbjct: 78  TLEEIEKLSLFSPLGALAVAVALEDL---GLSPEIKWPNDVLLSRKKVCGVLAETVWMGS 134

Query: 134 GLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            +  VV+GIG+NV         +            G  +D   +   + +     L  W+
Sbjct: 135 HINGVVLGIGINVATGSVPDSNMLLFPATCVESELGKPVDRLSLLESVLRH----LIEWR 190

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K    E  +  W+     +G+ +T++   G I GRF  VD+ G L+L  ++     IF G
Sbjct: 191 KQIRTERFIEEWKKRLAFLGEKVTVQKPDGEITGRFQDVDEHGALVLSVEE-QYHTIFAG 249

Query: 249 DI 250
           D+
Sbjct: 250 DV 251


>gi|220924019|ref|YP_002499321.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium nodulans ORS
           2060]
 gi|219948626|gb|ACL59018.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium nodulans ORS
           2060]
          Length = 264

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 80/242 (33%), Positives = 112/242 (46%), Gaps = 7/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E  DT+ ST+ + M RA  G  G LW+V   QT GRGRR + W S +GNL ASL  
Sbjct: 13  GYRLETHDTLGSTSTQAMARAREGAEGPLWVVTRRQTEGRGRRGSAWSSPEGNLAASLYW 72

Query: 73  --IDSISKDSLTLLSFAIAVAMRSVIASTLPVG----TDVKIKWPNDILVFQRKIAGILI 126
                ++ D +  L F   +++   +              ++KWPND+L    K+AGIL+
Sbjct: 73  PVPPGLAPDRIATLGFVAGLSLERALREVCGPERGAADAFRLKWPNDVLAGGDKLAGILL 132

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E   L  G  AVVVG G+NV   P    YPV SL   G   D   +F  L       L +
Sbjct: 133 EMETLPQGA-AVVVGFGVNVAAAPEGLAYPVASLAGLGRPADAAGLFRRLSATWIETLRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W + +G   I   W   A G+G  + +      + G F  +D  G L++    G  R + 
Sbjct: 192 WDEGSGFPAIRAAWLATAAGLGGPVAVDTGSERLAGTFDTIDSSGRLVVRLADGTQRTVT 251

Query: 247 TG 248
            G
Sbjct: 252 AG 253


>gi|188580271|ref|YP_001923716.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium populi
           BJ001]
 gi|179343769|gb|ACB79181.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium populi
           BJ001]
          Length = 281

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 83/273 (30%), Positives = 123/273 (45%), Gaps = 24/273 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAHGGEAGPLWVTTRRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLLID-SISKDSLTLLSFAIAVAMRSVIASTLPVGTDV------------- 106
           S +GNL ASLLL    ++ + +  L F   VA+   I     +                 
Sbjct: 61  SPEGNLAASLLLPVAGVAPEMVATLGFVAGVALVDAIRDACRLDPSPLSPQAGEGDALPQ 120

Query: 107 ---------KIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV 157
                     +KWPND+L   RK+AGIL+E   L  G +AVVVG G+NV   P   PYP 
Sbjct: 121 GIAAAHAAIHLKWPNDVLADGRKLAGILLEAETLPGGRRAVVVGFGVNVAAAPEGLPYPA 180

Query: 158 TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSY 217
            +L         + +   L +     + +W K  G   I   W   A G+G  ++++++ 
Sbjct: 181 AALSAFSAADAPR-LLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAE 239

Query: 218 GSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            ++ G F  +D+ G L++    G  R +  G++
Sbjct: 240 VTLTGIFETIDEGGRLVILAPDGTRRTVTAGEV 272


>gi|259047222|ref|ZP_05737623.1| biotin--[acetyl-CoA-carboxylase] ligase BirA [Granulicatella
           adiacens ATCC 49175]
 gi|259036272|gb|EEW37527.1| biotin--[acetyl-CoA-carboxylase] ligase BirA [Granulicatella
           adiacens ATCC 49175]
          Length = 330

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 55/249 (22%), Positives = 104/249 (41%), Gaps = 14/249 (5%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASL 70
             +  + F+  +STND       SG+    + +A  QTAGRGR    +    K  LY S+
Sbjct: 80  QDWDIQVFEKTTSTNDLAKNYGASGERVPTFFIAEEQTAGRGRLGRTFLSPPKSGLYMSI 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
            +      DS++L++ A AVA    + S   +   V IKW ND+    +KIAGIL E + 
Sbjct: 140 CIFPEGDLDSISLITCATAVAATRAVESF--IHETVGIKWVNDLYYHDKKIAGILTEAVT 197

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPV---------TSLQREGGCIDLKDIFSLLFQDVA 181
                +   + +G+ +     D   P           S Q         +  +   ++  
Sbjct: 198 NIEAQRVDALIVGMGINLHIDDAIIPEDLKPIIGSLFSPQEIPKSFSRNEFVARFLKEWN 257

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           +  +    ++G+ + M  ++  +  +G  I +     +       VD+ G+L+++   G 
Sbjct: 258 QCYEA--INSGKRDFMEEYKSHSIIVGKKINVISGMKTYPATAKSVDNNGHLIVQTDDGS 315

Query: 242 VRQIFTGDI 250
           +  +  G++
Sbjct: 316 IHSLSYGEV 324


>gi|113460565|ref|YP_718629.1| biotin--protein ligase [Haemophilus somnus 129PT]
 gi|170718912|ref|YP_001784082.1| biotin--protein ligase [Haemophilus somnus 2336]
 gi|112822608|gb|ABI24697.1| biotin operon repressor [Haemophilus somnus 129PT]
 gi|168827041|gb|ACA32412.1| biotin--acetyl-CoA-carboxylase ligase [Haemophilus somnus 2336]
          Length = 310

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 109/250 (43%), Gaps = 8/250 (3%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
            S L    +P  ++  +   I+STN   M+  L  +          Q AGRGRR  +W S
Sbjct: 62  LSYLETELSP--YKIYYHPIINSTNQYLMENILQLNK-GDLCFTEYQFAGRGRRGREWQS 118

Query: 62  DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
                             SL  LS  + +A   V+     +G +VK+KWPND+L+F RK+
Sbjct: 119 PFAGQLMVSFYWTFNPTVSLNGLSSVLGLATAEVLNE---MGAEVKLKWPNDLLLFGRKL 175

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           AGIL+E +N KNGL   +VGIG+N+          P   L      ID  D+   L +  
Sbjct: 176 AGILVEIVNAKNGLLNFIVGIGINLSLPQENKIDQPWAELLETLPEIDRNDLAIQLVKKW 235

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
            + L ++++          W       G  + I      + G   G+D+ GYLL+    G
Sbjct: 236 YQYLTIFEQQGM-HAFFQRWIKLDYFFGQEVNIISEKEIVCGIEQGIDEEGYLLVALNNG 294

Query: 241 CVRQIFTGDI 250
            +R+   G++
Sbjct: 295 VLRKFNGGEV 304


>gi|269103674|ref|ZP_06156371.1| biotin-protein ligase/biotin operon repressor [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163572|gb|EEZ42068.1| biotin-protein ligase/biotin operon repressor [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 318

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 94/239 (39%), Gaps = 8/239 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             +    I STN   + R           +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  NLDVIPVIDSTNQYLLDRVGQL-PSGAVCLAEYQQAGRGRRGRQWLSPFGSNLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   + S       V  KWPNDI    +K+AGIL+E +    
Sbjct: 139 LDAGVAAAMGLSLVVGVAIAETLQSMGAERIKV--KWPNDIYCDDKKVAGILVEMVGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYP--VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
               +++G+GLN+                      I+   + + L   + + L  ++   
Sbjct: 197 DAAHLIIGMGLNISMPEQQHIDQAWTNLTDCCEQTIERNQLAARLITQLTKTLQDYEHHG 256

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +  W      IG  + + L    I G   G++D G LLLE + G +     G+I
Sbjct: 257 -LAGFVERWNKVDNFIGRPVKLLLGEQVIEGIARGINDTGALLLETEAG-ITPYIGGEI 313


>gi|167045639|gb|ABZ10288.1| putative biotin/lipoate A/B protein ligase family protein
           [uncultured marine microorganism HF4000_APKG10K24]
          Length = 289

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 100/239 (41%), Gaps = 5/239 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R  +F  I ST +E  + A  G      +VA  Q+ GRGR+   W+S +GN+Y S++ 
Sbjct: 20  GKRLLYFQEIPSTMNEASRLAQEGADEGTVVVAGTQSEGRGRQGRNWVSREGNIYISIIF 79

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             ++  D L +LS    VA    I  T     +  IKWPND+++  +K  GIL+E+    
Sbjct: 80  RPTL--DVLPMLSILAGVAAVRAIRKTTG--LEPGIKWPNDVMIGGKKTGGILVESAVQG 135

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL-WKKDT 191
             +   ++G+G+N+                             L + +   LD  + + T
Sbjct: 136 GQVSHAILGMGINIDLDAQKEEEIANLATALNSAAGRIVPPEDLLRQLLHDLDRLYIEAT 195

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +  W      IG  I       +  G   G+D+ G LLL  + G +  +  GD+
Sbjct: 196 HGVSPLPEWETLLETIGQSIQATWRQETYTGVAEGIDNLGNLLLRLEDGQLMTLTAGDV 254


>gi|148560586|ref|YP_001258794.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ovis ATCC 25840]
 gi|148371843|gb|ABQ61822.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ovis ATCC 25840]
          Length = 265

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 127/243 (52%), Gaps = 5/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +GNL ++LL
Sbjct: 12  EGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEGNLASTLL 71

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTDVKIKWPNDILVFQRKIAGILI 126
           L++S    +   L F   +++   + +        V   + +KWPND+LV   K+ GIL+
Sbjct: 72  LVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGAKLTGILL 131

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L    +    +
Sbjct: 132 ESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDAWSVNYRV 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +G    + 
Sbjct: 192 WNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDEGSRVAVT 251

Query: 247 TGD 249
            GD
Sbjct: 252 AGD 254


>gi|90417552|ref|ZP_01225473.1| birA bifunctional protein [marine gamma proteobacterium HTCC2207]
 gi|90330644|gb|EAS45934.1| birA bifunctional protein [marine gamma proteobacterium HTCC2207]
          Length = 336

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 111/259 (42%), Gaps = 17/259 (6%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           LS    P+    + F TI+STN    + A S       I+A  QTAGRGRR   W+S   
Sbjct: 74  LSVEAIPHLSAIDIFQTINSTNTYARELAESSSASGAVILAEQQTAGRGRRGKSWVSPFA 133

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            N+Y S++        +L  LS AI VA++  +  T     +VK+KWPNDI V Q+K+ G
Sbjct: 134 ANIYLSIVWDFEQGAQALEGLSLAIGVAVKRAL--TAHGVQEVKLKWPNDIYVEQKKLGG 191

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL-------QREGGCID------LK 170
           IL+E +    G   V+VG+GLNV    +                Q +    D        
Sbjct: 192 ILLEMIGDPVGHCNVIVGVGLNVSMPALQAAAIDQDWTDVTTELQAQQSPADGPKLSVRN 251

Query: 171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDF 230
            + + L  ++  +LD ++         + W+      G    I     SI G   GV+  
Sbjct: 252 KLAAALISEILPLLDTFQTRG-FAAYRDEWQAADAFYGQAAEISTPKQSIAGVVRGVETN 310

Query: 231 GYLLLEEKKGCVRQIFTGD 249
           G L LE   G +     G+
Sbjct: 311 GALRLELDNGTIESFIGGE 329


>gi|238760246|ref|ZP_04621390.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia aldovae ATCC
           35236]
 gi|238701510|gb|EEP94083.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia aldovae ATCC
           35236]
          Length = 289

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 100/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   ++R           VA  Q AGRGRR   W+S    NLY 
Sbjct: 46  LPAG-QVTVLPVVDSTNQYLLERIAELK-SGDACVAEYQHAGRGRRGRHWVSPFGANLYL 103

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V++KWPND+ +  +K+AGIL+E 
Sbjct: 104 SMFWRLEQGPAAAMGLSLVVGIVMAEVLRKLG--AEQVRVKWPNDLYLNDKKLAGILVEL 161

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T          Q  G  ID   + + L  ++   + 
Sbjct: 162 TGKTGDAAQLVIGAGINLTMRESITNVINQHWINLQEAGVNIDRNKLTAELLSELRLAVV 221

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      +  WR     +   + + +    I G   G+D+ G LLL ++ G ++  
Sbjct: 222 KFENEG-LSAFIPRWREMDNYLDRPVKLIIGDQEIFGIARGIDEQGALLL-DQDGIIKPY 279

Query: 246 FTGDI 250
             G+I
Sbjct: 280 IGGEI 284


>gi|237727887|ref|ZP_04558368.1| biotin-protein ligase [Citrobacter sp. 30_2]
 gi|226910444|gb|EEH96362.1| biotin-protein ligase [Citrobacter sp. 30_2]
          Length = 320

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 101/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   M R    +      VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGNITVLPVIDSTNQYLMDRIGQLE-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRDLG--AEKVRVKWPNDLYLLDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  ID   + + L +++   L L+
Sbjct: 194 KTGDAAQIVIGAGINMSMRRVEENVVNQGWINLQEAGINIDRNTLAARLIRELRAALVLF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + +      ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EHEG-LAPYLSRWKRLDNFIDRPVKLIIGDKEIFGISRGIDAQGALLLEQ-NGEIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|306820540|ref|ZP_07454173.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551454|gb|EFM39412.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 321

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 114/237 (48%), Gaps = 7/237 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
            E FD I STN++  K A +       + A+ QT G+GRR  ++ S KG +Y S++L   
Sbjct: 84  IEVFDEIDSTNEQAKKIAKN-ASDGTIVAANVQTKGKGRRGREFESKKGGMYFSIILKPD 142

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++ + +  ++   A ++   ++    +G D  IKWPNDI++  +K+ GIL E     + L
Sbjct: 143 VAIEEVPFITQMTACSINKALSE---MGVDTLIKWPNDIILNDKKLCGILCEMSCEIDYL 199

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI--FSLLFQDVARVLDLWKKDTGR 193
             VV GIG+N+K    +      +   E    +L ++  F  + ++       +      
Sbjct: 200 SYVVAGIGINLKKVDFEEEVEKVATSLEQEGYELDNLGLFWNILKNFDYFYQKYIMHDYD 259

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            E++++ R  +  +   I I  S      R   +D+ G+L++E + G +  I  G++
Sbjct: 260 -EMLDILRANSYILNKDIEILTSNEIKKARSKDIDEKGFLVVEYENGDIEHINYGEV 315


>gi|109900297|ref|YP_663552.1| biotin--acetyl-CoA-carboxylase ligase [Pseudoalteromonas atlantica
           T6c]
 gi|109702578|gb|ABG42498.1| biotin--acetyl-CoA-carboxylase ligase [Pseudoalteromonas atlantica
           T6c]
          Length = 328

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 108/249 (43%), Gaps = 9/249 (3%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-G 64
             C++    +    + + STN    +R  S        +A  QTAGRGRR   W+S    
Sbjct: 80  KHCEHFVPTQLTLLNVVDSTNQYLKERIGSLH-NGDVCLAEAQTAGRGRRGRTWVSPYGA 138

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           +LY S     +    S+  LS A+ VA+   + +      DV++KWPNDI    +K+AG+
Sbjct: 139 SLYLSQFWQFAGGYQSIGGLSLAVGVAITQALETAGYQ--DVQLKWPNDIYAQGKKLAGV 196

Query: 125 LIETLNLKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVA 181
           LIE           ++G+GLN+           P   L        D   + +LL  ++ 
Sbjct: 197 LIEVEGQMGSACDCIIGVGLNMALDMGSERIDQPWIDLATLNPDGFDRNRVSALLLDELT 256

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           R  DL+ +    E  +  WR         + + +   ++ G   G+D  G LLLE++ G 
Sbjct: 257 RCADLFSQAG-LEPFLEKWRNRNVYQDKPVYLIIGNKTVHGICKGIDKTGALLLEQEDG- 314

Query: 242 VRQIFTGDI 250
           ++    G+I
Sbjct: 315 IQAYSGGEI 323


>gi|330879471|gb|EGH13620.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 319

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 72/245 (29%), Positives = 108/245 (44%), Gaps = 5/245 (2%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GN 65
           E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S    N
Sbjct: 69  ESGMPGEWSVRTYDSIDSTNAEASRLIARGAPMPLLVVAEQQTAGRGRRGRKWVSPFAEN 128

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL
Sbjct: 129 LYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQG--AGLKWPNDVLVGRQKIAGIL 186

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVL 184
           +E +     +  V++GIG+NV            TS++ + G    ++  +         L
Sbjct: 187 LELIGDPADVCHVIIGIGVNVNMRASTEVDQLWTSVRLQTGAPADRNTIAARISAQLEAL 246

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
               +  G       W       G  + +     ++ G  +GVD  G L LE   G  + 
Sbjct: 247 LAVHRQEGFLAFQKEWERGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE-VNGLEKS 305

Query: 245 IFTGD 249
              G+
Sbjct: 306 FSGGE 310


>gi|194334980|ref|YP_002016840.1| biotin/acetyl-CoA-carboxylase ligase [Prosthecochloris aestuarii
           DSM 271]
 gi|194312798|gb|ACF47193.1| biotin/acetyl-CoA-carboxylase ligase [Prosthecochloris aestuarii
           DSM 271]
          Length = 327

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 102/241 (42%), Gaps = 5/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                F+    STN      A +G      + A  Q+ GRGR    W S  G NLY S++
Sbjct: 81  GRELFFYPIAVSTNALAKSFARNGAGEGAVVTADAQSGGRGRMQRVWSSPAGVNLYFSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S+S   L  +   +A A+   + S    G  V IKWPND+LV  RKI GIL E  + 
Sbjct: 141 LRPSVSPLRLPQIPLLVAAALHRAL-SFSVPGLQVLIKWPNDMLVNGRKICGILCEMESE 199

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
            +    V+ GIG+NV    +       +       G       + +  F     + D W 
Sbjct: 200 ADMAHFVIAGIGINVNLRELPHEIRGIATSLFLETGEEYSRSALLASFFNAFEPIYDAWL 259

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++    +++     ++   G L+ ++     + GR  G+   G LLL+   G  R I +G
Sbjct: 260 EEEDLGQVLECLDEYSYLKGRLVEVEQFNRRLRGRAAGISRTGELLLDLDNGERRVISSG 319

Query: 249 D 249
           +
Sbjct: 320 E 320


>gi|190891301|ref|YP_001977843.1| biotin--[acetyl-CoA carboxylase] synthetase [Rhizobium etli CIAT
           652]
 gi|190696580|gb|ACE90665.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CIAT 652]
          Length = 254

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 147/240 (61%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEGLSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L  L  AIAVA+   I     P    +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLGSLPLAIAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD W +  
Sbjct: 133 PDGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDQWDQGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GIAEITARWRAIACGIGEKITVNLPDRSISGQFAGIDDKGLLMLDIGAGRIMPIAAGDVF 252


>gi|227821633|ref|YP_002825603.1| biotin transcriptional regulator bifunctional protein
           [Sinorhizobium fredii NGR234]
 gi|227340632|gb|ACP24850.1| biotin transcriptional regulator bifunctional protein
           [Sinorhizobium fredii NGR234]
          Length = 255

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 110/243 (45%), Positives = 145/243 (59%), Gaps = 1/243 (0%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +P  FR+       STN EC+ RA  GD GNLWI A+ QT GRGRR  +W S+ GNLYAS
Sbjct: 11  SPDDFRHIALAETVSTNSECLARAREGDPGNLWITAARQTGGRGRRGREWFSEPGNLYAS 70

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV-GTDVKIKWPNDILVFQRKIAGILIET 128
           LLLID    + L  L  A AVA+   I   +P    +V IKWPNDIL+  RK  GIL+E 
Sbjct: 71  LLLIDPAPVEHLHSLPLAAAVAVHRAIRRVMPPGSPEVAIKWPNDILIDGRKTCGILLEA 130

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             L +G  A+V+G G+NV   P    YPVTSL++EG  I  +++F+ LF  +A  L +W 
Sbjct: 131 EGLPDGRHALVIGCGVNVAVMPETGLYPVTSLRQEGATISAEELFAHLFVTMAEALSIWN 190

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +  G   +++ WR  A GIG+ IT+ L   S+ GRF+G+D  G LLL+   G    I  G
Sbjct: 191 RGAGIAAVIDQWRAAAKGIGEAITVNLPDRSLSGRFIGIDVDGRLLLDTGSGAPLAIAAG 250

Query: 249 DIF 251
           D+F
Sbjct: 251 DVF 253


>gi|161528492|ref|YP_001582318.1| biotin--acetyl-CoA-carboxylase ligase [Nitrosopumilus maritimus
           SCM1]
 gi|160339793|gb|ABX12880.1| biotin--acetyl-CoA-carboxylase ligase [Nitrosopumilus maritimus
           SCM1]
          Length = 335

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 106/241 (43%), Gaps = 11/241 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +FD+  ST ++ +K A+  +     IVA  QT GRGR   KW+S KG ++ S++L     
Sbjct: 93  YFDSTDSTQNQALKMAIEPENNGAIIVAEKQTGGRGRSGRKWVSPKGGIWFSIILHPRFD 152

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
               TL   A A+A+   +  T       ++KWPNDI +  +K+AG+L++     N ++ 
Sbjct: 153 ISITTLFPIASALALSIALEKTFK--ISPELKWPNDITIKGKKLAGMLVDVSLESNKIEN 210

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI--------FSLLFQDVARVLDLWKK 189
           +V+G+G+N           +       G   L +             F      +     
Sbjct: 211 LVLGVGINFDVDVKQIEKNLKGTPNFYGVASLNEKKIKIRPVELVQSFLVELEKIYKLLD 270

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
               ++I++ W   +  IG  + +    G I G+ + +DD G L++        ++  GD
Sbjct: 271 TKQTKKIISEWTKRSSTIGKNVKLNTVDGEIKGKAIRIDDDGALVV-SDNKDTNRVIAGD 329

Query: 250 I 250
           I
Sbjct: 330 I 330


>gi|167626055|ref|YP_001676349.1| biotin--protein ligase [Shewanella halifaxensis HAW-EB4]
 gi|167356077|gb|ABZ78690.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella halifaxensis
           HAW-EB4]
          Length = 320

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 68/237 (28%), Positives = 105/237 (44%), Gaps = 9/237 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +FD I STN   +K A    +     VA  Q+AGRGRR   W+S    +LY S+      
Sbjct: 83  YFDEIPSTNAFILKHAEEL-ISGDICVAEYQSAGRGRRGRVWVSPYGCHLYFSMYWQFPQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LS  +A ++ SV+        DV +KWPNDI +  +K+AG+LIE     +   
Sbjct: 142 GMAQAMGLSLVVACSIVSVLEKLG--VKDVGVKWPNDIYLDNKKLAGVLIEMSGQADSEC 199

Query: 137 AVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            +V+GIGLN+   +        P + L  +    D   +  LL + + + L L++     
Sbjct: 200 NLVIGIGLNMVMGEQHAAQIDQPWSDLSGQARMPDKTALLILLQKQLHQDLSLFQNSG-L 258

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 WR      G  + + +    I G   GVD+ G ++LE   G  +    G+I
Sbjct: 259 TPFQERWRAADLFQGKPVKLLMGQDEIHGVCRGVDEQGAIVLETDSGS-QSYIGGEI 314


>gi|304437093|ref|ZP_07397056.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304370044|gb|EFM23706.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 323

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 97/244 (39%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +   +D + STN    + A  G      +VA  Q  GRGR +  + S     ++ S+L
Sbjct: 78  GKKIICYDAVDSTNLVLKQLAHEGAEDGTVVVADSQGTGRGRMERHFFSPPGKGIWVSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +         +   AVA+   +      G    IKWPNDIL   RK+ GIL E    
Sbjct: 138 LRPTFLPQDAPKCTLMAAVAVARAMEHF---GLRAAIKWPNDILHEGRKLVGILTEMSAE 194

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  VV+GIG+NV       P +     TSL +  G    +  F          L   
Sbjct: 195 MDRVNYVVIGIGINVNIAREDFPEELQDTATSLMQMKGTPLPRVAFLQELLRALDALYRV 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  G   ++  WR +A  +G  + +         G    +D  G L ++   G  R++ 
Sbjct: 255 VQSDGFAPVLAAWRTYAVTLGQTVRVIGPAGEEFEGVAADIDADGALFVDTATGR-RRVL 313

Query: 247 TGDI 250
            GD+
Sbjct: 314 AGDV 317


>gi|270265458|ref|ZP_06193715.1| bifunctional protein BirA [Serratia odorifera 4Rx13]
 gi|270040595|gb|EFA13702.1| bifunctional protein BirA [Serratia odorifera 4Rx13]
          Length = 307

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 103/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      + STN   + R           VA  Q AGRGRR  +WIS    NLY S+   
Sbjct: 67  RVTVLSVVDSTNQYLLDRITELQ-SGDACVAEYQQAGRGRRGRQWISPFGANLYLSMFWR 125

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        +V++KWPND+ +  RK+AGIL+E      
Sbjct: 126 LEQGPAAAMGLSLVIGIVMAEVLQRLG--AEEVRVKWPNDLYLNDRKLAGILVELTGKTG 183

Query: 134 GLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  ID  ++ + L  ++ + L  ++ D
Sbjct: 184 DAAQLVMGAGINLAMRESNANAINQGWINLQEAGISIDRNELAATLLNELRQSLQQFEID 243

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ WR     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 244 G-LVPFISRWRALDNFIDRPVKLLIGEQQIFGIARGIDQQGALLLEQ-NGAIKPFIGGEI 301


>gi|146281153|ref|YP_001171306.1| biotin--protein ligase [Pseudomonas stutzeri A1501]
 gi|145569358|gb|ABP78464.1| BirA bifunctional protein [Pseudomonas stutzeri A1501]
          Length = 315

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 95/239 (39%), Gaps = 7/239 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
            +    FD + STN E ++   +G      +VA  Q+AGRGRR   W+S    NLY SL 
Sbjct: 75  GWELYLFDALDSTNAEALRLLSTGRA-PFLVVAESQSAGRGRRGRHWVSPFGQNLYCSLA 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                    L+ +S  + +A+   +           +KWPND+ V  RKI GIL+E    
Sbjct: 134 FKVHGGTRQLSGMSLVVGLAVMQTLR--GMGLPQAGLKWPNDVYVDGRKIGGILLELTGD 191

Query: 132 KNGLQAVVVGIGLNVKHC-PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
                 V+ GIG+NV          P TSL+   G +D  ++       +   LD     
Sbjct: 192 PADECHVIAGIGINVNMADAKGIDQPWTSLREWIGMVDRNELLLTFAATLKTYLDRHLAA 251

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                +   W       G   T+      + G  +GVD  G L L    G  R    G+
Sbjct: 252 G-FASLREEWEAAHIWQGQSCTLSTGAHELSGTVLGVDPQGGLRL-MIDGVERSFSGGE 308


>gi|294142949|ref|YP_003558927.1| birA bifunctional protein [Shewanella violacea DSS12]
 gi|293329418|dbj|BAJ04149.1| birA bifunctional protein [Shewanella violacea DSS12]
          Length = 309

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 99/236 (41%), Gaps = 7/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +F+ + STN   +K            +A  Q+AGRGRR   W+S    +LY S+      
Sbjct: 72  YFNELPSTNAFLLKHVNELA-SGDICIAEYQSAGRGRRGRSWVSPYGCHLYCSMYWKLEQ 130

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + LS  +A ++  V+ +      D+ +KWPNDI +  +K+AG+LIE     +   
Sbjct: 131 GMAQASGLSLVVACSLVKVLQNFGI--EDLGVKWPNDIYLNNKKLAGVLIEMSGQADSEC 188

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD--TGRE 194
            +VVGIG+N+            +               L      ++   +      G  
Sbjct: 189 HLVVGIGINISMSQSQGDKIDQAWSDLSANPSCPGKTELAIALQKQLHQDFSTFELQGLT 248

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             ++ W+     +G  + + +    I G   G+D+ G +LLE  +G ++    G+I
Sbjct: 249 AFLDRWQQVDVFLGKQVKLLMGDNQIDGICRGIDESGAILLETDEG-IKTFVGGEI 303


>gi|320540643|ref|ZP_08040293.1| putative bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/ DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Serratia symbiotica str. Tucson]
 gi|320029574|gb|EFW11603.1| putative bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/ DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Serratia symbiotica str. Tucson]
          Length = 320

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 103/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      + STN   + R           +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  RVTVLPVVDSTNQYLLDRICKLQ-SGDACIAEYQQAGRGRRGRQWVSPFGTNLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        DV++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVMAEVLQRLG--AEDVRVKWPNDLYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+  C            +LQ  G  ID  ++ + L  ++ + L  ++ D
Sbjct: 197 DAAHLVMGAGINLAMCGTNADAINQGWINLQEAGISIDRNELAATLLNELRQSLKQFEND 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   I + +    I G   G+D  G LLL +++G ++    G+I
Sbjct: 257 G-LTPFVARWHSLDNFIDRPIKLLIGEQQIFGIARGIDQQGALLL-DQQGVIKPFIGGEI 314


>gi|145297369|ref|YP_001140210.1| biotin-(acetyl-CoA-carboxylase) ligase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850141|gb|ABO88462.1| biotin-(acetyl-CoA-carboxylase) ligase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 321

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 99/240 (41%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
              F  I STN   ++R           +A CQTAGRGRR   W+S  G  L  S+    
Sbjct: 81  VHCFPVIDSTNQYLLERVNQLQ-SGESCLAECQTAGRGRRGKPWVSPFGCQLILSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS A+ VA+   + S    G +  +KWPND+    RK+AGIL+E       
Sbjct: 140 EQGMAAAMGLSLAVGVAVVQALESLGYPGVE--LKWPNDLYYQGRKLAGILVEMSGSAGA 197

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+     +      +            D   + + +   + + +  +++ 
Sbjct: 198 SCNLVIGVGLNLAMPAREGERIDQAWSELRHIQPELVDRNLLAARMLGHLQQAMLTFEQQ 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W       G  + + +    I G   G+DD G L LE  +G ++    G+I
Sbjct: 258 GLSH-FVDDWNRLDHFAGRPVRLLMGEQEIRGIARGIDDRGALRLETSEG-IKFYLGGEI 315


>gi|126461960|ref|YP_001043074.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103624|gb|ABN76302.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 251

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 75/253 (29%), Positives = 114/253 (45%), Gaps = 9/253 (3%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           +S    P        D++ STN    + A S   G  WIVA+ QTAGRGRR   W S +G
Sbjct: 1   MSADAWPEGVARHALDSVDSTNAVAARLASSL-SGPAWIVAAEQTAGRGRRGRPWSSRRG 59

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           N Y + LL  +   + + L SF  A+A+R    +   +     +KWPND+L+   K+AGI
Sbjct: 60  NFYGTHLLHPTEPPEVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGI 119

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           L+E+L     +Q + +GIG+N+   P           PV+ L   G  +  +     L  
Sbjct: 120 LLESLGQGGRVQHLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAP 179

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
             AR  + + +          W   A  +G+ I  +  +    G F  VD  G L+L+  
Sbjct: 180 AYARREESFTRLG-FGPTREAWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTG 238

Query: 239 KGCVRQIFTGDIF 251
            G V  I   ++F
Sbjct: 239 SGRV-AIPAAEVF 250


>gi|313894848|ref|ZP_07828408.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976529|gb|EFR41984.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 323

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 106/245 (43%), Gaps = 12/245 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R   +  + STN    + A  G      +VA  Q  GRGR + ++ S     ++ S+L
Sbjct: 78  GRRVACYGAVDSTNLIAKELAREGAADGTVVVAESQGTGRGRLERRFFSPPGKGIWVSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S         +   AVA+   +      G   +IKWPNDIL   +K+ GIL E    
Sbjct: 138 LRPSFLPQDAPKCTLMAAVAVARAMEKF---GLHAEIKWPNDILHDGKKLVGILTEMSAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTP-----YPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  +VVGIG+NV   P D P        + +Q +G  +        L + +  +   
Sbjct: 195 MDRVNYIVVGIGINVNIAPEDFPADLREIATSLMQMKGAPLPRVAFLQELLRALDDLYST 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIK-LSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +++     ++  WR +A  +G  + +   +  +  G    +D+ G LL++   G  R++
Sbjct: 255 VQREG-FAPVLAAWRTYAVTLGRPVRVIAAAGETFDGVAADIDEEGALLIDTASGR-RRV 312

Query: 246 FTGDI 250
             GD+
Sbjct: 313 LAGDV 317


>gi|269137524|ref|YP_003294224.1| biotin--protein ligase [Edwardsiella tarda EIB202]
 gi|267983184|gb|ACY83013.1| biotin--protein ligase [Edwardsiella tarda EIB202]
 gi|304557598|gb|ADM40262.1| Biotin-protein ligase / Biotin operon repressor [Edwardsiella tarda
           FL6-60]
          Length = 319

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 69/245 (28%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   R      + STN   ++R           VA  Q AGRGRR   W S    NLY 
Sbjct: 76  LPQG-RVTVLPVVDSTNQYLLERIGELA-SGDACVAEYQQAGRGRRGRHWFSPFGANLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  I + M  V+ +    G  V  KWPND+ +  RK+AGIL+E 
Sbjct: 134 SMYWKLEQGPAAAMGLSLVIGIVMAEVLQALGAAGVKV--KWPNDLYLNDRKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                    +VVG G+N+     DT        +LQ  G  ID   + + L   +   L 
Sbjct: 192 TGKTGDAANIVVGAGINLMMRNPDTSVVDQQWINLQEAGVNIDRNQLVACLLSRLRSTLA 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++        +  WR     I   + + +    I G   G+D  G LLLE + G +   
Sbjct: 252 DFEVRG-LSPFIARWRALDNFIDRPVRLIIGEQVIHGIARGIDAQGALLLE-RDGVITPF 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|305680154|ref|ZP_07402964.1| biotin--[acetyl-CoA-carboxylase] ligase [Corynebacterium
           matruchotii ATCC 14266]
 gi|305660774|gb|EFM50271.1| biotin--[acetyl-CoA-carboxylase] ligase [Corynebacterium
           matruchotii ATCC 14266]
          Length = 261

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 11/246 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
              PY  R E+F  +SSTN E +  A  G       +   QTAGRGR    + +   +  
Sbjct: 18  ANGPYQ-RIEYFPEVSSTNTELVAAAHDGAPAWTAFLTDHQTAGRGRMGRSFSAPPRSQM 76

Query: 68  A--SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
               L+     S   L  +  A  +A+   +A        +++KWPND+++  RK+ GIL
Sbjct: 77  PLSILIRPPHESVTRLGTMPLATGLALIDALA-----TPQIQLKWPNDLVIDGRKLCGIL 131

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
            E ++L +    V+                  TSL  EG   +  ++   +   +   L 
Sbjct: 132 AEAVSLGDQPAVVIGLGLNTSLTKEELPVPHATSLHLEGIPYERNELAVRVLNALHHRLT 191

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQ 244
            W+ +     +M  +R  +  IG    + L     +LG   GV D G L + ++ G + +
Sbjct: 192 QWETND--PALMPDYRAVSATIGQNARVILPNDTELLGTAEGVADDGRLQVRDQTGTLHE 249

Query: 245 IFTGDI 250
           +  GD+
Sbjct: 250 LTAGDV 255


>gi|312879985|ref|ZP_07739785.1| biotin/acetyl-CoA-carboxylase ligase [Aminomonas paucivorans DSM
           12260]
 gi|310783276|gb|EFQ23674.1| biotin/acetyl-CoA-carboxylase ligase [Aminomonas paucivorans DSM
           12260]
          Length = 340

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 105/246 (42%), Gaps = 8/246 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYAS 69
           P       F  + ST     + A  G    + +VA  Q +GRGRR   W S   G LY S
Sbjct: 85  PLGHPILHFPVLDSTQVPLKELARQGAPEGVVVVAQRQESGRGRRGRDWDSPPGGGLYFS 144

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +LL   +    + L++FA A+A++  +      G    IKWPND+L+  RK+ GIL E  
Sbjct: 145 VLLRPPLLPGQVQLVNFAAALAVQEGL--FRLFGLRAAIKWPNDVLLEGRKLCGILSEAA 202

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP-----YPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +  VV G+GLNV       P        T   R GG      + + + + +A  +
Sbjct: 203 VEADRIHHVVTGMGLNVNLSASQFPAELGARIATLKDRLGGPTSRGAVLAAVLESLASQM 262

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                  G E ++  +R     +G  + ++L    + G  + VD  G L + +  G   +
Sbjct: 263 VRLSSPEGDEALLASYRERCSTLGMPVRVELDCSFVEGTALSVDREGALWVRDALGKEHR 322

Query: 245 IFTGDI 250
               D+
Sbjct: 323 FAAADV 328


>gi|311068758|ref|YP_003973681.1| hypothetical protein BATR1942_09085 [Bacillus atrophaeus 1942]
 gi|310869275|gb|ADP32750.1| hypothetical protein BATR1942_09085 [Bacillus atrophaeus 1942]
          Length = 327

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 73/244 (29%), Positives = 116/244 (47%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
             +  + D + ST     + A +G      +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GRQLYYHDVLPSTQKTAHELANNGAPEGTLVVADKQTAGRGRMSRVWHSQEGNGIWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I           IKWPND+L+  +K  GIL E    
Sbjct: 143 LRPDIPLQQTPQLTLLSAVAVVQAIEEAAG--VQADIKWPNDLLIHGKKAVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ ++++++GIG+NV     D P  +  +     Q  G  ID   +   +     +    
Sbjct: 201 EDRVRSIIIGIGINVNQQSADFPQELQQIATSLSQEAGEKIDRAGLIQQILLSFEKRYHD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K      I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE K+G +++I+
Sbjct: 261 YLKHG-FTPIKLLWESYALGIGQELRARTLKGTFYGKSLGIDDEGVLLLETKEG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|320530152|ref|ZP_08031222.1| biotin-[acetyl-CoA-carboxylase] ligase [Selenomonas artemidis
           F0399]
 gi|320137585|gb|EFW29497.1| biotin-[acetyl-CoA-carboxylase] ligase [Selenomonas artemidis
           F0399]
          Length = 323

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 104/244 (42%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R   +  + STN    + A  G      +VA  Q  GRGR + ++ S     ++ S+L
Sbjct: 78  GRRVACYGAVDSTNLIAKELAREGAADGTVVVAESQGTGRGRLERRFFSPPGKGIWVSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  S         +   AVA+   +      G   +IKWPNDIL   +K+ GIL E    
Sbjct: 138 LRPSFLPQEAPKCTLMAAVAVARAMEKF---GLRAEIKWPNDILHDGKKLVGILTEMSAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTP----YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  +VVGIG+NV   P D P       TSL +  G    +  F          L   
Sbjct: 195 MDRVNYIVVGIGINVNIAPEDFPADLREIATSLMQMKGEPLPRVAFLQELLRALDDLYGT 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIK-LSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  G E ++  WR +A  +G  + +   +  +  G    +D+ G LL++   G  R++ 
Sbjct: 255 VQHEGFEPVLAAWRTYAVTLGRPVRVIAAAGETFDGVAADIDEEGALLIDTASGR-RRVL 313

Query: 247 TGDI 250
            GD+
Sbjct: 314 AGDV 317


>gi|332557961|ref|ZP_08412283.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           WS8N]
 gi|332275673|gb|EGJ20988.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           WS8N]
          Length = 251

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 75/253 (29%), Positives = 113/253 (44%), Gaps = 9/253 (3%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           +S    P        D++ STN    + A S   G  WIVA+ QTAGRGRR   W S +G
Sbjct: 1   MSADAWPEGVARHALDSVDSTNAVAARLASSL-SGPAWIVAAEQTAGRGRRGRPWSSRRG 59

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           N Y + LL  +   + + L SF  A+A+R    +   +     +KWPND+L+   K+AGI
Sbjct: 60  NFYGTHLLHPTEPPEVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGI 119

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           L+E+L     +Q + +GIG+N+   P           PV+ L   G  +  +     L  
Sbjct: 120 LLESLGQGGRVQHLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAP 179

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
             AR  + + +          W   A  +G+ I  +       G F  VD  G L+L+  
Sbjct: 180 AYARREESFTRLG-FGPTREAWLAHAARLGEQIRARTGRELREGMFETVDAHGALVLKTG 238

Query: 239 KGCVRQIFTGDIF 251
            G V  I   ++F
Sbjct: 239 SGRV-AIPAAEVF 250


>gi|52841020|ref|YP_094819.1| biotin synthetase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54296807|ref|YP_123176.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Legionella pneumophila str. Paris]
 gi|296106368|ref|YP_003618068.1| biotin-(acetyl-CoA carboxylase) ligase [Legionella pneumophila
           2300/99 Alcoy]
 gi|52628131|gb|AAU26872.1| biotin operon repressor and biotin [acetyl CoA carboxylase]
           synthetase BirA bifunctional protein [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|53750592|emb|CAH11997.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Legionella pneumophila str. Paris]
 gi|295648269|gb|ADG24116.1| biotin-(acetyl-CoA carboxylase) ligase [Legionella pneumophila
           2300/99 Alcoy]
 gi|307609581|emb|CBW99083.1| biotin- [Legionella pneumophila 130b]
          Length = 331

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 7/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
             F    F +I STN        S  +         QT GRGR    W S    N+Y S 
Sbjct: 84  QPFNLHLFTSIDSTNRYLKDLPSSSAVE--ICCTEMQTQGRGRFGRHWHSPFGENIYCST 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
               +     L+ LS  I++A    I     V   VKIKWPNDIL   +K+ GIL+E + 
Sbjct: 142 RWSFNCDISKLSGLSLVISLATVLTINEF-IVSDKVKIKWPNDILWNNKKLCGILVEIIA 200

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW--- 187
             N     ++G+GLN+     + P P  S     G  +     + +   +   L+ +   
Sbjct: 201 ESNATAQFIIGVGLNINSDTKNNPLPDKSWCSFFGITNQNYNRNSIVTRLLINLEKYLSK 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +       + W  +   +G  + +  +  SI G  +G++ FG L+LE++ G   ++ +
Sbjct: 261 FINNDLNAFKDDWNKYDYLVGKKVKVSQALNSISGIALGINSFGQLILEDEFGNKHELSS 320

Query: 248 GD 249
           GD
Sbjct: 321 GD 322


>gi|148360565|ref|YP_001251772.1| bifunctional biotin operon repressor/biotin [acetyl CoA
           carboxylase] synthetase BirA [Legionella pneumophila
           str. Corby]
 gi|148282338|gb|ABQ56426.1| biotin operon repressor and biotin [acetyl CoA carboxylase]
           synthetase BirA bifunctional protein [Legionella
           pneumophila str. Corby]
          Length = 331

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 7/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
             F    F +I STN        S  +         QT GRGR    W S    N+Y S 
Sbjct: 84  QPFNLHLFTSIDSTNRYLKDLPSSSAVE--ICCTEMQTQGRGRFGRHWHSPFGENIYCST 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
               +     L+ LS  I++A    I     V   VKIKWPNDIL   +K+ GIL+E + 
Sbjct: 142 RWSFNCDISKLSGLSLVISLATVLTINEF-IVSDKVKIKWPNDILWNNKKLCGILVEIIA 200

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW--- 187
             N     ++G+GLN+     + P P  S     G  +     + +   +   L+ +   
Sbjct: 201 ESNATAQFIIGVGLNINSDTKNNPLPDKSWSSFFGITNQNYNRNSIVTRLLINLEKYLSK 260

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             +       + W  +   +G  + +  +  SI G  +G++ FG L+LE++ G   ++ +
Sbjct: 261 FINNDLNAFKDDWNKYDYLVGKKVKVSQALNSISGIALGINSFGQLILEDEFGNKHELSS 320

Query: 248 GD 249
           GD
Sbjct: 321 GD 322


>gi|299143726|ref|ZP_07036806.1| biotin-[acetyl-CoA-carboxylase] ligase [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518211|gb|EFI41950.1| biotin-[acetyl-CoA-carboxylase] ligase [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 326

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/238 (20%), Positives = 100/238 (42%), Gaps = 2/238 (0%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
               ++TI STN +  +   S DL N   +++  QT GRGR+   + S K   +Y +++L
Sbjct: 83  DIYCYETIDSTNTQAKRLLYSKDLENFTVLISDEQTKGRGRKGRSFSSPKGSGIYMTIIL 142

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
               +    +     +  A   V A       + KIKW NDI +  +KI GIL E     
Sbjct: 143 FPKDNFKINSFDLITVRAANAVVNAIKSKTDKEPKIKWVNDIFLNHKKICGILSEADYDF 202

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
              Q   + IG+ +      + +        G  +    + +    ++         +  
Sbjct: 203 ESKQIKSIIIGIGLNFSTDLSAFSKELRPIVGSLLPKDLLRNEFIGEILNEFYKACYEQQ 262

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           REEI+ +++  +  +G  ++ +          + +++ G L++E + G +  + +G++
Sbjct: 263 REEILKIYKDNSLLLGRSVSFEKDSKKYEATAIDINENGNLIVELEDGSIISLSSGEV 320


>gi|148259946|ref|YP_001234073.1| biotin--acetyl-CoA-carboxylase ligase [Acidiphilium cryptum JF-5]
 gi|146401627|gb|ABQ30154.1| biotin--acetyl-CoA-carboxylase ligase [Acidiphilium cryptum JF-5]
          Length = 242

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 112/238 (47%), Gaps = 5/238 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E +DT+ ST+D C +RA  G+   L +VA+ QTAGRGR    W S  GN   S LL
Sbjct: 7   PWRIEHYDTLGSTSDFCARRAAEGEPERLMVVAARQTAGRGRAGRAWESPAGNFCGSALL 66

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +        +    +A+  V+   LP    V +KWPND++    K+AGIL++     
Sbjct: 67  RPRVPAGQGGWFALLAGLALIEVLDPALPAPGAVMLKWPNDLMAGAAKLAGILLDATIEN 126

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             + A++VG+G+N+   P       TSL   GG +  + +       +   LD+    +G
Sbjct: 127 GMITAMIVGVGVNLAEAPPVPGRVTTSLAALGGAMTPEALAPAFCARLDHWLDVLA--SG 184

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +   W   A   G  IT+    G   G + G+DD G LLL E    V  +  GD+
Sbjct: 185 AAPLRAAWMRRAHPEGTAITV--DGGRRSGIYAGLDDDGALLLREGD-RVTALRGGDV 239


>gi|149191771|ref|ZP_01870010.1| biotin--protein ligase [Vibrio shilonii AK1]
 gi|148834413|gb|EDL51411.1| biotin--protein ligase [Vibrio shilonii AK1]
          Length = 319

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 92/239 (38%), Gaps = 9/239 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
           +E    I STN   + +  +        ++  Q+ GRGRR  +W+S    NLY S+    
Sbjct: 80  FELIPIIDSTNQYLLDK-QNSLESGAVCISEYQSKGRGRRGRQWVSPFGSNLYLSMYWKL 138

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  I VA+   +      G    +KWPND+    +K+AGIL+E      G
Sbjct: 139 EAGMAAAMGLSLVIGVAIVEALEQLGIDGVK--LKWPNDLYFNDKKLAGILVEMSGQAGG 196

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
              +V+G+G+N+                           D+     +     L+ ++   
Sbjct: 197 AANLVMGMGMNLNMSEQVEGIDQPWTSLNEVADKPFSRNDLVVAFIKAWQNALEDYEMCG 256

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +  W      +   + + +    I G   G+D  G +LLE + G ++    G+I
Sbjct: 257 -LHGFVERWNRHDNFLDREVRLVMGNRDIQGIVRGIDATGAVLLETEAG-IQPFIGGEI 313


>gi|326403100|ref|YP_004283181.1| biotin--[acetyl-CoA-carboxylase] synthetase [Acidiphilium
           multivorum AIU301]
 gi|325049961|dbj|BAJ80299.1| biotin--[acetyl-CoA-carboxylase] synthetase [Acidiphilium
           multivorum AIU301]
          Length = 242

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 76/238 (31%), Positives = 113/238 (47%), Gaps = 5/238 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E +DT+ ST+D C +RA  G+   L +VA+ QTAGRGR    W S  GN   S LL
Sbjct: 7   PWRIEHYDTLGSTSDFCARRAAEGEPERLMVVAARQTAGRGRAGRAWESPAGNFCGSALL 66

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +        +    +A+  V+   LP    V +KWPND++    K+AGIL++     
Sbjct: 67  RPRVPAGQGGWFALLAGLALIEVLDPALPAPGAVMLKWPNDLMAGAAKLAGILLDATIEN 126

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             + A++VG+G+N+   P       TSL   GG +  + +       +   LD+    +G
Sbjct: 127 GMITAMIVGVGVNLAEAPPVPGRVTTSLAALGGAMTPEALAPAFCARLDHWLDVLA--SG 184

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +   W C A   G  IT+    G   G + G+DD G LLL E    V  +  GD+
Sbjct: 185 AAPLRAAWMCRAHPEGTAITV--DGGRRSGIYAGLDDDGALLLREGD-RVTALRGGDV 239


>gi|212212566|ref|YP_002303502.1| biotin operon repressor [Coxiella burnetii CbuG_Q212]
 gi|212010976|gb|ACJ18357.1| biotin operon repressor [Coxiella burnetii CbuG_Q212]
          Length = 323

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 7/250 (2%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            +         R + F+ I+STN+   +      L     +A  QT G+GR    W S  
Sbjct: 72  KIKNAVQAEPVRIDLFEQINSTNEYLKRVNHPQQLN--ICLAEMQTQGKGRFQRAWHSPF 129

Query: 64  -GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
             N+Y SL          L  LS    +A+ + I    P+   + +KWPNDI+   +K+A
Sbjct: 130 GQNIYLSLKYPFHKDVSELAGLSLVCGLAVCNAIEKNCPLTKPIFVKWPNDIICEDKKLA 189

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQD 179
           GILIE     +G  + ++GIGLNV             +  +       D   + + L   
Sbjct: 190 GILIEIEAETHGFCSAIIGIGLNVNMEKEQDKINQPWISIKNLTATDQDRNQLCAALINQ 249

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +   +D ++K     E +  W+     +   I +K     + G+ +G++  GYL ++   
Sbjct: 250 LVNCIDCFEKKG-FNEFLASWKTKDYLLNKQIQLKSGRQELQGKSLGINPQGYLTVQLSD 308

Query: 240 GCVRQIFTGD 249
           G  R   +GD
Sbjct: 309 GSERIFSSGD 318


>gi|78187913|ref|YP_375956.1| biotin--acetyl-CoA-carboxylase ligase [Chlorobium luteolum DSM 273]
 gi|78167815|gb|ABB24913.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium luteolum DSM 273]
          Length = 326

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 106/243 (43%), Gaps = 6/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           +     +  ++ STN      A  G      +VA  Q+AGRGR    W S  G NLY SL
Sbjct: 80  FGRLIHWHRSLESTNSTARLLAAGGADEGAVVVAESQSAGRGRLGRSWDSPSGVNLYFSL 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  L+  +AVA+   + + L       IKWPNDILV  RK++GIL E  +
Sbjct: 140 VLRPQLPPGRIPQLTLLLAVALHRAL-TLLDGELRPAIKWPNDILVGGRKLSGILCEMQS 198

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQDVARVLDLW 187
             +    VV GIG+NV     +     T+          I    + + +   +  + D W
Sbjct: 199 EADRAHFVVAGIGINVNQAGFEGELDGTATSLRMETGRTISRPALLASVLNHLEPLYDRW 258

Query: 188 KK-DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++ +     +       A   G  ++++  +G++ G   G+   G L++    G   ++ 
Sbjct: 259 QQEEDDLRFVQKELEDNAFLQGRTVSVERMHGTLEGTVTGIAPTGELIITTPDGTPCRVA 318

Query: 247 TGD 249
           +G+
Sbjct: 319 SGE 321


>gi|28867838|ref|NP_790457.1| birA bifunctional protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851074|gb|AAO54152.1| birA bifunctional protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 319

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 110/247 (44%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           + E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S   
Sbjct: 67  IVESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++G+G+NV            TS++ + G    ++  +        
Sbjct: 185 ILLELIGDPADVCHVIIGVGVNVNMRASTEVDQLWTSVRLQTGAPADRNTIAARISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L +  +  G       W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 ALLVVHRQEGFLAFQKEWEQGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE-VNGLE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|124484959|ref|YP_001029575.1| hypothetical protein Mlab_0131 [Methanocorpusculum labreanum Z]
 gi|124362500|gb|ABN06308.1| biotin--acetyl-CoA-carboxylase ligase [Methanocorpusculum labreanum
           Z]
          Length = 328

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 107/243 (44%), Gaps = 11/243 (4%)

Query: 17  EFFDTISSTNDECMKRALS---GDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
             F+ + STN    +              ++A  QT G GR +  W+S +G ++A+++++
Sbjct: 87  HHFEQVPSTNALARQMMHEVGDEVQPGTVLIAEQQTGGLGRMNRVWMSPEGGIWATIVVM 146

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +  D   L+  A ++++   I           I+WPND+ +  +K+AG  +E    ++
Sbjct: 147 PKLHVDQTFLIMMAASISLARAIR--HEFELSALIQWPNDVFIGDKKVAGTTLELAADED 204

Query: 134 GLQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            ++  +VGIG++V  C     P  +    +     G  +D   +FS+  ++  R   +  
Sbjct: 205 IIKYCLVGIGVDVNVCVEKVMPNLSKIVTSLSDELGHDVDRAQLFSVFLKEFERRYQMIL 264

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K          WR  +  +   + ++    S  G  + VD+ G L++ +  G V ++  G
Sbjct: 265 KGETEPLFRE-WRSLSRTLHRRVRVRTIRESFEGEALDVDERGALIIHKDNGEVERVIAG 323

Query: 249 DIF 251
           D +
Sbjct: 324 DCY 326


>gi|283836711|ref|ZP_06356452.1| biotin-[acetyl-CoA-carboxylase] ligase [Citrobacter youngae ATCC
           29220]
 gi|291067304|gb|EFE05413.1| biotin-[acetyl-CoA-carboxylase] ligase [Citrobacter youngae ATCC
           29220]
          Length = 320

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 101/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   M R    +      VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGNITVLPVIDSTNQYLMDRIGQLE-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRDLG--ADKVRVKWPNDLYLLDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  ID   + + L +++   L L+
Sbjct: 194 KTGDAAQIVIGAGINMSMRRVEENVVNQGWINLQEAGINIDRNTLAARLIRELRAALVLF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + +      ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EHEG-LAPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDAQGALLLEQ-NGVIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|193083923|gb|ACF09601.1| biotin acetyl-CoA-carboxylase ligase [uncultured marine
           crenarchaeote KM3-34-D9]
          Length = 332

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 109/244 (44%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             R  +FD+I ST +  ++ A +       I++  QT G GR   KW S  G ++ S+++
Sbjct: 87  GKRIYYFDSIDSTQNFAVEIAPNRKENGTVIISKKQTEGMGRLKRKWKSPVGGIWLSVII 146

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
               S   +TL+  A ++A+   I   L       +KWPND+ + ++K+AGIL++T    
Sbjct: 147 HPKFSTSQITLVPIATSLALHKAIEKVLG--IKPMLKWPNDLTLKKKKVAGILLDTSIQS 204

Query: 133 NGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           N ++ +V+G+G+N K  P +                     +        F      +  
Sbjct: 205 NKIEFLVLGVGINFKIKPHNLEKLLKKTPNFYGASTLIEKNEKPLPLVKQFLHELENIFQ 264

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  ++I+  W   +  IG  +++    G   G+ + +D+ G L++  +    +++F
Sbjct: 265 MINSGSNKKIVTEWTKRSSTIGKNVSVITDDGRFNGKAIKLDNDGGLII-TRGKKTKKLF 323

Query: 247 TGDI 250
            GD+
Sbjct: 324 VGDV 327


>gi|295696303|ref|YP_003589541.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus tusciae DSM 2912]
 gi|295411905|gb|ADG06397.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus tusciae DSM 2912]
          Length = 328

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 103/244 (42%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                  +T+ STN      A  G      ++A  QTAGRGRR   W S     ++ S++
Sbjct: 82  GRHMTVLETVDSTNRYAFAEAEGGAPEGYTVLAERQTAGRGRRGRPWFSPPGHGIWMSVV 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ-RKIAGILIETLN 130
           L  +        L+   AV++   I         V IKWPND+L+   RK+ GIL E   
Sbjct: 142 LRPTFPVFRAPQLTLMAAVSVAEAIRERAG--VSVGIKWPNDLLLPDGRKVCGILSEMSA 199

Query: 131 LKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
               ++ +V+GIG+NV    +  P +      SL + G  I    +   L   +     +
Sbjct: 200 EAEEIRFIVLGIGINVFGREEDFPPELRGVAGSLAQPGSPISRTALIQGLLGRLEADYRI 259

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++ +  R      W      +G  I ++   G  +G    +DD G L +E  +G + +I 
Sbjct: 260 YQNEGFR-AFREGWERLNVSLGRTIAVQTQSGQKIGWARRIDDDGALWVETDEGRLEKII 318

Query: 247 TGDI 250
           + ++
Sbjct: 319 SAEV 322


>gi|304321902|ref|YP_003855545.1| biotin protein ligase [Parvularcula bermudensis HTCC2503]
 gi|303300804|gb|ADM10403.1| biotin protein ligase [Parvularcula bermudensis HTCC2503]
          Length = 258

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 104/243 (42%), Gaps = 6/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRAL---SGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
                 +  + STND   + A      D    W++A  QTAGRGRR   W     N   +
Sbjct: 12  GRPVWHYRAVGSTNDTAAELARMQGEMDRSPCWVIADHQTAGRGRRGRAWSDHADNFSGT 71

Query: 70  LLLIDSISKDSLT-LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           LL   +        L SF  A+A+     +     T + +KWPND+L+   K+ GIL+ET
Sbjct: 72  LLWPLAPEHGRTPALFSFLAALAIVDSFEAVGIPRTIIGLKWPNDVLLEGGKVCGILVET 131

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           +    GL A  +GIG+N+   P   P    +L +             L         ++ 
Sbjct: 132 VAGLEGLMAATIGIGVNLAQVPPHAPPEGRALSQWITPPPPTAFLETLDARFDEWWAIYG 191

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I + W   A G+   + ++LS  ++ G F G+D  G LLLE  +G V +   G
Sbjct: 192 AHG-FSRIRSAWLERATGLNQALVVRLSDRTLEGIFRGLDKDGALLLEH-QGEVTRFLAG 249

Query: 249 DIF 251
           D+F
Sbjct: 250 DVF 252


>gi|213969198|ref|ZP_03397336.1| birA bifunctional protein [Pseudomonas syringae pv. tomato T1]
 gi|301381705|ref|ZP_07230123.1| biotin--protein ligase [Pseudomonas syringae pv. tomato Max13]
 gi|302062649|ref|ZP_07254190.1| biotin--protein ligase [Pseudomonas syringae pv. tomato K40]
 gi|302130764|ref|ZP_07256754.1| biotin--protein ligase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213925876|gb|EEB59433.1| birA bifunctional protein [Pseudomonas syringae pv. tomato T1]
          Length = 319

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 109/247 (44%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           + E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S   
Sbjct: 67  IVESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++G+G+NV            TS++ + G    ++  +        
Sbjct: 185 ILLELIGDPADVCHVIIGVGVNVNMRVSTEVDQLWTSVRLQTGAPADRNTIAARISAQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G       W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 ALLAVHRQEGFLAFQKEWEQGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE-VNGLE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|294634233|ref|ZP_06712777.1| biotin-[acetyl-CoA-carboxylase] ligase [Edwardsiella tarda ATCC
           23685]
 gi|291092341|gb|EFE24902.1| biotin-[acetyl-CoA-carboxylase] ligase [Edwardsiella tarda ATCC
           23685]
          Length = 319

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 100/252 (39%), Gaps = 10/252 (3%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +     Q P++ R      + STN   + R           VA  Q AGRGRR  +W S 
Sbjct: 69  AEAITAQLPHA-RVTVLPVVDSTNQYLLDRISELQ-SGDACVAEYQQAGRGRRGRQWFSP 126

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY S+         +   LS  I + M  V+      G  V  KWPND+ +  RK+
Sbjct: 127 FGANLYLSMYWKLEQGPAAAMGLSLVIGIVMAEVLRELGADGVKV--KWPNDLYLNDRKL 184

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           AGIL+E          +V+G G+N+               +LQ  G  ID   + + L  
Sbjct: 185 AGILVELTGKTGDAANIVIGAGINLMMRNPDANVVDQQWINLQEAGVTIDRNRLVACLLG 244

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
            +   L  ++        +  WR     I   + + +   +I G   G+D  G LLLE +
Sbjct: 245 RLRATLTEFELRG-LAPFIARWRALDNFIDRPVRLLIGEQTIHGIARGIDAQGALLLE-R 302

Query: 239 KGCVRQIFTGDI 250
            G V     G+I
Sbjct: 303 DGVVTPFIGGEI 314


>gi|324110921|gb|EGC04912.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia fergusonii
           B253]
          Length = 321

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +VVG G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVVGAGINMAMRRVEESIVNQGWITLQEAGINLDRNALAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|312116316|ref|YP_004013912.1| biotin/acetyl-CoA-carboxylase ligase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221445|gb|ADP72813.1| biotin/acetyl-CoA-carboxylase ligase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 250

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 120/238 (50%), Gaps = 3/238 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
              FD+I STN+E +++  +     LWIVA  QT GRGR    W S +GN+YA+LLL  +
Sbjct: 9   VLRFDSIDSTNEEALRQLAAEADLPLWIVARTQTKGRGRAGRSWQSPEGNVYATLLLKTA 68

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIAGILIETLNLKN 133
           +S  + T LSF   +A     A+ L       +++KWPND+++ + K+AG L+E+++L  
Sbjct: 69  VSAATATQLSFVAGLAAHDAAAAHLSPNEAARLRLKWPNDLMLGRAKLAGNLLESISLAR 128

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             + + V +G+ +    +                 ++ +F+ L +     L  W +  G 
Sbjct: 129 N-RGLAVVLGVGMNVAALPDDTGRDVASLGLAPSSVEAVFASLARAFDIWLARWNEGRGF 187

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I   W   A  + + I++ L+   I GRF GVDD G L L  + G V  +  GDI+
Sbjct: 188 PAIREAWLSRALALNETISVNLNNSIIRGRFCGVDDTGALKLTTEAGVVMTVTAGDIY 245


>gi|281181042|dbj|BAI57372.1| biotin-[acetyl-CoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Escherichia coli SE15]
          Length = 321

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVTVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNSLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|251792305|ref|YP_003007030.1| biotin--protein ligase [Aggregatibacter aphrophilus NJ8700]
 gi|247533697|gb|ACS96943.1| biotin-[acetyl-CoA-carboxylase] ligase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 310

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 68/248 (27%), Positives = 102/248 (41%), Gaps = 7/248 (2%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            L++   P  +       ISSTN   +    +        +A  Q+AGRGRR  +WIS  
Sbjct: 64  RLAQALQP--YHVTLKPVISSTNQYLLDNIETLQK-GDLCLAEYQSAGRGRRGRQWISPF 120

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
                            L  LS  I +A+   +      G  V  KWPNDILV  RK+AG
Sbjct: 121 AGQIILSFYWQLDPSKPLDGLSSVIGLAIVQSLVELDMYGFQV--KWPNDILVNDRKLAG 178

Query: 124 ILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +N  NG   +V+GIG+NV          P   L      ID + +   + + + R
Sbjct: 179 ILVEIINRPNGKLNLVIGIGMNVSLGQEKHIDQPWAELSEFFPNIDREQVIIQMVKTIYR 238

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L  +++     E+   W       G  + +      I G   G++  G+L L  + G V
Sbjct: 239 YLSHFEQHGIDAEMQQQWLEHDAYFGTEVNVITEKSVISGIDQGINSSGHLCLMTQDG-V 297

Query: 243 RQIFTGDI 250
           R    G++
Sbjct: 298 RYFNAGEV 305


>gi|104744458|gb|ABF74574.1| biotin ligase [Mammalian expression vector pNBio]
 gi|104744493|gb|ABF74577.1| biotin ligase [Mammalian expression vector pCBio]
          Length = 334

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           +A  Q AGRGRR  KW S    NLY S+
Sbjct: 90  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSM 148

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 149 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 206

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 207 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 266

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 267 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 324

Query: 248 GDI 250
           G+I
Sbjct: 325 GEI 327


>gi|15804567|ref|NP_290608.1| biotin--protein ligase [Escherichia coli O157:H7 EDL933]
 gi|15834154|ref|NP_312927.1| biotin--protein ligase [Escherichia coli O157:H7 str. Sakai]
 gi|82778848|ref|YP_405197.1| biotin--protein ligase [Shigella dysenteriae Sd197]
 gi|168752646|ref|ZP_02777668.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4113]
 gi|168759132|ref|ZP_02784139.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4401]
 gi|168765262|ref|ZP_02790269.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4501]
 gi|168771444|ref|ZP_02796451.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4486]
 gi|168778065|ref|ZP_02803072.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4196]
 gi|168780898|ref|ZP_02805905.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4076]
 gi|168786837|ref|ZP_02811844.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC869]
 gi|168802900|ref|ZP_02827907.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC508]
 gi|170682429|ref|YP_001746361.1| biotin--protein ligase [Escherichia coli SMS-3-5]
 gi|208806288|ref|ZP_03248625.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4206]
 gi|208812148|ref|ZP_03253477.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4045]
 gi|208819796|ref|ZP_03260116.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4042]
 gi|209399876|ref|YP_002273493.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4115]
 gi|217326609|ref|ZP_03442693.1| bifunctional protein BirA [Escherichia coli O157:H7 str. TW14588]
 gi|218707596|ref|YP_002415115.1| biotin--protein ligase [Escherichia coli UMN026]
 gi|254795976|ref|YP_003080813.1| biotin--protein ligase [Escherichia coli O157:H7 str. TW14359]
 gi|261227311|ref|ZP_05941592.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257058|ref|ZP_05949591.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285391|ref|YP_003502209.1| Bifunctional protein BirA [Escherichia coli O55:H7 str. CB9615]
 gi|293407591|ref|ZP_06651509.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1412]
 gi|298383339|ref|ZP_06992931.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1302]
 gi|300897863|ref|ZP_07116247.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 198-1]
 gi|309783928|ref|ZP_07678573.1| bifunctional protein birA [Shigella dysenteriae 1617]
 gi|331665629|ref|ZP_08366525.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA143]
 gi|331685716|ref|ZP_08386298.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H299]
 gi|12518899|gb|AAG59173.1|AE005629_2 biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Escherichia coli O157:H7 str. EDL933]
 gi|13364376|dbj|BAB38323.1| bifunctional protein BirA biotin-[acetylCoA carboxylase] holoenzyme
           synthetase / biotin operon repressor [Escherichia coli
           O157:H7 str. Sakai]
 gi|81242996|gb|ABB63706.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella dysenteriae Sd197]
 gi|170520147|gb|ACB18325.1| bifunctional protein BirA [Escherichia coli SMS-3-5]
 gi|187766853|gb|EDU30697.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4196]
 gi|188013588|gb|EDU51710.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4113]
 gi|189001543|gb|EDU70529.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4076]
 gi|189354243|gb|EDU72662.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4401]
 gi|189359776|gb|EDU78195.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4486]
 gi|189364934|gb|EDU83350.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4501]
 gi|189373399|gb|EDU91815.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC869]
 gi|189375264|gb|EDU93680.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC508]
 gi|208726089|gb|EDZ75690.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4206]
 gi|208733425|gb|EDZ82112.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4045]
 gi|208739919|gb|EDZ87601.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4042]
 gi|209161276|gb|ACI38709.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4115]
 gi|209751898|gb|ACI74256.1| pantothenate kinase [Escherichia coli]
 gi|209751900|gb|ACI74257.1| pantothenate kinase [Escherichia coli]
 gi|209751902|gb|ACI74258.1| pantothenate kinase [Escherichia coli]
 gi|209751904|gb|ACI74259.1| pantothenate kinase [Escherichia coli]
 gi|209751906|gb|ACI74260.1| pantothenate kinase [Escherichia coli]
 gi|217322830|gb|EEC31254.1| bifunctional protein BirA [Escherichia coli O157:H7 str. TW14588]
 gi|218434693|emb|CAR15625.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli UMN026]
 gi|254595376|gb|ACT74737.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. TW14359]
 gi|284924070|emb|CBG37169.1| bifunctional protein [includes: biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase] [Escherichia
           coli 042]
 gi|290765264|gb|ADD59225.1| Bifunctional protein BirA [Escherichia coli O55:H7 str. CB9615]
 gi|291425359|gb|EFE98399.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1412]
 gi|298276218|gb|EFI17739.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1302]
 gi|300358418|gb|EFJ74288.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 198-1]
 gi|308928299|gb|EFP73761.1| bifunctional protein birA [Shigella dysenteriae 1617]
 gi|320190927|gb|EFW65577.1| biotin--protein ligase [Escherichia coli O157:H7 str. EC1212]
 gi|320639101|gb|EFX08739.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O157:H7 str. G5101]
 gi|320644494|gb|EFX13556.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O157:H- str. 493-89]
 gi|320649814|gb|EFX18333.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O157:H- str. H 2687]
 gi|320655147|gb|EFX23101.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320660791|gb|EFX28243.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665909|gb|EFX32938.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli O157:H7 str. LSU-61]
 gi|323943583|gb|EGB39693.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H120]
 gi|326347173|gb|EGD70903.1| biotin--protein ligase [Escherichia coli O157:H7 str. 1125]
 gi|331057147|gb|EGI29139.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA143]
 gi|331077026|gb|EGI48242.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H299]
          Length = 321

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVTVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|54293766|ref|YP_126181.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Legionella pneumophila str. Lens]
 gi|53753598|emb|CAH15056.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Legionella pneumophila str. Lens]
          Length = 333

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 104/243 (42%), Gaps = 7/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
             F    F +I STN       LS  +         QT GRGR    W S    N+Y S 
Sbjct: 84  QPFNLHLFTSIDSTNRYLKDLPLSSAVE--ICCTEMQTQGRGRFGRHWHSPFGENIYCST 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETL 129
               S     L+ LS  I++A    I   +   +D VKIKWPNDIL   +K+ GIL+E +
Sbjct: 142 RWSFSCDISKLSGLSLVISLATVLTINEFIVSDSDKVKIKWPNDILWNNKKLCGILVEII 201

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW-- 187
              N     ++G+GLN+     + P P  S        +     + +   +   L+ +  
Sbjct: 202 AESNATAQFIIGVGLNINSDTKNNPLPDKSWCSFFEITNQNYNRNSIVTRLLINLEKYLS 261

Query: 188 -KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
              +       + W  +   +G  + +  +  SI G  +G++ FG L+LE++ G   ++ 
Sbjct: 262 KFINNDLNAFKDDWNKYDYLVGKKVKVSQALNSISGIALGINSFGQLILEDEFGNKHELS 321

Query: 247 TGD 249
           +GD
Sbjct: 322 SGD 324


>gi|71734061|ref|YP_276722.1| biotin--protein ligase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554614|gb|AAZ33825.1| birA bifunctional protein [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 319

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 115/247 (46%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E L     +  V++GIG+NV      +     TS++ E G +  ++  + L      
Sbjct: 185 ILLELLGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSIRLETGSLADRNRIAALISSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L    +  G     + W       G  + +     ++ G  +G D  G L LE   G  
Sbjct: 245 SLLAVHRKEGFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGADSLGALRLE-VNGVE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|241204102|ref|YP_002975198.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857992|gb|ACS55659.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 254

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 111/240 (46%), Positives = 151/240 (62%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL
Sbjct: 13  DFRHEALSETSSTNSECLARARAGDGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLL 72

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ID    + L  L  AIAVA+   I   LP     +++KWPNDIL+ ++K  GIL+E   L
Sbjct: 73  IDPAPMERLGSLPLAIAVAVHQAIRRVLPLGAEPLEVKWPNDILIGRKKTCGILVEGEGL 132

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A++VGIG+N+   P +  YPVT L+++G     +++F+ LF   A VL++W +  
Sbjct: 133 PDGRYALIVGIGINISVMPDNPLYPVTCLRQQGSAASPEELFAHLFAAAAEVLEIWDQGR 192

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI  LWR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 193 GVGEITTLWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|119384962|ref|YP_916018.1| biotin--acetyl-CoA-carboxylase ligase [Paracoccus denitrificans
           PD1222]
 gi|119374729|gb|ABL70322.1| biotin--acetyl-CoA-carboxylase ligase [Paracoccus denitrificans
           PD1222]
          Length = 252

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 109/249 (43%), Gaps = 9/249 (3%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
             P            STN E +K A  G  G+ W++A  Q AGRGRR  +W+   GN   
Sbjct: 4   AWPEGVARHVLARTDSTNAEALKLAP-GLSGSAWVLAREQFAGRGRRGREWVMPAGNFAG 62

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           +L+L       +   LSF  A+A+   +         + IKWPND+L+   K+AGIL+E+
Sbjct: 63  TLVLRPQGGALAAAQLSFVAALALYDALGLACGPAARLAIKWPNDVLLNGGKVAGILLES 122

Query: 129 LNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
                G+QAV VGIG+N+   P           PV+     G  +D ++   LL    AR
Sbjct: 123 SGSGPGVQAVAVGIGVNLAAAPDAGAVEPGATPPVSVQGETGHAVDPEEFLDLLAPAFAR 182

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
                        I N W   A  +G+ I  +       G F G+DD G L+L    G  
Sbjct: 183 WQAQLDTYG-FAPIRNAWLARAARLGEPIIARTGTAESHGIFEGIDDSGALILRGPAGR- 240

Query: 243 RQIFTGDIF 251
           + I   ++F
Sbjct: 241 QVIPAAEVF 249


>gi|289422524|ref|ZP_06424367.1| biotin-(acetyl-CoA-carboxylase) ligase [Peptostreptococcus
           anaerobius 653-L]
 gi|289157096|gb|EFD05718.1| biotin-(acetyl-CoA-carboxylase) ligase [Peptostreptococcus
           anaerobius 653-L]
          Length = 327

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/241 (26%), Positives = 112/241 (46%), Gaps = 8/241 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
             R ++F TI STN +  K A         ++A  QT G+GR    W+S++   LY S +
Sbjct: 83  GQRVDYFKTIDSTNIQANKIASQ-SPEGTVVLADEQTKGKGRIGRTWVSEQNKGLYFSTI 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+      ++  +A ++          G ++ IKWPND++   +K+AGIL E    
Sbjct: 142 LKPDIALMQAPFITQLVAASLTKTFLDL---GIEISIKWPNDLIYKGKKVAGILTEMSAE 198

Query: 132 KNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +  ++VGIG+N+  K    +     TS   EG  ID  +     F +   + + +K 
Sbjct: 199 IDHISYIIVGIGINLYKKDFEDEIKDKATSFANEGIEIDRIEFLRKFFPNFEDLYEKFKA 258

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
              R E +++ R  +  +G  +        +      +DD G L++E + G V  +FTG+
Sbjct: 259 GDKR-ECLDILRSRSAVLGREVYKIKEGERVKVFARDIDDMGNLIVEHESGQVETVFTGE 317

Query: 250 I 250
           I
Sbjct: 318 I 318


>gi|29654317|ref|NP_820009.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Coxiella burnetii RSA 493]
 gi|153206793|ref|ZP_01945634.1| bifunctional protein birA [Coxiella burnetii 'MSU Goat Q177']
 gi|154706391|ref|YP_001424418.1| biotin operon repressor [Coxiella burnetii Dugway 5J108-111]
 gi|161830514|ref|YP_001596714.1| bifunctional protein birA [Coxiella burnetii RSA 331]
 gi|165918577|ref|ZP_02218663.1| bifunctional protein birA [Coxiella burnetii RSA 334]
 gi|212218437|ref|YP_002305224.1| biotin operon repressor [Coxiella burnetii CbuK_Q154]
 gi|29541584|gb|AAO90523.1| biotin operon repressor [Coxiella burnetii RSA 493]
 gi|120577156|gb|EAX33780.1| bifunctional protein birA [Coxiella burnetii 'MSU Goat Q177']
 gi|154355677|gb|ABS77139.1| biotin operon repressor [Coxiella burnetii Dugway 5J108-111]
 gi|161762381|gb|ABX78023.1| bifunctional protein birA [Coxiella burnetii RSA 331]
 gi|165917705|gb|EDR36309.1| bifunctional protein birA [Coxiella burnetii RSA 334]
 gi|212012699|gb|ACJ20079.1| biotin operon repressor [Coxiella burnetii CbuK_Q154]
          Length = 323

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 7/250 (2%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            +         R + F+ I+STN+   +      L     +A  QT G+GR    W S  
Sbjct: 72  KIKNAVQAEPVRIDLFEQINSTNEYLKRVNHPQQLN--ICLAEMQTQGKGRFQRAWHSPF 129

Query: 64  -GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
             N+Y SL          L  LS    +A+ + I    P+   + +KWPNDI+   +K+A
Sbjct: 130 GQNIYLSLKYPFHKDVSELAGLSLVCGLAVCNAIEENCPLTKPIFVKWPNDIICEDKKLA 189

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG---GCIDLKDIFSLLFQD 179
           GILIE     +G  + ++GIGLNV             +  +       D   + + L   
Sbjct: 190 GILIEIEAETHGFCSAIIGIGLNVNMEKEQDKINQPWISIKNLTATDQDRNQLCAALINQ 249

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +   +D ++K     E +  W+     +   I +K     + G+ +G++  GYL ++   
Sbjct: 250 LVNCIDCFEKKG-FNEFLASWKTKDYLLNKQIQLKSGRQELQGKSLGINPQGYLTVQLSD 308

Query: 240 GCVRQIFTGD 249
           G  R   +GD
Sbjct: 309 GSERIFSSGD 318


>gi|124441841|gb|ABN11538.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441845|gb|ABN11541.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441849|gb|ABN11544.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441869|gb|ABN11559.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441873|gb|ABN11562.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441877|gb|ABN11565.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441881|gb|ABN11568.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
          Length = 319

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 115/244 (47%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D ISST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 77  GQHLIYQDVISSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGIWMSLI 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I +         IKWPNDIL+  +K  GIL E    
Sbjct: 137 LRPDIPLQKTPQLTLLAAVAVVQGIEAAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV     D P  +  +     Q  G  ID   +   +     +    
Sbjct: 195 EDRVRSVIIGIGINVNQQSDDFPDELKDIATSLSQASGEKIDRAGVIQHILLCFEKRYRD 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE ++G +++I+
Sbjct: 255 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETQEG-IKKIY 312

Query: 247 TGDI 250
           + DI
Sbjct: 313 SADI 316


>gi|255102770|ref|ZP_05331747.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-63q42]
          Length = 325

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 111/241 (46%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
               E  DTI STN+   + A++  +    I++  Q  G+GR   +W       ++ S++
Sbjct: 80  GKNIEHLDTIDSTNEHAKRIAIN-SVDGTVILSEHQDMGKGRLGRRWDSKPHEGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  ++       ++     ++   + +    G +  IKWPND+++  +KI GIL E    
Sbjct: 139 LKPNMEPFKAPFITLIAGASVTKALNNL---GANTLIKWPNDVILNGKKICGILTELSAE 195

Query: 132 KNGLQAVVVGIGLN--VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                 VV+GIG+N  +     +     TSL +EG  +   DI   +  +  ++   +  
Sbjct: 196 IERTNYVVLGIGINVKIMDFEQEIADKATSLYKEGYMLSRVDIVRNVLTEFEKLYLDYTV 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +  +E+ + + R ++  I   I +       L + + +++ G LL++   G +++I +G+
Sbjct: 256 NNSKEKTLKICRDYSAIIDKNIYVLKGDNRELVKCLDINEEGNLLVQRSDGSIKEIISGE 315

Query: 250 I 250
           +
Sbjct: 316 V 316


>gi|296333018|ref|ZP_06875475.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674878|ref|YP_003866550.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|317374855|sp|E0U174|BIRA_BACPZ RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|773349|gb|AAB60184.1| BirA protein [Bacillus subtilis]
 gi|296149869|gb|EFG90761.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305413122|gb|ADM38241.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 325

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 115/244 (47%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
                + D ISST     + A +       +VA  QTAGRGR    W S +GN ++ SL+
Sbjct: 83  GQHLIYQDVISSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGIWMSLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+   AVA+   I +         IKWPNDIL+  +K  GIL E    
Sbjct: 143 LRPDIPLQKTPQLTLLAAVAVVQGIEAAAG--IQTDIKWPNDILINGKKTVGILTEMQAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
           ++ +++V++GIG+NV     D P  +  +     Q  G  ID   +   +     +    
Sbjct: 201 EDRVRSVIIGIGINVNQQSDDFPDELKDIATSLSQASGEKIDRAGVIQHILLCFEKRYRD 260

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +        I  LW  +A GIG  +  +   G+  G+ +G+DD G LLLE ++G +++I+
Sbjct: 261 YMTHG-FTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVLLLETQEG-IKKIY 318

Query: 247 TGDI 250
           + DI
Sbjct: 319 SADI 322


>gi|163752639|ref|ZP_02159812.1| birA bifunctional protein [Shewanella benthica KT99]
 gi|161327469|gb|EDP98682.1| birA bifunctional protein [Shewanella benthica KT99]
          Length = 320

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 97/241 (40%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           + R  +FD + STN   ++            +A  Q+AGRGRR   W+S    +LY S+ 
Sbjct: 78  NHRCFYFDELPSTNAFLLQHVDEL-TSGDICIAEYQSAGRGRRGRSWVSPYGCHLYCSMY 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                     + LS  +A ++  V+ S      D+ +KWPNDI +  +K+AG+LIE    
Sbjct: 137 WKLQHGMSQASGLSLVVACSLVKVLQSFGI--EDLGVKWPNDIYLNNKKLAGVLIEMSGQ 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +    +VVGIG+N+            +               L      ++   +    
Sbjct: 195 ADSECHLVVGIGINISMSQSQGDKIDQAWSDLSANPSCPSKTELAIALQKQLHQDFSTFE 254

Query: 192 GR--EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W+      G  + + +    I G   GVD+ G +LLE   G ++    G+
Sbjct: 255 RLGLTAFLARWQEVDVFFGKEVKLLMGDNQIQGICKGVDESGAILLETDNG-IKAFVGGE 313

Query: 250 I 250
           I
Sbjct: 314 I 314


>gi|331018144|gb|EGH98200.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 319

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 110/247 (44%), Gaps = 5/247 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           + E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S   
Sbjct: 67  IVESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQG--AGLKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E +     +  V++G+G+NV            TS++ + G    ++  +        
Sbjct: 185 ILLELIGDPADVCHVIIGVGVNVNMRASTEVDQLWTSVRLQTGAPADRNTIAARLSSQLE 244

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L +  +  G       W       G  + +     ++ G  +GVD  G L LE   G  
Sbjct: 245 ALLVVHRQEGFLAFQKEWEQGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE-VNGLE 303

Query: 243 RQIFTGD 249
           +    G+
Sbjct: 304 KSFSGGE 310


>gi|240103812|ref|YP_002960121.1| biotin--protein ligase [Thermococcus gammatolerans EJ3]
 gi|239911366|gb|ACS34257.1| Biotin--acetyl-CoA-carboxylase ligase (birA) [Thermococcus
           gammatolerans EJ3]
          Length = 237

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 9/238 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +     D + STN+   + A +       +VA  QTAGRGR+  +W S +G L+ +++L 
Sbjct: 3   WNIITLDEVDSTNEYARRIAPT-APEGTVVVAKRQTAGRGRKGRRWASPEGGLWMTVILK 61

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                + +T L F  A+A+   +      G   ++KWPND+LV  +KIAGIL E      
Sbjct: 62  PKSGPEHVTKLVFVGALAVLDTLHEY---GIRGELKWPNDVLVDGKKIAGILSECRLNHF 118

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            L  +  G+ +N +         V+  +  G  IDL+++ + + ++++R   L++ +   
Sbjct: 119 ALLGI--GLNVNNEIPDELRESAVSMKEVLGRAIDLEEVLNRVLRNLSRWYGLFR-NGRH 175

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSI-LGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            EI+   +  +  +G  + I      I  G  V +D+ G L+L+ ++  VR ++ GD+
Sbjct: 176 GEILKAVKGSSAVLGKRVRIIEDGEIIAEGIAVDIDNSGALILKGEENTVRVLY-GDV 232


>gi|158534337|gb|ABW71926.1| BirA [Mammalian expression vector pNBioSec]
          Length = 361

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           +A  Q AGRGRR  KW S    NLY S+
Sbjct: 117 DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSM 175

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 176 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 233

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 234 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 293

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 294 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 351

Query: 248 GDI 250
           G+I
Sbjct: 352 GEI 354


>gi|126701184|ref|YP_001090081.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Clostridium difficile 630]
 gi|255308591|ref|ZP_05352762.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile ATCC 43255]
 gi|115252621|emb|CAJ70464.1| BirA bifunctional protein (Includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase)
           [Clostridium difficile]
          Length = 325

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 110/241 (45%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
               E  DTI STN+   + A++  +    I++  Q  G+GR   +W       ++ S++
Sbjct: 80  GKNIEHLDTIDSTNEHAKRIAIN-SVDGTVILSEHQDMGKGRLGRRWDSKPHEGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       ++     ++   + +    G +  IKWPND+++  +KI GIL E    
Sbjct: 139 LKPDMEPFKAPFITLIAGASVTKALNNL---GANTLIKWPNDVILNGKKICGILTELSAE 195

Query: 132 KNGLQAVVVGIGLN--VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                 VV+GIG+N  +     +     TSL +EG  +   DI   +  +  ++   +  
Sbjct: 196 IERTNYVVLGIGINVKIMDFEQEIADKATSLYKEGYMLSRVDIVRNVLTEFEKLYLDYTV 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +  +E+ + + R ++  I   I +       L + + +++ G LL++   G +++I +G+
Sbjct: 256 NNSKEKTLKICRDYSAIIDKNIYVLKGDNRELVKCLDINEEGNLLVQRSDGSIKEIISGE 315

Query: 250 I 250
           +
Sbjct: 316 V 316


>gi|218551038|ref|YP_002384829.1| biotin--protein ligase [Escherichia fergusonii ATCC 35469]
 gi|218358579|emb|CAQ91227.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia fergusonii ATCC 35469]
          Length = 321

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|84502630|ref|ZP_01000749.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola batsensis
           HTCC2597]
 gi|84389025|gb|EAQ01823.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 70/250 (28%), Positives = 107/250 (42%), Gaps = 5/250 (2%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN 65
           ++   P        +T+ ST +E  +R   G     WI+A  QTA RGRR   W    GN
Sbjct: 3   ADPAWPEGHDRIVLETVDSTLNEAQRRFAGGINRPTWILALAQTAARGRRGRPWSMPPGN 62

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
             A+L+L  +   D + L SF  ++A+             + +KWPND+L+   K+AGIL
Sbjct: 63  FAATLILPTTERPDRIALRSFTTSLALFDACVGATGRTEGLALKWPNDVLLNGGKLAGIL 122

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE----GGCIDLKDIFSLLFQDVA 181
           +ETL          +GIG+N+   P  +     +L+       G     + F  L     
Sbjct: 123 LETLQSGGRTAGAAIGIGVNLASAPEVSEVEERALRPVALTGMGASPPPEDFLELLAQAF 182

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
              +   +  G   I   W   A  +G++IT +       GRF  +D+ G L+L    G 
Sbjct: 183 DRYETQFRHYGFAPIRTAWLDRAAHLGEVITARTGMSETTGRFETIDETGQLVLST-DGS 241

Query: 242 VRQIFTGDIF 251
            R I   DI+
Sbjct: 242 RRTIAAADIY 251


>gi|295112258|emb|CBL29008.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Synergistetes
           bacterium SGP1]
          Length = 331

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/257 (26%), Positives = 114/257 (44%), Gaps = 16/257 (6%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           S+LSE       R    DT+ STN    + AL+G      I A+ QT GRGRR   ++S 
Sbjct: 72  SHLSEACG--VRRVVCLDTVDSTNTHAKRLALAGAESGTLIAANQQTVGRGRRGRSFLSP 129

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF---- 117
               LY +LLL  S S +   +++ A   A+   +    P      +KW ND+ +     
Sbjct: 130 AGTGLYMTLLLRPSSSMERFQMITIAAGTAVCLAVEELTP--LRPLVKWVNDVYLHGRDG 187

Query: 118 -QRKIAGILIETLNLKNG--LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS 174
            +RK+ GIL E ++      ++ VVVGIGLNV            +       +    + +
Sbjct: 188 VERKVCGILSEAVSDVESGTVENVVVGIGLNVTTRDFGRDLNDRAGSIFPEGVSRNQLAA 247

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
                +A  L  +       E++  +R  +  +G  +         LGR V VD+ G L+
Sbjct: 248 R----IAERLMDFSTRLEDPELLRAYRERSLLLGRRVRWMQDGRGCLGRAVDVDELGGLV 303

Query: 235 LEEKKGCVRQIFTGDIF 251
           +E++ G  R + +G+++
Sbjct: 304 VEDEDGARRSLRSGEVY 320


>gi|167031483|ref|YP_001666714.1| biotin--protein ligase [Pseudomonas putida GB-1]
 gi|166857971|gb|ABY96378.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas putida GB-1]
          Length = 319

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 106/239 (44%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     +++ STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L
Sbjct: 76  WPVFIHESVDSTNAEGLRLANQGQAAPFVVLAERQSAGRGRRGRQWVSPFAENLYYSLVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + VA+   + +      DV +KWPND+LV  +KI GIL+E +   
Sbjct: 136 RVDGGMRQLEGLSLVVGVAVMRTLQAF--GVKDVGLKWPNDVLVRGQKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYP--VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+GIG+NV     D       +  +  G  ID   + + L Q +   L   ++ 
Sbjct: 194 ADVCHVVLGIGINVNMQANDQVDQEWTSMRREVGAAIDRNHLVASLNQQLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      I G  +GVD  G L LE   G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE-VDGVEKSFSGGE 310


>gi|293413411|ref|ZP_06656071.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           B354]
 gi|291468006|gb|EFF10505.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           B354]
          Length = 320

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVTVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|218556532|ref|YP_002389446.1| biotin--protein ligase [Escherichia coli IAI1]
 gi|307315460|ref|ZP_07595022.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli W]
 gi|218363301|emb|CAR00951.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli IAI1]
 gi|306905220|gb|EFN35770.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli W]
 gi|315063304|gb|ADT77631.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding protein transcriptional
           repressor, bio-5'-AMP-binding protein [Escherichia coli
           W]
 gi|323380633|gb|ADX52901.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli KO11]
          Length = 321

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|147920738|ref|YP_685458.1| putative pyruvate carboxylase, subunit A [uncultured methanogenic
           archaeon RC-I]
 gi|56295631|emb|CAH04872.1| pyruvate carboxylase subunit a [uncultured archaeon]
 gi|110620854|emb|CAJ36132.1| putative pyruvate carboxylase, subunit A [uncultured methanogenic
           archaeon RC-I]
          Length = 722

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 111/255 (43%), Gaps = 11/255 (4%)

Query: 4   NLSECQNP--YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAG-RGRRDNKWI 60
            + +C     +  +  +F+ ++STN    + A +G      I+A  Q+ G +GR   +WI
Sbjct: 455 EIKKCLKTKVFGHKIHYFEEVASTNRIAKEMAATGAEEGTMILAETQSGGIKGRIGREWI 514

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S  G +  SL+L    +  + + ++ A A A+   I        D +I WPND+L+  RK
Sbjct: 515 SPFGGVSFSLVLRPKAAPRNASKITLAAASAVCKTIREMYG--LDARISWPNDVLIGGRK 572

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-----DLKDIFSL 175
           + GIL +     N ++ +V+G G+NV    +  P  +                 KD    
Sbjct: 573 VCGILTDIAMDVNSIKYIVLGFGVNVNVEMLSFPTKIQKSATSIKEELGKTVSRKDFIDA 632

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           L ++     + +  +   EEI+  ++     +G  + +K       G  V + + G  ++
Sbjct: 633 LLREFEIQYEHF-NEGRYEEILTGYKSLIYPLGSRVIVKDQDNLYEGISVDITEDGAFVM 691

Query: 236 EEKKGCVRQIFTGDI 250
           + K G +    TGD+
Sbjct: 692 KAKDGSLMTFMTGDV 706


>gi|154248538|ref|YP_001419496.1| biotin--acetyl-CoA-carboxylase ligase [Xanthobacter autotrophicus
           Py2]
 gi|154162623|gb|ABS69839.1| biotin--acetyl-CoA-carboxylase ligase [Xanthobacter autotrophicus
           Py2]
          Length = 255

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 123/237 (51%), Gaps = 2/237 (0%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
              F  I STN E M R    +   +W+VA  QTAGRGRR   W S+ GNL+ASL+L + 
Sbjct: 13  IVRFTQIGSTNAEGMARLGRSETFPVWLVADIQTAGRGRRGRPWTSELGNLFASLVLPNP 72

Query: 76  ISKDSLTLLSFAIAVAMRSVI--ASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
               +L  L F   +A+R  +  A+       +++KWPND+L+   K+AGIL+E     +
Sbjct: 73  APVANLAQLCFVAGLALRDAVLAAAPQIRPDALRLKWPNDLLLDGGKVAGILVEGGADPS 132

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G  A V+G G+N  H P D PY  TSL+  G       +   L   +A  L+ W    G 
Sbjct: 133 GRPAAVIGFGVNCLHHPDDLPYRATSLEESGAPTAPDRLLEALDLAMAVRLNQWNAGAGF 192

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             I + W  +A G+GD +++K+    ++GRF  +D  G ++L  K G    I  GD+
Sbjct: 193 PAIRSDWMRYALGMGDQVSVKIGEREVVGRFENIDTRGAMMLRRKDGIAEIITAGDV 249


>gi|195940695|ref|ZP_03086077.1| biotin--protein ligase [Escherichia coli O157:H7 str. EC4024]
          Length = 326

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVTVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|326333790|ref|ZP_08200023.1| biotin-[acetyl-CoA-carboxylase] ligase [Nocardioidaceae bacterium
           Broad-1]
 gi|325948372|gb|EGD40479.1| biotin-[acetyl-CoA-carboxylase] ligase [Nocardioidaceae bacterium
           Broad-1]
          Length = 262

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/245 (26%), Positives = 107/245 (43%), Gaps = 7/245 (2%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLY 67
             P  +R E  D   STN E   RA SG+   L I    QTAGRGR D  W +  +  L 
Sbjct: 13  ALPGGWRVEILDETPSTNAELAARARSGEASGLVITTEHQTAGRGRLDRGWTTPARSALT 72

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
            S+LL  S S          +   +    ++    G    +KWPND+L+  RK+ GILIE
Sbjct: 73  VSVLLRPSASISVERWPWLPLMTGVAVA-STLRKKGYAAGLKWPNDVLIEGRKVCGILIE 131

Query: 128 TLNLKNGLQAVV-VGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            +    G  AV+  G+  +     +      +     G  +D  ++   L  ++    ++
Sbjct: 132 RIEAPEGAAAVIGFGLNTSQTREELPIEAATSLELESGAPVDRTEMLVALLAELGAAYEI 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSI-LGRFVGVDDFGYLLLEEKKGCVRQI 245
           W   +   E+   +R  +  +G+ +  +L  G +  G    +DDFG L++   +G  R +
Sbjct: 192 W--GSDPAELARRYRELSVTVGEQVRAELPGGDVWEGVATEIDDFGRLVIATDEGS-RVV 248

Query: 246 FTGDI 250
             GD+
Sbjct: 249 GAGDV 253


>gi|170770175|ref|ZP_02904628.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia albertii
           TW07627]
 gi|170120960|gb|EDS89891.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia albertii
           TW07627]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|301021755|ref|ZP_07185721.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 69-1]
 gi|300397880|gb|EFJ81418.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 69-1]
          Length = 320

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVTVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRTALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|193066775|ref|ZP_03047794.1| bifunctional protein BirA [Escherichia coli E22]
 gi|192925579|gb|EDV80254.1| bifunctional protein BirA [Escherichia coli E22]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 103/243 (42%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ EG  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEEGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|238927138|ref|ZP_04658898.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas flueggei ATCC
           43531]
 gi|238884920|gb|EEQ48558.1| biotin--[acetyl-CoA-carboxylase] ligase [Selenomonas flueggei ATCC
           43531]
          Length = 323

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 99/244 (40%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             +   +D + STN    + A  G      +VA  Q  GRGR +  + S     ++ S+L
Sbjct: 78  GKKIICYDAVDSTNLVLKQLAHEGAEDGTVVVADSQGTGRGRMERHFFSPPGKGIWVSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +         +   AVA+   +      G    IKWPNDI+   RK+ GIL E    
Sbjct: 138 LRPTFLPQDAPKCTLMAAVAVARAMEHF---GLRAAIKWPNDIIHKGRKLVGILTEMSAE 194

Query: 132 KNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  VV+GIG+NV       P +     TSL +  G    +  F         VL   
Sbjct: 195 MDRVDYVVIGIGINVNIAREDFPEELRDTATSLMQMKGTPLPRVAFLQELLRAVDVLYQE 254

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  G   ++  WR +A  +G  + +         G    +D  G L ++ K G  R++ 
Sbjct: 255 VQREGFAPVLAAWRKYAVTLGQTVRVIGPAGEEFEGVAADIDADGALFVDTKMGR-RRVL 313

Query: 247 TGDI 250
            GD+
Sbjct: 314 AGDV 317


>gi|156743597|ref|YP_001433726.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus castenholzii DSM
           13941]
 gi|156234925|gb|ABU59708.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus castenholzii DSM
           13941]
          Length = 272

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/245 (26%), Positives = 101/245 (41%), Gaps = 16/245 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
           ++ ++STND    RA +G    L ++   Q+AGRGR    W+S  G+  L + LL    +
Sbjct: 29  YERVASTNDIARARARNGYPEGLVVLTEEQSAGRGRLGRTWVSAYGDALLLSILLRPVWL 88

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIETLNLK 132
                  L+    VA+   +           +KWPND+L+F     RK AGIL E     
Sbjct: 89  PPGEAFSLTMMAGVALCEAVE--HVASVRAHLKWPNDLLLFVDGKWRKSAGILTEVSVNG 146

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-------CIDLKDIFSLLFQDVARVLD 185
           + L+  VVG+G+NV   P  T       Q            I    +   L   +     
Sbjct: 147 DTLEWAVVGMGVNVNQAPDSTINGRNLQQTATCISAAAGQRISRTALLEALLTTLDERYA 206

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              +   R  +   WR     +G+ +T+ L  G + G    V   G LLL +  G +  +
Sbjct: 207 Q-IRSGERAALFAAWRARLMHMGEPVTVTLPGGELHGIAEDVAPDGTLLLRDATGVLHAV 265

Query: 246 FTGDI 250
            TGD+
Sbjct: 266 HTGDV 270


>gi|300904222|ref|ZP_07122083.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 84-1]
 gi|301307397|ref|ZP_07213399.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 124-1]
 gi|300403827|gb|EFJ87365.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 84-1]
 gi|300837429|gb|EFK65189.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 124-1]
 gi|315252399|gb|EFU32367.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 85-1]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|74314471|ref|YP_312890.1| biotin--protein ligase [Shigella sonnei Ss046]
 gi|82546319|ref|YP_410266.1| biotin--protein ligase [Shigella boydii Sb227]
 gi|157156012|ref|YP_001465468.1| biotin--protein ligase [Escherichia coli E24377A]
 gi|157163446|ref|YP_001460764.1| biotin--protein ligase [Escherichia coli HS]
 gi|170022019|ref|YP_001726973.1| biotin--protein ligase [Escherichia coli ATCC 8739]
 gi|187731456|ref|YP_001882662.1| biotin--protein ligase [Shigella boydii CDC 3083-94]
 gi|188495234|ref|ZP_03002504.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Escherichia coli 53638]
 gi|191169657|ref|ZP_03031358.1| bifunctional protein BirA [Escherichia coli B7A]
 gi|193071829|ref|ZP_03052717.1| bifunctional protein BirA [Escherichia coli E110019]
 gi|194430466|ref|ZP_03062945.1| bifunctional protein BirA [Escherichia coli B171]
 gi|194440199|ref|ZP_03072240.1| bifunctional protein BirA [Escherichia coli 101-1]
 gi|209921455|ref|YP_002295539.1| biotin--protein ligase [Escherichia coli SE11]
 gi|218697685|ref|YP_002405352.1| biotin--protein ligase [Escherichia coli 55989]
 gi|253775393|ref|YP_003038224.1| biotin--protein ligase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163919|ref|YP_003047027.1| biotin--protein ligase [Escherichia coli B str. REL606]
 gi|256021702|ref|ZP_05435567.1| biotin--protein ligase [Shigella sp. D9]
 gi|260846778|ref|YP_003224556.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O103:H2 str. 12009]
 gi|260870689|ref|YP_003237091.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O111:H- str. 11128]
 gi|293474285|ref|ZP_06664694.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           B088]
 gi|300820172|ref|ZP_07100338.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 107-1]
 gi|300825462|ref|ZP_07105531.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 119-7]
 gi|300917835|ref|ZP_07134475.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 115-1]
 gi|300925973|ref|ZP_07141800.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 182-1]
 gi|300930507|ref|ZP_07145905.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 187-1]
 gi|301327873|ref|ZP_07221053.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 78-1]
 gi|309797679|ref|ZP_07692065.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 145-7]
 gi|312974237|ref|ZP_07788407.1| bifunctional protein birA [Escherichia coli 1827-70]
 gi|331655672|ref|ZP_08356662.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli M718]
 gi|331670828|ref|ZP_08371663.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA271]
 gi|331680094|ref|ZP_08380755.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H591]
 gi|332282946|ref|ZP_08395359.1| biotin-protein ligase [Shigella sp. D9]
 gi|73857948|gb|AAZ90655.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella sonnei Ss046]
 gi|81247730|gb|ABB68438.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase [Shigella
           boydii Sb227]
 gi|157069126|gb|ABV08381.1| bifunctional protein BirA [Escherichia coli HS]
 gi|157078042|gb|ABV17750.1| bifunctional protein BirA [Escherichia coli E24377A]
 gi|169756947|gb|ACA79646.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli ATCC 8739]
 gi|187428448|gb|ACD07722.1| bifunctional protein BirA [Shigella boydii CDC 3083-94]
 gi|188490433|gb|EDU65536.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Escherichia coli 53638]
 gi|190900301|gb|EDV60149.1| bifunctional protein BirA [Escherichia coli B7A]
 gi|192954860|gb|EDV85375.1| bifunctional protein BirA [Escherichia coli E110019]
 gi|194411489|gb|EDX27832.1| bifunctional protein BirA [Escherichia coli B171]
 gi|194420869|gb|EDX36915.1| bifunctional protein BirA [Escherichia coli 101-1]
 gi|209914714|dbj|BAG79788.1| biotin-[acetyl-CoA carboxylase] holoenzyme synthase and biotin
           operon repressor [Escherichia coli SE11]
 gi|218354417|emb|CAV01212.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli 55989]
 gi|242379508|emb|CAQ34324.1| bifunctional biotin-[acetyl-CoA-carboxylase] ligase and
           transcriptional repressor [Escherichia coli BL21(DE3)]
 gi|253326437|gb|ACT31039.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975820|gb|ACT41491.1| biotin-protein ligase [Escherichia coli B str. REL606]
 gi|253979976|gb|ACT45646.1| biotin-protein ligase [Escherichia coli BL21(DE3)]
 gi|257761925|dbj|BAI33422.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O103:H2 str. 12009]
 gi|257767045|dbj|BAI38540.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O111:H- str. 11128]
 gi|291321315|gb|EFE60756.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           B088]
 gi|300414957|gb|EFJ98267.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 115-1]
 gi|300417965|gb|EFK01276.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 182-1]
 gi|300461619|gb|EFK25112.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 187-1]
 gi|300522076|gb|EFK43145.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 119-7]
 gi|300527282|gb|EFK48344.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 107-1]
 gi|300845604|gb|EFK73364.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 78-1]
 gi|308118691|gb|EFO55953.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 145-7]
 gi|310331404|gb|EFP98669.1| bifunctional protein birA [Escherichia coli 1827-70]
 gi|320174323|gb|EFW49475.1| biotin--protein ligase [Shigella dysenteriae CDC 74-1112]
 gi|320185985|gb|EFW60733.1| biotin--protein ligase [Shigella flexneri CDC 796-83]
 gi|320200184|gb|EFW74773.1| biotin--protein ligase [Escherichia coli EC4100B]
 gi|323161272|gb|EFZ47184.1| bifunctional protein birA [Escherichia coli E128010]
 gi|323167448|gb|EFZ53156.1| bifunctional protein birA [Shigella sonnei 53G]
 gi|323174287|gb|EFZ59913.1| bifunctional protein birA [Escherichia coli LT-68]
 gi|323177995|gb|EFZ63579.1| bifunctional protein birA [Escherichia coli 1180]
 gi|323182074|gb|EFZ67484.1| bifunctional protein birA [Escherichia coli 1357]
 gi|323958936|gb|EGB54610.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H489]
 gi|323969083|gb|EGB64390.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA007]
 gi|324016020|gb|EGB85239.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 117-3]
 gi|324115441|gb|EGC09385.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli E1167]
 gi|331046597|gb|EGI18684.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli M718]
 gi|331061916|gb|EGI33840.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA271]
 gi|331072249|gb|EGI43583.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H591]
 gi|332088156|gb|EGI93279.1| bifunctional protein birA [Shigella boydii 3594-74]
 gi|332105298|gb|EGJ08644.1| biotin-protein ligase [Shigella sp. D9]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|16131807|ref|NP_418404.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110061|ref|AP_003841.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K-12 substr.
           W3110]
 gi|170083438|ref|YP_001732758.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K-12 substr.
           DH10B]
 gi|194435381|ref|ZP_03067578.1| bifunctional protein BirA [Shigella dysenteriae 1012]
 gi|238903034|ref|YP_002928830.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli BW2952]
 gi|254039232|ref|ZP_04873281.1| biotin-holoenzyme synthetase [Escherichia sp. 1_1_43]
 gi|256026293|ref|ZP_05440158.1| biotin--protein ligase [Escherichia sp. 4_1_40B]
 gi|300948195|ref|ZP_07162321.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 116-1]
 gi|300958242|ref|ZP_07170390.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 175-1]
 gi|301028266|ref|ZP_07191529.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 196-1]
 gi|301648418|ref|ZP_07248152.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 146-1]
 gi|307140668|ref|ZP_07500024.1| biotin--protein ligase [Escherichia coli H736]
 gi|331644708|ref|ZP_08345826.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H736]
 gi|115015|sp|P06709|BIRA_ECOLI RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|14488672|pdb|1HXD|A Chain A, Crystal Structure Of E. Coli Biotin Repressor With Bound
           Biotin
 gi|14488673|pdb|1HXD|B Chain B, Crystal Structure Of E. Coli Biotin Repressor With Bound
           Biotin
 gi|90109230|pdb|2EWN|A Chain A, Ecoli Biotin Repressor With Co-Repressor Analog
 gi|90109231|pdb|2EWN|B Chain B, Ecoli Biotin Repressor With Co-Repressor Analog
 gi|157830325|pdb|1BIA|A Chain A, The E. Coli Biotin Holoenzyme Synthetase(Slash)bio
           Repressor Crystal Structure Delineates The Biotin And
           Dna- Binding Domains
 gi|157830326|pdb|1BIB|A Chain A, The E. Coli Biotin Holoenzyme Synthetase(Slash)bio
           Repressor Crystal Structure Delineates The Biotin And
           Dna- Binding Domains
 gi|4545270|gb|AAD22470.1|AF121784_2 biotin protein ligase [Expression vector pCY216]
 gi|145432|gb|AAA23520.1| bifunctional protein [Escherichia coli]
 gi|145434|gb|AAA23521.1| biotin-holoenzyme synthetase [Escherichia coli]
 gi|396316|gb|AAC43075.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|1790408|gb|AAC76951.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K-12 substr.
           MG1655]
 gi|2852398|gb|AAC40211.1| Eschericia coli biotin-holoenzyme synthetase [Cloning vector
           pBIOTRX-BirA]
 gi|4545273|gb|AAD22472.1| biotin protein ligase [Expression vector pCY215]
 gi|85676092|dbj|BAE77342.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K12 substr.
           W3110]
 gi|169891273|gb|ACB04980.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli str. K-12 substr.
           DH10B]
 gi|194416375|gb|EDX32547.1| bifunctional protein BirA [Shigella dysenteriae 1012]
 gi|226838467|gb|EEH70497.1| biotin-holoenzyme synthetase [Escherichia sp. 1_1_43]
 gi|238860074|gb|ACR62072.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli BW2952]
 gi|260451195|gb|ACX41617.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Escherichia coli DH1]
 gi|299878667|gb|EFI86878.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 196-1]
 gi|300315082|gb|EFJ64866.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 175-1]
 gi|300452268|gb|EFK15888.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 116-1]
 gi|301073507|gb|EFK88313.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 146-1]
 gi|309704393|emb|CBJ03742.1| bifunctional protein [includes: biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase] [Escherichia
           coli ETEC H10407]
 gi|315138534|dbj|BAJ45693.1| biotin--protein ligase [Escherichia coli DH1]
 gi|315617766|gb|EFU98371.1| bifunctional protein birA [Escherichia coli 3431]
 gi|320179562|gb|EFW54513.1| biotin--protein ligase [Shigella boydii ATCC 9905]
 gi|323938874|gb|EGB35095.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli E482]
 gi|331036008|gb|EGI08245.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H736]
 gi|332083865|gb|EGI89078.1| bifunctional protein birA [Shigella boydii 5216-82]
 gi|332086309|gb|EGI91462.1| bifunctional protein birA [Shigella dysenteriae 155-74]
 gi|332345966|gb|AEE59300.1| bifunctional protein BirA [Escherichia coli UMNK88]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           +A  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|148658140|ref|YP_001278345.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus sp. RS-1]
 gi|148570250|gb|ABQ92395.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus sp. RS-1]
          Length = 272

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 104/245 (42%), Gaps = 16/245 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
           ++ ++STND   +RA SG    L ++A  Q+AGRGR    W++  G+  L + LL    +
Sbjct: 29  YERVASTNDIARERARSGAAEGLIVLAEEQSAGRGRLGRNWVASYGDALLMSVLLRPVWL 88

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIETLNLK 132
                  L+    VA+   +          ++KWPND+L+F     RK AGIL E     
Sbjct: 89  PPGEAFTLTMLAGVALCEAVEQV--AAVRAQLKWPNDLLLFANGAWRKGAGILTEISVAG 146

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-------GCIDLKDIFSLLFQDVARVLD 185
           + ++  ++GIGLNV   P          Q            I    +   L   +     
Sbjct: 147 DAIEWAIIGIGLNVNQAPTGAVNGRNLQQTATSVSAAAGQRISRTALLETLLTSLDERYA 206

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L +    R  +   WR     +G+ +T+ L  G + G    V   G LLL +  G +  I
Sbjct: 207 LLR-SGERATLFADWRARLAYLGETVTVTLPNGELRGIAEDVAADGTLLLRDAAGVLHTI 265

Query: 246 FTGDI 250
            TGD+
Sbjct: 266 HTGDV 270


>gi|72162952|ref|YP_290609.1| biotin--acetyl-CoA-carboxylase ligase [Thermobifida fusca YX]
 gi|71916684|gb|AAZ56586.1| biotin--acetyl-CoA-carboxylase ligase [Thermobifida fusca YX]
          Length = 299

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 103/243 (42%), Gaps = 10/243 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLI 73
                 ++ STN E + +A  G      +V   QTAGRGR    + +  +  L  S+LL 
Sbjct: 52  SVHVVPSLGSTNTELLAQARQGAPAGTVLVTEHQTAGRGRLGRSFHTPARAALTFSVLLR 111

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            ++       L   +  A  + +        D ++KWPND+L   RKIAGIL E +   +
Sbjct: 112 PTVPSARYGWLPLLMGAATAAGVRRV--AAVDAQVKWPNDVLAQDRKIAGILSEAVFGPS 169

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG--CIDLKDIFSLLFQDVARVLDLWKKDT 191
           G  AVV+G GLNV     + P P  +     G  C+D   +   + Q  A     W +  
Sbjct: 170 GP-AVVIGTGLNVTQTAAELPVPTATSLALAGASCVDRGLLLCAILQAFADRYTRWVEHD 228

Query: 192 GREEIMNL---WRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           G  E   L   +R     +G  + + L   S + G  +G+D  G L +    G    +  
Sbjct: 229 GDAERSGLAAEYRSVCSTLGQQVRVHLPGNSVVEGTAMGIDTDGRLQVRSDGGRDHALTV 288

Query: 248 GDI 250
           GD+
Sbjct: 289 GDV 291


>gi|53804169|ref|YP_114219.1| birA bifunctional protein [Methylococcus capsulatus str. Bath]
 gi|53757930|gb|AAU92221.1| birA bifunctional protein [Methylococcus capsulatus str. Bath]
          Length = 331

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
            E  + + STND  M+RA  G       +A  Q+AGRGR    W+S         LL   
Sbjct: 91  IEVHEQLDSTNDHLMRRAAEGAPAGTVCLAERQSAGRGRIGRTWVSPLSGNVYLSLLWRF 150

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                  L S A+ VA+   + +      D  +KWPNDIL  +RK+ GILIE     N  
Sbjct: 151 GRAGFSGL-SLAVGVAVVRALRAQGIG--DAALKWPNDILWSRRKLGGILIEVRGEANDQ 207

Query: 136 QAVVVGIGLNVKHCPVD-----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            AVV+GIGLNV             +   +    G  +    + + +  ++A +L  ++  
Sbjct: 208 YAVVIGIGLNVNLPDSHAVAIDQDWIDLARIPGGAAVSRNRLIAGMLNELAPLLTDYETT 267

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  WR +    G   +++       GR VGV   G LLL  + G VR+  +GD+
Sbjct: 268 G-LAPYLEEWRGYHGFEGAQASVQQGDWVWTGRIVGVSAEGLLLLACEDGPVREFASGDV 326


>gi|332977065|gb|EGK13869.1| biotin--[acetyl-CoA-carboxylase] ligase [Desmospora sp. 8437]
          Length = 324

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 103/245 (42%), Gaps = 10/245 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASL 70
           +  +  +   +SST     + A  G      ++   Q  GRGR    W+   +  ++ SL
Sbjct: 82  FGQQIRYRQQVSSTQLLAHEWAREGAEEGSLVITEEQVQGRGRMGRNWVSPPRSGIWMSL 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   I       L+   +VA+   +        +++IKWPND+L+  RKI GIL ET  
Sbjct: 142 ILRPPIPLIQAPQLTLLTSVALTRALRKA--TDLEIRIKWPNDLLIRGRKICGILTETRG 199

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-----GGCIDLKDIFSLLFQDVARVLD 185
            ++ +Q VVVG+G+NV          +                   + + + +++  + D
Sbjct: 200 EQDQIQYVVVGMGINVNVTESSWSGELKKKATSLAIEGNTTYHRAKLIAGILKELEGLYD 259

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +      + I  LW  +A  +G  I      G + G  VG+D  G LL+      V  +
Sbjct: 260 AYLVHG-FDPIRILWEEYAGMLGRQIRTLTPEGPVEGTAVGLDPSGALLIRRGD-RVSPV 317

Query: 246 FTGDI 250
           F+ +I
Sbjct: 318 FSAEI 322


>gi|331083391|ref|ZP_08332503.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330404084|gb|EGG83632.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 253

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 15  RYEFFDTISSTNDECMKRALS---GDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASL 70
           +  + +++ ST     + A      +L     VA+ QTAG+GR    W S    N+Y +L
Sbjct: 3   KIFWKESVDSTLTWAKEEAKKSVGKELDGALFVANEQTAGKGRLGRVWTSVPGENIYMTL 62

Query: 71  L-LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L +   +  ++ + L+  + +++   +        D  IKWPNDI++ ++KI GIL E  
Sbjct: 63  LLMQPEVRAENASSLTLVMGLSVAEAVEEMAG--IDAGIKWPNDIVLSKKKICGILTEMQ 120

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
             +     +++G+G+NV              +     G  +  +++ + +     +  +L
Sbjct: 121 MKEQKPDFIMIGVGINVNQKEFQEELRNKATSVFLETGKEMSREELVAKVTACFWKNYEL 180

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K    + +   +          + I       +G   G+ D G LL+E+ +G VR++F
Sbjct: 181 FLKTQNLKALKEEYEKRLLNKNQQVRILEKGTETIGTARGITDTGELLVEDLQGKVRKVF 240

Query: 247 TGDI 250
           +G++
Sbjct: 241 SGEV 244


>gi|295098828|emb|CBK87917.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Eubacterium
           cylindroides T2-87]
          Length = 255

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 97/247 (39%), Gaps = 10/247 (4%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN 65
            +   P  ++ +  D+ +STN    +   +       ++A  QT G+GR    + S   +
Sbjct: 13  IQSSLPSFYQIKVIDSTASTNSWLSE--HTDLPEGTVLIADHQTQGKGRNGRSFYSPSNS 70

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
            +Y SLLL     K+ +   +   A+ M   I S         IKW NDI    +K+ GI
Sbjct: 71  GIYLSLLLKPKEDKECVLHYTALSALCMCKAIQSVYGFS--PSIKWLNDIYFHDKKLGGI 128

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L E    +    ++++GIG+NV        YP           D           +   L
Sbjct: 129 LCEGKLQQERFDSLIIGIGINV----HSFIYPEDIASIACAVEDFVPFKKPRNILITSFL 184

Query: 185 DLWK-KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           + +    T     +  ++     I   + I        G  +GVDD   L+++++ G + 
Sbjct: 185 ESFYDYYTNHHSFLQAYKDHLAYINQTVRILHPQKEYKGTILGVDDSFRLVIKKEDGSID 244

Query: 244 QIFTGDI 250
            + +G+I
Sbjct: 245 HLSSGEI 251


>gi|330831437|ref|YP_004394389.1| biotin-(acetyl-CoA-carboxylase) ligase [Aeromonas veronii B565]
 gi|328806573|gb|AEB51772.1| Biotin-(Acetyl-CoA-carboxylase) ligase [Aeromonas veronii B565]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/239 (26%), Positives = 97/239 (40%), Gaps = 10/239 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
              F  I STN   + R           +A CQTAGRGRR   WIS  G  L  S+    
Sbjct: 81  VHCFPVIGSTNQHLLDRVNEL-RSGESCLAECQTAGRGRRGKPWISPFGCQLILSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS A+ VA+   + S    G +  +KWPND+    RK+AGIL+E       
Sbjct: 140 EQGMAAAMGLSLAVGVAVVEALESLGYQGVE--LKWPNDLYYQGRKLAGILVEMSGSAGA 197

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKKD 190
              +V+GIGLN+     +      +            D   + + +   + R L  +++ 
Sbjct: 198 SCHLVIGIGLNLAMPAREGEKIDQAWAELRHINPELVDRNQLAARMIVHLQRALHTFEQQ 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 ++ W       G  + + +    I G   G+DD G L LE ++G  +    G+
Sbjct: 258 G-LASFVDDWNRLDHFAGRPVRLLMGDQEIRGIARGIDDRGALRLETEEGT-KFYLGGE 314


>gi|308188898|ref|YP_003933029.1| Biotin-(acetyl-CoA carboxylase) ligase [Pantoea vagans C9-1]
 gi|308059408|gb|ADO11580.1| Biotin-(acetyl-CoA carboxylase) ligase [Pantoea vagans C9-1]
          Length = 319

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 101/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   ++R           +A  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  NVSIIPVIDSTNQYLLERMHD-MPSGTACIAEYQQAGRGRRGRQWFSPFGANLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M   + +      DV++KWPNDI +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVMAETLRALG--ADDVRVKWPNDIYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  ++  ++ + L   +   L L++++
Sbjct: 197 DAAQIVMGAGINLAMRTADASQINQGWINLQEAGVSVNRNELAARLINSLREALPLFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    + G   GVD  G LLLE+  G ++    G+I
Sbjct: 257 G-LTAFISRWAALDNFINRPVKLLIGEREVHGIARGVDSQGGLLLEQ-DGEIKAWVGGEI 314


>gi|293417480|ref|ZP_06660103.1| birA BirA [Escherichia coli B185]
 gi|291430807|gb|EFF03804.1| birA BirA [Escherichia coli B185]
          Length = 321

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 101/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR   W S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRTWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|329765334|ref|ZP_08256914.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329138240|gb|EGG42496.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 333

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 111/247 (44%), Gaps = 12/247 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           +  R  +F++I ST ++ MK A   D     I+A  QT+G+GR   KW+S KG ++ S++
Sbjct: 86  FGKRAYYFESIDSTQNQAMKMASDVD-DGTIIIAEKQTSGKGRSGRKWVSPKGGIWFSII 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +       ++TL   A ++ +   I  TL      ++KWPNDI +  +K+AG+L++    
Sbjct: 145 MHPKFDISAITLFPLASSLGLAYAIEKTLG--IKSELKWPNDITIKGKKVAGMLVDASIE 202

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI--------FSLLFQDVARV 183
            N ++ +++G+G+N           +   +   G   L +             F      
Sbjct: 203 SNKIEKLILGVGINFNVDVKQIEKTLKDTENFYGVASLSEQNKTIKPISLLQSFLIELEQ 262

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           +         ++I+  +   +  +G  + +      I G  + +DD G L++  +     
Sbjct: 263 VYNLLNSGDSKKIIREYTKRSSTVGQKVELNTDNRKIKGIAIKIDDDGALVV-SENKKNI 321

Query: 244 QIFTGDI 250
           ++ +GDI
Sbjct: 322 RVTSGDI 328


>gi|260858087|ref|YP_003231978.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O26:H11 str. 11368]
 gi|257756736|dbj|BAI28238.1| bifunctional biotin-[acetylCoA carboxylase]holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O26:H11 str. 11368]
 gi|323155531|gb|EFZ41709.1| bifunctional protein birA [Escherichia coli EPECa14]
          Length = 321

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGSSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|170742525|ref|YP_001771180.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium sp. 4-46]
 gi|168196799|gb|ACA18746.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium sp. 4-46]
          Length = 264

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 109/244 (44%), Gaps = 7/244 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E  DT+ ST+ + M RA  G  G LW+ A  QT GRGRR   W S +GNL ASL  
Sbjct: 13  GYRLEAHDTLGSTSTQAMARAREGAAGPLWVAARRQTEGRGRRGRTWTSPEGNLAASLYW 72

Query: 73  I------DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
                           +   ++  A+             +++KWPND+L    K+AGIL+
Sbjct: 73  PVPPGLAPEEVATLAFVAGLSLEGALVLAGGPAREGSPPLRLKWPNDVLAGSAKLAGILL 132

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E  +L  G  A+VVG G+NV   P   PY  TSL   G   + + +   L     R L +
Sbjct: 133 EMESLPRGA-ALVVGFGVNVAAAPEGLPYLATSLAAIGRPAEAEGLLRQLTGTWLRWLRI 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W +  G   I   W   A G+     ++     + G F  +D  G L+L    G  R + 
Sbjct: 192 WDEGRGFPAIREAWLARAAGLEGPALVRAGSERLSGTFETIDSRGRLVLRLPDGARRTVT 251

Query: 247 TGDI 250
            G++
Sbjct: 252 AGEV 255


>gi|255657508|ref|ZP_05402917.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-23m63]
 gi|296452820|ref|ZP_06894507.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Clostridium
           difficile NAP08]
 gi|296879928|ref|ZP_06903900.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Clostridium
           difficile NAP07]
 gi|296258368|gb|EFH05276.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Clostridium
           difficile NAP08]
 gi|296429042|gb|EFH14917.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Clostridium
           difficile NAP07]
          Length = 325

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 110/241 (45%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLL 71
               E  +TI STN+   + A++  L    I++  Q  G+GR   +W       ++ S++
Sbjct: 80  GKNIEHLETIDSTNEHAKRIAVN-SLDGTVILSEHQDMGKGRLGRRWDSKPHEGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       ++     ++   +     +G +  IKWPND+++  +KI GIL E    
Sbjct: 139 LKPDMEPFKAPFITLIAGASVTKAL---NNMGANTLIKWPNDVILNGKKICGILTELSAE 195

Query: 132 KNGLQAVVVGIGLN--VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                 VV+GIG+N  +     +     TSL +EG  +   DI   +  +  ++   +  
Sbjct: 196 IERTNYVVLGIGINVKIMDFEQEIAEKATSLYKEGYMLSRVDIVRNVLTEFEKLYLDYTV 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +  +E+ + + R ++  I   I +       L + + +++ G LL++   G +++I +G+
Sbjct: 256 NNSKEKTLKICRDYSAIIDKNIYVLKGDNKELVKCLDINEEGNLLVQRSDGNIKEIISGE 315

Query: 250 I 250
           +
Sbjct: 316 V 316


>gi|323974209|gb|EGB69340.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TW10509]
          Length = 321

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAH--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +VVG G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVVGAGINMAMRRVEESVVNQGWITLQEAGINLDRNALAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|238062713|ref|ZP_04607422.1| biotin-acetyl-CoA-carboxylase ligase [Micromonospora sp. ATCC
           39149]
 gi|237884524|gb|EEP73352.1| biotin-acetyl-CoA-carboxylase ligase [Micromonospora sp. ATCC
           39149]
          Length = 291

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/269 (23%), Positives = 97/269 (36%), Gaps = 27/269 (10%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           L+    P++ R E      STN +  + A SG+   L ++A  QTAGRGRR   W S   
Sbjct: 23  LTAPHGPWA-RLELRAETGSTNADVAEAARSGEPEGLVVIAERQTAGRGRRGRVWQSPPR 81

Query: 65  NLYASLL-----------LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPND 113
              A+ +                       L     VA+   +A       D  +KWPND
Sbjct: 82  AGIATSVLLRPGEAVAERDWPPAPATGYGWLPLLAGVALVEAVARLAE--LDAALKWPND 139

Query: 114 ILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC------- 166
           +L+   K AGIL E +      Q   + +G+ +         P                 
Sbjct: 140 LLIGDAKCAGILAEAVPGPAPDQPPAIVLGIGLNVTLRADELPANPTGLPATSLQLAGAV 199

Query: 167 -IDLKDIFSLLFQDVARVLDLWKKDTGREEI---MNLWRCFACGIGDLITIKLSYG-SIL 221
             D   +   L + VA   D W+   G        + +      +G  + + L  G  + 
Sbjct: 200 ATDRDPLLRALLRSVADWYDRWRHAGGDAVASGLRDAYLAACATVGRPVRVLLPGGAEVT 259

Query: 222 GRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   GVD  G LL++   G  R +  GD+
Sbjct: 260 GVATGVDADGRLLVDTPAGP-RTLAAGDV 287


>gi|317494923|ref|ZP_07953333.1| biotin-[acetyl-CoA-carboxylase] ligase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917111|gb|EFV38460.1| biotin-[acetyl-CoA-carboxylase] ligase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 319

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      + STN   + R           VA  Q AGRGRR   W S    NLY S+   
Sbjct: 80  RVTVLPVVDSTNQYLLDRIHDL-RSGDACVAEYQQAGRGRRGRHWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        DVK+KWPND+ +  +K+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVMAEVLRELG--APDVKVKWPNDLYLNDKKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+     DT        +LQ  G  I+  ++ + L + +   L  ++  
Sbjct: 197 DAANIVIGAGINLSMRSPDTSIVNQQWINLQEAGVQINRNELVARLLKRLRDTLVDFETR 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  WR     I   + + +    I G   G+D  G LLL ++ G ++    G+I
Sbjct: 257 G-LSPFVERWRELDNFIDRPVNLLIGEQKIYGIARGIDAQGALLL-DRDGEIQPFIGGEI 314


>gi|312882959|ref|ZP_07742691.1| biotin--protein ligase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369478|gb|EFP96998.1| biotin--protein ligase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 320

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/241 (24%), Positives = 98/241 (40%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   + R  S +      +A  Q  GRGRR  +W+S    NLY S+   
Sbjct: 79  NVELIPIIDSTNQYLLDRVDSLE-SGSVCLAEYQAKGRGRRGREWVSPFGSNLYLSMFWR 137

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +           +KWPND+    +K+AGIL+E      
Sbjct: 138 LDAGIAAALGLSLVVGVAIVEALEDMGLTSVK--LKWPNDLYYQDKKLAGILVEMSGQAG 195

Query: 134 GLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
               +V+G+GLN+        +  P+       +   ID   +   +   + R LD +++
Sbjct: 196 AAANIVIGMGLNLMMSEATQGITQPWASLFEVAKNQEIDRNQLAITMITTLHRTLDEYER 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      I   +T+ +    I G   G+++ G +LLE + G +     G+
Sbjct: 256 YGMSG-FVEKWNRLDNFINRPVTLLIGSKEITGIARGINEQGAVLLETENG-LESYIGGE 313

Query: 250 I 250
           I
Sbjct: 314 I 314


>gi|331660534|ref|ZP_08361467.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA206]
 gi|315300344|gb|EFU59577.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 16-3]
 gi|331052317|gb|EGI24355.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA206]
          Length = 321

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/250 (26%), Positives = 106/250 (42%), Gaps = 12/250 (4%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           LS+  +           I STN   + R           VA  Q AGRGRR  KW S   
Sbjct: 73  LSQLND---GSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFG 128

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S+         +   LS  I + M  V+         V++KWPND+ +  RK+AG
Sbjct: 129 ANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAG 186

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IL+E          +V+G G+N+               +LQ  G  +D   + ++L +++
Sbjct: 187 ILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIREL 246

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L+L++++      ++ W      I   + + +    I G   G+D  G LLLE+  G
Sbjct: 247 RAALELFEQEG-LTPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DG 304

Query: 241 CVRQIFTGDI 250
            ++    G+I
Sbjct: 305 IIKPWMGGEI 314


>gi|291526249|emb|CBK91836.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Eubacterium
           rectale DSM 17629]
          Length = 326

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 103/240 (42%), Gaps = 8/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             +FDTI STN +  + A  G      +VA  Q +G+GRR   W+S     ++ +L++  
Sbjct: 81  VLYFDTIDSTNIKAQELAEKGYPSGTLVVADKQESGKGRRGRSWVSPSGTGIFMTLMIKP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I+ ++ ++L+   A+A+   I S      +  IKWPNDI+V  +K+ GIL E     + 
Sbjct: 141 DINPNNASMLTLVAALAVAKAITSVTG--EEALIKWPNDIVVNGKKVCGILTEMNAQFDY 198

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +VVGIG+NV +          +                I +       +  D + K 
Sbjct: 199 INHIVVGIGINVHNESFPEEISQMASSLMIEAGGKRFHRAQIIAETMSYFEQYYDTFLKT 258

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                ++  +          + +        G+ +G+   G L+++  +   + + +G++
Sbjct: 259 QDLSALVREYDELLVNRNKSVRVLDPKEPFDGKAMGITPKGELIVDTWE-SRKLVSSGEV 317


>gi|157147231|ref|YP_001454550.1| biotin--protein ligase [Citrobacter koseri ATCC BAA-895]
 gi|157084436|gb|ABV14114.1| hypothetical protein CKO_03018 [Citrobacter koseri ATCC BAA-895]
          Length = 320

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 101/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVTVLPVIDSTNQYLLDRIGQL-TSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRDLG--AEKVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEGVVNQGWINLQEAGITLDRNMLAATLIKELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDAQGALLLEQ-DGVIKPWMGGEI 314


>gi|291526760|emb|CBK92346.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Eubacterium
           rectale M104/1]
          Length = 326

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 103/240 (42%), Gaps = 8/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             +FDTI STN +  + A  G      +VA  Q +G+GRR   W+S     ++ +L++  
Sbjct: 81  VLYFDTIDSTNIKAQELAEKGYPSGTLVVADKQESGKGRRGRSWVSPSGTGIFMTLMIKP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I+ ++ ++L+   A+A+   I S      +  IKWPNDI+V  +K+ GIL E     + 
Sbjct: 141 DINPNNASMLTLVAALAVAKAITSVTG--EEALIKWPNDIVVNGKKVCGILTEMNAQFDY 198

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +VVGIG+NV +          +                I +       +  D + K 
Sbjct: 199 INHIVVGIGINVHNESFPEEISQMASSLMIEAGGKRFHRAQIIAETMSYFEQYYDTFLKT 258

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                ++  +          + +        G+ +G+   G L+++  +   + + +G++
Sbjct: 259 QDLSALVREYDELLVNRNKSVRVLDPKEPFDGKAMGITPKGELIVDTWE-SRKLVSSGEV 317


>gi|153938303|ref|YP_001390471.1| birA bifunctional protein [Clostridium botulinum F str. Langeland]
 gi|152934199|gb|ABS39697.1| birA bifunctional protein [Clostridium botulinum F str. Langeland]
 gi|295318554|gb|ADF98931.1| birA bifunctional protein [Clostridium botulinum F str. 230613]
          Length = 327

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                 FD+I+STND+  K A S +     I++  QT G+GR    W S K   +Y S++
Sbjct: 79  GQNIIHFDSINSTNDKSKKIASS-ENDGTIIISEEQTLGKGRLGRTWFSSKFKGIYMSII 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I+   +  ++   A A+ +   + L       IKWPNDI+V  +K+ GIL E    
Sbjct: 138 LKPDINTMDVPKITQIAAAAVLT---ALLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGE 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +  VVVG+G+NV     D P        +    +        + + +  +   +   
Sbjct: 195 ISKVNYVVVGMGINVNCEEEDIPKDLLSKATSLKIEKDREFKRNILVADILNNFENLYTE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +    +  + + +  +  IG  + I        G+ VG++  G LL++ K G ++ + 
Sbjct: 255 LIECNNIDTSIEICKENSILIGKEVRIINRTRESFGKAVGLNSNGELLVQFKNGEIKPLI 314

Query: 247 TGDI 250
           +G+I
Sbjct: 315 SGEI 318


>gi|297565563|ref|YP_003684535.1| biotin/acetyl-CoA-carboxylase ligase [Meiothermus silvanus DSM
           9946]
 gi|296850012|gb|ADH63027.1| biotin/acetyl-CoA-carboxylase ligase [Meiothermus silvanus DSM
           9946]
          Length = 248

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 110/247 (44%), Gaps = 20/247 (8%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DK 63
           L   + P    Y + +  SST D     A  G      +VA  Q  GRGRR   W S   
Sbjct: 11  LPLLETPLGRTYRYLERTSSTQDVAKAWAEEGAPEGALVVAETQQKGRGRRGRPWQSAPG 70

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            +L  SLLL   I  +   LLSFA  VA+R              +KWPND+L       G
Sbjct: 71  ESLTFSLLLRPQIPSERFPLLSFAAGVALREACG-------VGGLKWPNDLLAPD----G 119

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             +  + L+ G   VV+GIGLNV   P     P  +   E G ++   + +     +  +
Sbjct: 120 RKLAGILLEAGRGYVVLGIGLNVHKAP-----PGAAALAEFGLVERPKVLAGFLNRLGHL 174

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
               +      +I++ WR ++  +G  ++++   GS+ GR + + + G L +E   G +R
Sbjct: 175 YPALE--GQASQILSAWRRYSLTLGREVSLETPQGSLQGRAMDIAEDGSLWVE-VSGTIR 231

Query: 244 QIFTGDI 250
           ++ +GD+
Sbjct: 232 RVTSGDV 238


>gi|333014301|gb|EGK33656.1| bifunctional protein birA [Shigella flexneri K-227]
          Length = 321

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 103/243 (42%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQFLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++LW      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSLWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|71909369|ref|YP_286956.1| biotin--acetyl-CoA-carboxylase ligase [Dechloromonas aromatica RCB]
 gi|71848990|gb|AAZ48486.1| Biotin--acetyl-CoA-carboxylase ligase [Dechloromonas aromatica RCB]
          Length = 267

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 122/243 (50%), Gaps = 11/243 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLL 72
           F  +  D   ST+ E M+RA  G      IVA  Q+AGRGRR   W  S + +L  SLL 
Sbjct: 20  FDVDALDECDSTSSELMRRADRGAPAGTVIVADRQSAGRGRRGRSWLSSPERSLTFSLLW 79

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIET 128
             + +   L+ LS A+ + +   +         V++KWPND+L+       K+AGILIE 
Sbjct: 80  RFAGNASRLSGLSLAVGLGLAKALEKL--GAVGVRLKWPNDVLLQSGSDFAKLAGILIEL 137

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + + G QA++ GIGLN++    D P PV  L++     D  ++ + +   +  VLD++ 
Sbjct: 138 SSDRRGTQAII-GIGLNLETPDSDLPQPVAGLKQCCAQADRHEVLAAILVSLVGVLDIFA 196

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSY-GSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +     + + W  +      L+ +       + GR +GVD  G LLLE  +G V  IF+
Sbjct: 197 AEG-FVGLRDEWLGYHAWQDQLVQVLGDDAEPLPGRCLGVDGDGSLLLETARG-VEHIFS 254

Query: 248 GDI 250
           GD+
Sbjct: 255 GDV 257


>gi|238922484|ref|YP_002935997.1| putative transcriptional repressor of the biotin operon birA
           [Eubacterium rectale ATCC 33656]
 gi|238874156|gb|ACR73863.1| putative transcriptional repressor of the biotin operon birA
           [Eubacterium rectale ATCC 33656]
          Length = 326

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 103/240 (42%), Gaps = 8/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
             +FDTI STN +  + A  G      +VA  Q +G+GRR   W+S     ++ +L++  
Sbjct: 81  VLYFDTIDSTNIKAQELAEKGYPSGTLVVADKQESGKGRRGRSWVSPSGTGIFMTLMIKP 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I+ ++ ++L+   A+A+   I S      +  IKWPNDI+V  +K+ GIL E     + 
Sbjct: 141 DINPNNASMLTLVAALAVAKAITSVTG--EEALIKWPNDIVVNGKKVCGILTEMNAQFDY 198

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKD 190
           +  +VVGIG+NV +          +                I +       +  D + K 
Sbjct: 199 INHIVVGIGINVHNESFPEEISQMASSLMIEAGGKRFHRAQIIAETMSYFEQYYDTFLKT 258

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                ++  +          + +        G+ +G+   G L+++  +   + + +G++
Sbjct: 259 QDLSALVREYDELLVNRNKSVRVLDPKEPFDGKAMGITPKGELIVDTWE-SRKLVSSGEV 317


>gi|323933948|gb|EGB30423.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli E1520]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           +A  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSI 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|301063845|ref|ZP_07204329.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
 gi|300442048|gb|EFK06329.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
          Length = 284

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 109/249 (43%), Gaps = 9/249 (3%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALS-GDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
            + +     F + + STN    K A   G      ++A  QT G GR   +W S K  NL
Sbjct: 28  NSMFGKNIIFEERLGSTNVFLKKIAQEEGAAEGTVVIADEQTDGLGRMGRRWFSKKGENL 87

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
             S+LL  +++ D++ +L+   A+A    +        D  IKWPNDI + Q+K+ G+L 
Sbjct: 88  LFSVLLRPTLAPDNVFILTMIFALAGTDALKEVSG--LDAGIKWPNDIYLGQKKLGGVLT 145

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC----IDLKDIFSLLFQDVAR 182
           E   L   +Q +V+G+GLNV   P +                  +  +++   L   +A 
Sbjct: 146 EFSVLGESVQYLVLGMGLNVNWKPKEGETTGYMTSSVFSESGKRVSREELLVFLLGRLAV 205

Query: 183 VLDLWKKDTGREEIM-NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
                 +D   +E++   W   +  +G  + I+     I+G    +D  G L +   +G 
Sbjct: 206 YYQGCMEDGKEKELLYKRWNKKSVVLGRPVVIETGKERIIGNAAEIDQDGALWVVTSEGE 265

Query: 242 VRQIFTGDI 250
            ++I  GD+
Sbjct: 266 EKRILCGDV 274


>gi|330507534|ref|YP_004383962.1| bifunctional protein birA [Methanosaeta concilii GP-6]
 gi|328928342|gb|AEB68144.1| Bifunctional protein birA [Methanosaeta concilii GP-6]
          Length = 289

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 107/238 (44%), Gaps = 5/238 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                 F  ++STN+  +  A  G+     I+A  QT GRGR    W S  G ++ SL+L
Sbjct: 48  GRDMRLFAQLASTNELAISLAQKGE-SGTVILAEVQTRGRGRLSRHWESPSGGIWMSLIL 106

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       ++ AI VA+   I++ L    +  IKWPND+L+ +RK+ GIL+E     
Sbjct: 107 RPDIPIALAYQINMAICVAVCRAISNLLG--LNPGIKWPNDLLIGERKVGGILMEVQAEG 164

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             L+  VVG+G+N    P   P    +              +L+ + +  +   ++    
Sbjct: 165 ERLEYAVVGVGINANIDPSAFPDDWMATSLSREGGSEVSRTALIQRTLLEIERAYENLG- 223

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             EI + WR  +  IG ++ I  + G ++G    + + G LLL      + ++  GD 
Sbjct: 224 SMEIYDEWRRRSVTIGRMVRISANSGELVGEVEDLAEDGALLLRRDD-ELVRVLAGDC 280


>gi|254463933|ref|ZP_05077344.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           Y4I]
 gi|206684841|gb|EDZ45323.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           Y4I]
          Length = 248

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 111/248 (44%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + ST +E  + A     G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 3   WPAGYGKRVLAEVDSTLNEAARIAGELA-GPEWILALRQTQGRGRRGRDWKDPKGNFAAT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++    + D   L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+ 
Sbjct: 62  LVMRPDGAPDQAALRSFVAALAVYDACVAVTGRSEGLSLKWPNDVLLKGGKLAGILLESA 121

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + VGIG+N+   P+         YPV+ L   G  +  ++    +    AR 
Sbjct: 122 GNGQGVNHLFVGIGVNLVETPMQEWLEPGAVYPVSLLSETGVQVTPEEFLVAVAGAFARY 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +      E I   W   A  +G++IT + +     G F  VD  G L+L   KG V 
Sbjct: 182 EQQFATYG-FEPIRTEWLARAAKLGEVITARTANSETEGTFETVDASGNLVLNTAKGRV- 239

Query: 244 QIFTGDIF 251
            I   DI+
Sbjct: 240 SIPAADIY 247


>gi|294495300|ref|YP_003541793.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalophilus mahii DSM
           5219]
 gi|292666299|gb|ADE36148.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalophilus mahii DSM
           5219]
          Length = 322

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 103/240 (42%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                 F  + STND     A         +VA  Q  GRGRR   W+S  G ++ S++L
Sbjct: 82  GKDIRHFMELESTNDYAKTIAKD-TTEGTVVVAEVQKKGRGRRGFDWVSPHGGVWISIVL 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             SI     + L+    +A+   + S    G    +KWPND+LV  +KI GIL E     
Sbjct: 141 KPSIVSADASRLTLVGGLAVVDSLKSI---GLTPSLKWPNDVLVNGKKICGILTEMEAEI 197

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           + ++ +V+G+G+N+       P +     T++  E G    +  F            +  
Sbjct: 198 DRVEYIVLGMGINLNFNTEMLPEEIRDGSTTISDELGTYVDRLEFVRSLLYNLEQYYVHF 257

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K    EE+M  W   +  IG  + I      + GR +G+   G LLL++  G   +I +G
Sbjct: 258 KTQPFEELMERWIDSSDTIGRKVRIVTPSKMVDGRAIGISPSGGLLLQKNNGSTEEILSG 317


>gi|222479889|ref|YP_002566126.1| biotin/acetyl-CoA-carboxylase ligase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222452791|gb|ACM57056.1| biotin/acetyl-CoA-carboxylase ligase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 329

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 72/256 (28%), Positives = 109/256 (42%), Gaps = 25/256 (9%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +  E++D +SSTND   + A  G    + +VA  QT  RGR D +W++  G ++ SL++
Sbjct: 73  PYAVEYYDRLSSTNDRARELAGDGA-DGVAVVADEQTGSRGRLDREWVAPSGGVWLSLVI 131

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ-------------- 118
                     L + A AVA+          G +  IKWPND+LV                
Sbjct: 132 RPDAPPARAPLFTLAAAVAIVDACREA---GVNAHIKWPNDVLVGGLGDETDTDTDADSE 188

Query: 119 ----RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS 174
               RK+AGIL E     + +  ++ GIG+N        P   TSLQ   G    +  F+
Sbjct: 189 GRGGRKVAGILTEMEGEADRVSWLIPGIGVNANVDSDLLPADATSLQEVLGEPIDRRRFA 248

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
               +    L         + I+  WR  A  IG  + +  S G + G  V V+  G L+
Sbjct: 249 ATLLERFAALAG--TPDRMDRILPAWRERASTIGRRVRVDTSNGPVTGTAVDVEPPGALV 306

Query: 235 LEEKKGCVRQIFTGDI 250
           +E   G  R++  GD 
Sbjct: 307 IETNDGT-RRVHAGDC 321


>gi|325271339|ref|ZP_08137868.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas sp. TJI-51]
 gi|324103525|gb|EGC00843.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas sp. TJI-51]
          Length = 319

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 105/239 (43%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     DTI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L
Sbjct: 76  WPVFIHDTIDSTNAEGLRMAGEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   +        DV +KWPND+LV   KI GIL+E +   
Sbjct: 136 RVDGGMRQLEGLSLVVGLAVMRTLQGF--GVKDVGLKWPNDVLVRGMKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+G+G+NV     +       +  +  GG ID   + + L Q +   L   ++ 
Sbjct: 194 ADVCHVVLGVGINVNMQANEQVDQQWTSMRRELGGAIDRNHLVASLTQHLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      + G  +GVD  G L LE   G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRSVSLIAGNTRVDGVVLGVDGQGGLRLE-VDGVEKSFSGGE 310


>gi|312963382|ref|ZP_07777865.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas fluorescens WH6]
 gi|311282462|gb|EFQ61060.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas fluorescens WH6]
          Length = 319

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 72/240 (30%), Positives = 112/240 (46%), Gaps = 7/240 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           ++    +D+I STN E ++   +       ++A  Q AGRGRR  KWIS    N+Y SL+
Sbjct: 75  AWPIHIYDSIDSTNAEALRLVNATCATPFLVLAEQQVAGRGRRGRKWISPFAQNIYYSLV 134

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L        L  LS  + +A+   +  +   G    +KWPND+LV Q+KIAGIL+E +  
Sbjct: 135 LRIQDGLRQLEGLSLVVGLAVIQALRESGVQG--AVLKWPNDVLVGQKKIAGILLELVGD 192

Query: 132 KNGLQAVVVGIGLNVKHC-PVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK 189
              +  VV+GIG+NV      +     TS+Q E G  +D   + +L+   + R LD  K 
Sbjct: 193 PADICHVVIGIGINVNMQRADEVDQQWTSMQLETGVAVDRNTLVALVGLQLQRYLDRHKA 252

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 +   W       G  +++      + G  +GVD  G L L +  G  +    G+
Sbjct: 253 SG-FAALQEEWEQNHGWQGRSVSLIAGVNRVDGVVLGVDQQGALRL-DVDGVEKAYSGGE 310


>gi|26250746|ref|NP_756786.1| biotin--protein ligase [Escherichia coli CFT073]
 gi|91212781|ref|YP_542767.1| biotin--protein ligase [Escherichia coli UTI89]
 gi|117626242|ref|YP_859565.1| biotin--protein ligase [Escherichia coli APEC O1]
 gi|218561044|ref|YP_002393957.1| biotin--protein ligase [Escherichia coli S88]
 gi|218692259|ref|YP_002400471.1| biotin--protein ligase [Escherichia coli ED1a]
 gi|227885496|ref|ZP_04003301.1| biotin--protein ligase [Escherichia coli 83972]
 gi|237702743|ref|ZP_04533224.1| biotin-protein ligase [Escherichia sp. 3_2_53FAA]
 gi|300990628|ref|ZP_07179258.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 45-1]
 gi|301047588|ref|ZP_07194658.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 185-1]
 gi|306811993|ref|ZP_07446201.1| biotin--protein ligase [Escherichia coli NC101]
 gi|26111177|gb|AAN83360.1|AE016770_160 BirA bifunctional protein [Escherichia coli CFT073]
 gi|91074355|gb|ABE09236.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Escherichia coli UTI89]
 gi|115515366|gb|ABJ03441.1| BirA bifunctional protein [Escherichia coli APEC O1]
 gi|218367813|emb|CAR05607.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli S88]
 gi|218429823|emb|CAR10649.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli ED1a]
 gi|222035689|emb|CAP78434.1| bifunctional protein birA [Escherichia coli LF82]
 gi|226903056|gb|EEH89315.1| biotin-protein ligase [Escherichia sp. 3_2_53FAA]
 gi|227837534|gb|EEJ48000.1| biotin--protein ligase [Escherichia coli 83972]
 gi|294493273|gb|ADE92029.1| bifunctional protein BirA [Escherichia coli IHE3034]
 gi|300300523|gb|EFJ56908.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 185-1]
 gi|300407102|gb|EFJ90640.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 45-1]
 gi|305854598|gb|EFM55034.1| biotin--protein ligase [Escherichia coli NC101]
 gi|307556121|gb|ADN48896.1| BirA bifunctional protein [Escherichia coli ABU 83972]
 gi|307628376|gb|ADN72680.1| biotin--protein ligase [Escherichia coli UM146]
 gi|312948552|gb|ADR29379.1| biotin--protein ligase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315285968|gb|EFU45406.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 110-3]
 gi|315292315|gb|EFU51667.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 153-1]
 gi|323948820|gb|EGB44718.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H252]
 gi|323953779|gb|EGB49587.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H263]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LTPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|297519249|ref|ZP_06937635.1| biotin--protein ligase [Escherichia coli OP50]
          Length = 301

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 57  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 115

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 116 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 173

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 174 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 233

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 234 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 291

Query: 248 GDI 250
           G+I
Sbjct: 292 GEI 294


>gi|315499804|ref|YP_004088607.1| biotin/acetyl-CoA-carboxylase ligase [Asticcacaulis excentricus CB
           48]
 gi|315417816|gb|ADU14456.1| biotin/acetyl-CoA-carboxylase ligase [Asticcacaulis excentricus CB
           48]
          Length = 242

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 76/236 (32%), Positives = 113/236 (47%), Gaps = 3/236 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
            + FD++ ST  E + R  +GD G  W+ A  QTAG+GR   +W    GNL AS   +  
Sbjct: 4   IDVFDSLPSTQTEALSRLRAGDRGPRWVRAQRQTAGQGRMGRQWDGPSGNLMASWYGVLP 63

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +T LSF  A+A+   I   L     +KIKWPND+L   RK+ GIL ++  L+ GL
Sbjct: 64  VEMRRVTQLSFVAALAVTDAIRPVLSAPDPLKIKWPNDVLYEGRKLCGILAQSETLETGL 123

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             VV+GIG+N+   P    Y   +L         ++ +   L   + R LD W      E
Sbjct: 124 -GVVIGIGINIAKAPQGLSYGTAALNDLTAQPQTVEVVLDALDAALTRRLDDWLTHG-FE 181

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                W   A G   L  I+    +  G  +G+DD+G L + +  G +  I +G +
Sbjct: 182 ATAAQWWDQAYGRDQLCLIEQHSQARTGTILGLDDYGALRVRDPDGTIHVIASGSV 237


>gi|88604407|ref|YP_504585.1| biotin--acetyl-CoA-carboxylase ligase [Methanospirillum hungatei
           JF-1]
 gi|88189869|gb|ABD42866.1| Biotin--acetyl-CoA-carboxylase ligase [Methanospirillum hungatei
           JF-1]
          Length = 326

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 110/246 (44%), Gaps = 11/246 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSG---DLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
             +  FF++I ST       A  G   ++  + I+A  QT G GR    W+S  G ++ +
Sbjct: 81  GRKMRFFESIPSTIWYGKDLAEQGGIDEMNGMVIIAEEQTGGIGRMGRAWVSPAGGIWVT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++L   I  + L +L+ A +V++  V+           IKWPNDI++  +K+AGIL+E  
Sbjct: 141 IILQPQIPIEQLFMLTLAASVSVARVLRK--MYDIGALIKWPNDIIIGDKKVAGILLELG 198

Query: 130 NLKNGLQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
             +  ++  +VGIG++                 +  Q     +D   + + + ++     
Sbjct: 199 AEERKVEYCLVGIGIDANVNLESLNQTIRSTMTSISQEVNQNVDRAVLLAAILKEFENRY 258

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           ++       + ++  W+ F+  IG  + I        G  + +D  G L++++  G + +
Sbjct: 259 EM-ISQGEFDAVIREWKNFSSTIGRRVRIVTLRTHFEGEAIDIDPNGALVVKKDNGKIER 317

Query: 245 IFTGDI 250
           +  GD 
Sbjct: 318 VIAGDC 323


>gi|323963772|gb|EGB59272.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli M863]
 gi|327250447|gb|EGE62157.1| bifunctional protein birA [Escherichia coli STEC_7v]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEENIVNQGWITLQEAGINLDRNALAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|325499289|gb|EGC97148.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia fergusonii
           ECD227]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNALAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|147669411|ref|YP_001214229.1| biotin--acetyl-CoA-carboxylase ligase [Dehalococcoides sp. BAV1]
 gi|146270359|gb|ABQ17351.1| biotin--acetyl-CoA-carboxylase ligase [Dehalococcoides sp. BAV1]
          Length = 262

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 97/254 (38%), Gaps = 12/254 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + +NL  C         +    +ST    M+ A  G      I+   QT G GR    W+
Sbjct: 11  IQNNLRTCFM--GREIIYLPETASTQIVAMEMARKGAGDGTVIITERQTDGHGRLKRLWV 68

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S +GN+Y S +    +      +    +A ++    A     G   ++KWPNDIL+  +K
Sbjct: 69  SPQGNIYMSFI----LRPSQTEISRLIMAASLAISFAIQDTTGIMTELKWPNDILINGKK 124

Query: 121 IAGILIETLNLKNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           + G+L+E       +   VVG+G+N    ++  P       + +   G  +  + +    
Sbjct: 125 VCGMLVENDIRDGQVNFSVVGLGINVNADMQDYPELKDIATSLINHTGKPVSREKLILSF 184

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  R+      +   + +  +W+     +G  + +        G    V   G L + 
Sbjct: 185 LHEFERLY--LDLNEHGKCVFEMWKKRLITLGKEVDVTSGKDIYSGIVETVASDGSLKIR 242

Query: 237 EKKGCVRQIFTGDI 250
              G +  I  GD+
Sbjct: 243 LADGNLVHIVAGDV 256


>gi|110644313|ref|YP_672043.1| biotin--protein ligase [Escherichia coli 536]
 gi|191172692|ref|ZP_03034230.1| bifunctional protein BirA [Escherichia coli F11]
 gi|300937971|ref|ZP_07152754.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 21-1]
 gi|300994519|ref|ZP_07180935.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 200-1]
 gi|110345905|gb|ABG72142.1| BirA [Escherichia coli 536]
 gi|190906996|gb|EDV66597.1| bifunctional protein BirA [Escherichia coli F11]
 gi|300304918|gb|EFJ59438.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 200-1]
 gi|300457030|gb|EFK20523.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 21-1]
 gi|320197128|gb|EFW71746.1| biotin--protein ligase [Escherichia coli WV_060327]
 gi|323190165|gb|EFZ75443.1| bifunctional protein birA [Escherichia coli RN587/1]
 gi|324015423|gb|EGB84642.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 60-1]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|330908294|gb|EGH36813.1| biotin-protein ligase / Biotin operon repressor [Escherichia coli
           AA86]
          Length = 321

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+    V+         +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEDSVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LTPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|73748653|ref|YP_307892.1| biotin-acetyl-CoA-carboxylase ligase [Dehalococcoides sp. CBDB1]
 gi|73660369|emb|CAI82976.1| biotin-acetyl-CoA-carboxylase ligase [Dehalococcoides sp. CBDB1]
          Length = 266

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 97/254 (38%), Gaps = 12/254 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + +NL  C         +    +ST    M+ A  G      I+   QT G GR    W+
Sbjct: 15  IQNNLRTCFM--GREIIYLPETASTQIVAMEMARKGAGDGTVIITERQTDGHGRLKRLWV 72

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S +GN+Y S +    +      +    +A ++    A     G   ++KWPNDIL+  +K
Sbjct: 73  SPQGNIYMSFI----LRPSQTEISRLIMAASLAISFAIQDTTGIMTELKWPNDILINGKK 128

Query: 121 IAGILIETLNLKNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           + G+L+E       +   VVG+G+N    ++  P       + +   G  +  + +    
Sbjct: 129 VCGMLVENDIRDGQVNFSVVGLGINVNADMQDYPELKDIATSLINHTGKPVSREKLILSF 188

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  R+      +   + +  +W+     +G  + +        G    V   G L + 
Sbjct: 189 LHEFERLY--LDLNEHGKCVFEMWKKRLITLGKEVDVTSGKDIYSGIVETVASDGSLKIR 246

Query: 237 EKKGCVRQIFTGDI 250
              G +  I  GD+
Sbjct: 247 LADGNLVHIVAGDV 260


>gi|289432678|ref|YP_003462551.1| biotin/acetyl-CoA-carboxylase ligase [Dehalococcoides sp. GT]
 gi|288946398|gb|ADC74095.1| biotin/acetyl-CoA-carboxylase ligase [Dehalococcoides sp. GT]
          Length = 262

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 97/254 (38%), Gaps = 12/254 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + +NL  C         +    +ST    M+ A  G      I+   QT G GR    W+
Sbjct: 11  IQNNLRTCFM--GREIIYLPETASTQIVAMEMARKGAGDGTVIITERQTDGHGRLKRLWV 68

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S +GN+Y S +    +      +    +A ++    A     G   ++KWPNDIL+  +K
Sbjct: 69  SPQGNIYMSFI----LRPSQTEISRLIMAASLAISFAIQDTTGIMTELKWPNDILINGKK 124

Query: 121 IAGILIETLNLKNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           + G+L+E       +   VVG+G+N    ++  P       + +   G  +  + +    
Sbjct: 125 VCGMLVENDIRDGQVNFSVVGLGINVNADMQDYPELKDIATSLINHTGKPVSREKLILSF 184

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  R+      +   + +  +W+     +G  + +        G    V   G L + 
Sbjct: 185 LHEFERLY--LDLNEHGKCVFEMWKKRLITLGKKVDVTSGKDIYSGIVETVASDGSLKIR 242

Query: 237 EKKGCVRQIFTGDI 250
              G +  I  GD+
Sbjct: 243 LADGNLVHIVAGDV 256


>gi|300087947|ref|YP_003758469.1| biotin/acetyl-CoA-carboxylase ligase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527680|gb|ADJ26148.1| biotin/acetyl-CoA-carboxylase ligase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 255

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 107/243 (44%), Gaps = 5/243 (2%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
            + +S    F+ ++ ST D   + A  G      +VA+ Q AGRGR    W+S +G++  
Sbjct: 13  GSTWSTHTHFYPSVDSTMDIARQMAKGGCTEGTNVVAARQHAGRGRLSRVWLSPEGSVSM 72

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S++L   +  + L+ L     VA+   + S         +KWPNDI++   K+ GIL+E+
Sbjct: 73  SVVLFPEL--NRLSHLVMIAGVAVVEALESFTG--VSPALKWPNDIIIRGLKLGGILVES 128

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             +     AV+ GIGLNV     D P                   + + + + R L+ + 
Sbjct: 129 GTVSERRYAVI-GIGLNVNVTIGDYPEIAGIATSLFDITGKNFRETEVSRSIVRSLEHYY 187

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +     EI   WR     I   +T++     I G    V+  G L++    G   Q+F G
Sbjct: 188 RGIDNSEIFQRWRSRLDTIDRRVTVETGGNHIEGIARDVNPDGSLIIRSDDGIDHQVFAG 247

Query: 249 DIF 251
           DI+
Sbjct: 248 DIW 250


>gi|330966927|gb|EGH67187.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 71/245 (28%), Positives = 107/245 (43%), Gaps = 5/245 (2%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GN 65
           E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S    N
Sbjct: 69  ESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFAEN 128

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL
Sbjct: 129 LYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQG--AGLKWPNDVLVGRQKIAGIL 186

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVL 184
           +E +     +  V++GIG+NV             S++ + G    ++  +         L
Sbjct: 187 LELIGDPADVCHVIIGIGVNVNMRASTEVDQLWASVRLQTGAPADRNTIAARISAQLEAL 246

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
               +  G       W       G  + +     ++ G  +GVD  G L LE   G  + 
Sbjct: 247 LAVHRQEGFSAFQKEWERGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE-VSGLEKS 305

Query: 245 IFTGD 249
              G+
Sbjct: 306 FSGGE 310


>gi|288556124|ref|YP_003428059.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus pseudofirmus OF4]
 gi|288547284|gb|ADC51167.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus pseudofirmus OF4]
          Length = 329

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 101/247 (40%), Gaps = 11/247 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLL 71
                +FD   ST     K A  G      +VA+ QT G+GR    W S    ++  S++
Sbjct: 79  GRELTYFDATESTQQIAHKLAQDGAEEGHVVVANEQTKGKGRLGRVWHSRSNTSISMSMI 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       L+   AVA+   I      G   +IKWPNDIL+  +K+ GIL E    
Sbjct: 139 LRPPLPPQKTPQLTLLAAVAVVQAIKK--NTGLQCEIKWPNDILLKGKKLVGILTEMQAD 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE--------GGCIDLKDIFSLLFQDVARV 183
            + + +V++GIGLNV     D    +  L            G    +             
Sbjct: 197 PDLVHSVIIGIGLNVNQTSEDFGEDIAHLATSLHLEKDGASGEPVDRARLIADILLEFEE 256

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L     + G + I  LW  ++  +G  I  ++    I G   G+ D G LL+E++ G   
Sbjct: 257 LYEEYLENGFQSIRPLWESYSISVGTYIYARMIKDVIYGYAKGITDDGVLLVEDESGKTH 316

Query: 244 QIFTGDI 250
            I++ DI
Sbjct: 317 HIYSADI 323


>gi|238752779|ref|ZP_04614247.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia rohdei ATCC
           43380]
 gi|238708977|gb|EEQ01227.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia rohdei ATCC
           43380]
          Length = 292

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 97/245 (39%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P          I STN   + R           VA  Q AGRGRR  +WIS    NLY 
Sbjct: 49  LPEG-NVRVLPVIDSTNQYLLDRISELQ-SGDACVAEYQHAGRGRRGRQWISPFGSNLYL 106

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V++KWPND+ +  +K+AGIL+E 
Sbjct: 107 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLG--AEQVRVKWPNDLYLNDKKLAGILVEL 164

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T                ID   + + L  ++   + 
Sbjct: 165 TGKTGDAAQLVIGAGINLTMRESTTNVINQDWINLQEAGVIIDRNKLTAALLSELRLAVV 224

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G V+  
Sbjct: 225 KFENEG-LAAFISRWREIDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-DGIVKPY 282

Query: 246 FTGDI 250
             G+I
Sbjct: 283 IGGEI 287


>gi|55376943|ref|YP_134793.1| biotin-(acetyl-CoA carboxylase) ligase [Haloarcula marismortui ATCC
           43049]
 gi|55229668|gb|AAV45087.1| biotin-(acetyl-CoA carboxylase) ligase [Haloarcula marismortui ATCC
           43049]
          Length = 315

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 103/245 (42%), Gaps = 18/245 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            F  E+ D+I STN      A  G+     ++A  QT GRGR D  W S  G ++ S+L 
Sbjct: 74  PFSVEYHDSIPSTNARARDLAAEGESD-TVVLADEQTGGRGRLDRDWHSPSGGIWLSVLF 132

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGILIET 128
              +      + + A AVA+          G +  IKWPND+LV      RK+ GIL E 
Sbjct: 133 RPDVPMAHAPVFTLAAAVAVTRAAREA---GVEAGIKWPNDVLVRHGDEERKLVGILTEM 189

Query: 129 LNLKNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
               + +  VVVGIG+N    P    D   P +     G  +D +     L ++   +  
Sbjct: 190 EGEADRVSWVVVGIGVNANVDPADLPDEANPTSLSTERGEPLDRRLFTQRLLEEFDAL-- 247

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                     ++  WR +A  +G  + ++   G I G  V +   G L++E   G    +
Sbjct: 248 ----RQDTGRVVEAWREYATTLGKRVRVETPGGPIEGEAVDIQFPGALVIETASGT-EVV 302

Query: 246 FTGDI 250
             GD 
Sbjct: 303 SAGDC 307


>gi|332159902|ref|YP_004296479.1| biotin--protein ligase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325664132|gb|ADZ40776.1| biotin--protein ligase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330863579|emb|CBX73691.1| bifunctional protein birA [Yersinia enterocolitica W22703]
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 76  LPAG-QVAVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V  KWPND+ +  +K+AGIL+E 
Sbjct: 134 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLGAEHVRV--KWPNDLYLNDKKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T          Q  G  ID   + + L  ++   + 
Sbjct: 192 TGKTGDAAQLVIGAGINLTMRESTTNVISQDWINLQEAGVNIDRNKLTAELLSELRLAVV 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE K G ++  
Sbjct: 252 KFENEG-LSAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLE-KDGNIKPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|218702608|ref|YP_002410237.1| biotin--protein ligase [Escherichia coli IAI39]
 gi|218372594|emb|CAR20468.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli IAI39]
          Length = 321

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|85058103|ref|YP_453805.1| biotin--protein ligase [Sodalis glossinidius str. 'morsitans']
 gi|84778623|dbj|BAE73400.1| bifunctional protein biotin operon repressor and biotin-acetyl-CoA
           carboxylase synthase [Sodalis glossinidius str.
           'morsitans']
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 101/252 (40%), Gaps = 10/252 (3%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
            ++   + P   R      I STN   ++R           VA  Q  GRGRR  +WIS 
Sbjct: 69  ESVIRARLPAG-RLAVLPVIDSTNQYLIERIGIAQP-GDACVAEYQAQGRGRRGRQWISP 126

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL         +   LS  + + M  V+      G  V  KWPND+ +   K+
Sbjct: 127 FGNNLYLSLYWRLEQGPSAAGGLSLMVGIVMAEVLQRLGAEGVRV--KWPNDLYLNDCKL 184

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           AGIL+E          VV+G G+N+               +LQ  G  ID   + + L  
Sbjct: 185 AGILVEISGKAGDAAHVVIGAGINLAMREGAAGKIDQGWINLQEAGIAIDRNALAAELTD 244

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
            + + L  +++D      +  W+         + + +    I G   G+D  G LLL ++
Sbjct: 245 TLRQALWQFERDG-FAPFVARWQALDNFFDRPVKLLIGEREIKGIARGIDAQGALLL-DQ 302

Query: 239 KGCVRQIFTGDI 250
           +G +     G+I
Sbjct: 303 EGKLHAYLGGEI 314


>gi|297584393|ref|YP_003700173.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus selenitireducens
           MLS10]
 gi|297142850|gb|ADH99607.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus selenitireducens
           MLS10]
          Length = 326

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 6/247 (2%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-N 65
           +  N Y       D  +ST D+ +K    G       V+  Q+AGRGR    W S +   
Sbjct: 75  QKGNSYFKSIHKVDETTSTQDDALKLIQEGAESGTVTVSDMQSAGRGRLGRSWDSPRKGG 134

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           L+ S++L   I       L+    VA+   + + L       IKWPND+L+  +KIAGIL
Sbjct: 135 LWFSMILKPDIPVHKAPQLTLLTGVALAQTVNNQLHGQV-AAIKWPNDLLINHKKIAGIL 193

Query: 126 IETLNLKNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVAR 182
            E     + ++A+++G+GLNV     P        SL R  G   +L +I S        
Sbjct: 194 TEMHADPDKVKALIIGVGLNVNQEMFPDWLLDIADSLGRMTGARYNLNEILSDFLIRFDE 253

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           +  L+ K+     I NLW+  A   G  +  K + G I G    +D+ G + +++ +G +
Sbjct: 254 LYHLFIKEGFL-PIRNLWKELALSPGQTVHYKHNKGVINGTTHDIDEEGVMQIKDDQGTI 312

Query: 243 RQIFTGD 249
            ++F+ +
Sbjct: 313 HRVFSSE 319


>gi|331675464|ref|ZP_08376213.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA280]
 gi|331067342|gb|EGI38748.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA280]
          Length = 320

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|238918134|ref|YP_002931648.1| biotin--protein ligase [Edwardsiella ictaluri 93-146]
 gi|238867702|gb|ACR67413.1| biotin-[acetyl-CoA-carboxylase] ligase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 99/247 (40%), Gaps = 10/247 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
              P   R      + STN   ++R           VA  Q AGRGRR   W S    NL
Sbjct: 74  ALLPQG-RVTVLPVVDSTNQYLLERIGELA-SGDACVAEYQQAGRGRRGRHWFSPFGANL 131

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           Y S+         +   LS  I + M  V+ +    G  V  KWPND+ +  RK+AGIL+
Sbjct: 132 YLSMYWRLEQGPAAAMGLSLVIGIVMAEVLQALGAAGVKV--KWPNDLYLNDRKLAGILV 189

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           E          +VVG G+N+     DT        +LQ  G  ID   + + L   +   
Sbjct: 190 ELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQWINLQEAGVNIDRNQLVACLLSRLRST 249

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L  ++        ++ WR     +   + + +    I G   G+D  G LLLE + G + 
Sbjct: 250 LADFEVRG-LSPFISRWRVLDNFVDRPVRLIIGEQVIHGIARGIDAQGALLLE-RDGVIT 307

Query: 244 QIFTGDI 250
               G+I
Sbjct: 308 PFIGGEI 314


>gi|318607549|emb|CBY29047.1| biotin-protein ligase; Biotin operon repressor [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +      + STN   + R           VA  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  QVAVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + + M  V+         V  KWPND+ +  +K+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVVGIVMAEVLHKLGAEHVRV--KWPNDLYLNDKKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+      T          Q  G  ID   + + L  ++   +  ++ +
Sbjct: 197 DAAQLVIGAGINLTMRESTTNVISQDWINLQEAGVNIDRNKLTAELLSELRLAVVKFENE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ WR     +   + + +    I G   G+D  G LLLE K G ++    G+I
Sbjct: 257 G-LSAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLE-KDGNIKPYIGGEI 314


>gi|315128074|ref|YP_004070077.1| biotin--protein ligase [Pseudoalteromonas sp. SM9913]
 gi|315016587|gb|ADT69925.1| biotin--protein ligase [Pseudoalteromonas sp. SM9913]
          Length = 330

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 106/242 (43%), Gaps = 10/242 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDL--GNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             E    I STN E M+R  +         IVA  Q AGRGRR   W S    NLY S  
Sbjct: 86  NIEVQPLIDSTNSELMRRIQAKTPLQSGKVIVAEMQQAGRGRRGRVWQSPFGANLYYSYF 145

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                   +   +S A+ +A+   I +      DV++KWPNDI + ++K+AG+L+E    
Sbjct: 146 WRLDDGLQAAMGVSIAVGLAVYDAIKALYG--IDVELKWPNDIYINKQKLAGVLVELDGQ 203

Query: 132 KNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             G   +V+GIG+N+              T L +    +D   + + L   + + L  ++
Sbjct: 204 PQGPCQLVIGIGINLNMPKSASQHIDQAWTDLSQHTQQLDKNQLVASLTYWLEQRLAQYR 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++   + +   W       G+ + +   + S  G   G+D  G + + +  G V+  + G
Sbjct: 264 ENG-LQTMYQQWNALNAFAGEQVELNTGHRSWRGICEGIDAHGGVRIRQ-DGEVKSYYGG 321

Query: 249 DI 250
           +I
Sbjct: 322 EI 323


>gi|77361815|ref|YP_341390.1| biotin--protein ligase [Pseudoalteromonas haloplanktis TAC125]
 gi|76876726|emb|CAI87948.1| biotin-[protein] holoenzyme synthetase; possibly (by homology)
           transcriptional repressor of biotin synthesis (BirA
           family) [Pseudoalteromonas haloplanktis TAC125]
          Length = 330

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 106/242 (43%), Gaps = 10/242 (4%)

Query: 15  RYEFFDTISSTNDECMKR--ALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           + E    I STN E M+R  A +       IVA  Q  GRGRR   W S    NLY S  
Sbjct: 86  KVEVHPIIDSTNSELMRRIQAKTELESGTVIVAEMQQLGRGRRGRVWQSPFGANLYYSYF 145

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                   +   +S  + +A+   I +      +V++KWPNDI + ++K+AG+L+E    
Sbjct: 146 WRLDDGIQAAMGVSIVVGLAVYDAIKAL--YNIEVELKWPNDIYLNKQKLAGVLVELDAQ 203

Query: 132 KNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             G   +V+GIG+N++             T L +    ++   + + L   + + L+ + 
Sbjct: 204 PQGPCQLVIGIGINLQMPESFSQHIDQAWTDLSQHTQQLNKNQLVASLTYYLEQRLEQYS 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +    + +   W       G+ + +   + S  G   G+D  G + + +  G V+  + G
Sbjct: 264 ESG-LQSMHQQWNALNAFAGECVELNTGHRSWRGICEGIDPQGGIRIRQ-DGEVKSYYGG 321

Query: 249 DI 250
           +I
Sbjct: 322 EI 323


>gi|215489310|ref|YP_002331741.1| biotin--protein ligase [Escherichia coli O127:H6 str. E2348/69]
 gi|312965370|ref|ZP_07779603.1| bifunctional protein birA [Escherichia coli 2362-75]
 gi|215267382|emb|CAS11833.1| bifunctional protein BirA biotin-[acetylCoA carboxylase] holoenzyme
           synthetase and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312290044|gb|EFR17931.1| bifunctional protein birA [Escherichia coli 2362-75]
          Length = 321

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDRQGALLLEQ-DGIIKPWMGGEI 314


>gi|123440665|ref|YP_001004658.1| biotin--protein ligase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087626|emb|CAL10408.1| bifunctional protein BirA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 319

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 76  LPAG-QVAVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V  KWPND+ +  +K+AGIL+E 
Sbjct: 134 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLGAEHVRV--KWPNDLYLNDKKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T          Q  G  ID   + + L  ++   + 
Sbjct: 192 TGKTGDAAQLVIGAGINLTMRESTTNVISQDWINLQEAGVNIDRNKLTAELLSELRLAVV 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G ++  
Sbjct: 252 KFENEG-LPAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-DGNIKPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|238794970|ref|ZP_04638567.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia intermedia
           ATCC 29909]
 gi|238725728|gb|EEQ17285.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia intermedia
           ATCC 29909]
          Length = 295

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 52  LPAG-QVTVLPVVDSTNQYLLDRITELK-SGDACVAEYQHAGRGRRGRQWVSPFGTNLYL 109

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V++KWPND+ +  +K+AGIL+E 
Sbjct: 110 SMFWRLEQGPAAAMGLSLVVGIVMAEVLRKLG--AEQVRVKWPNDLYLNDKKLAGILVEL 167

Query: 129 LNLKNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+               +LQ  G  ID   + + L  ++   + 
Sbjct: 168 TGKTGDAAQLVIGAGINLTMRESITNAINQDWINLQEAGVNIDRNKLTAELLSELRLAVV 227

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G V+  
Sbjct: 228 KFENEG-LSAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-NGNVKPY 285

Query: 246 FTGDI 250
             G+I
Sbjct: 286 IGGEI 290


>gi|270308155|ref|YP_003330213.1| biotin--acetyl-CoA-carboxylase ligase/ BirA family transcriptional
           regulator [Dehalococcoides sp. VS]
 gi|270154047|gb|ACZ61885.1| biotin--acetyl-CoA-carboxylase ligase/ BirA family transcriptional
           regulator [Dehalococcoides sp. VS]
          Length = 262

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/252 (21%), Positives = 96/252 (38%), Gaps = 12/252 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +NL  C         +    +ST    M  A  G      I+   QT G GR    W+S 
Sbjct: 13  NNLHTCFM--GREIIYLPETASTQTVAMDMARKGAEAGTVIITERQTEGHGRLKRLWLSP 70

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           +GN+Y S +    +  +   L    +A ++    A     G   ++KWPNDIL+  +K+ 
Sbjct: 71  QGNIYMSFI----LHPNQNELSRLIMAASLAVSFAIEDTTGIMTELKWPNDILIKGKKVC 126

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           G+LIE       + +  VG+G+NV       P       + +   G  +  + +      
Sbjct: 127 GMLIENDIRDGQVNSSAVGLGINVNTDMQTYPELRDIATSLINHTGKPVSREKLILSFLH 186

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
           +  R+      +   E +  +W+     +G  + +        G    ++  G L +   
Sbjct: 187 EFERLY--LYLNEHGECVFEMWKKRLITLGKEVDVTSGRDIYRGIVETINPDGSLRIRLA 244

Query: 239 KGCVRQIFTGDI 250
            G +  I  GD+
Sbjct: 245 DGNLVYIMAGDV 256


>gi|302876938|ref|YP_003845571.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulovorans
           743B]
 gi|307687627|ref|ZP_07630073.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulovorans
           743B]
 gi|302579795|gb|ADL53807.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulovorans
           743B]
          Length = 267

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/258 (24%), Positives = 110/258 (42%), Gaps = 14/258 (5%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGD---LGNLWIVASCQTAGRGRRDNK 58
             NL+ C   +   + +  TI STN +  + A            I++  QT G+GR    
Sbjct: 11  LENLNTCC--FGKTFLYLPTIDSTNIKAKELANQDQSKYPNGFLIISEEQTNGKGRLGRT 68

Query: 59  WISDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF 117
           W S     L+ SL+L  +I+   +  ++   AVA+   + +    G D +IKWPNDIL+ 
Sbjct: 69  WHSPSGCGLWFSLILRPNINLVDIPKITLISAVALCDSLKN---SGVDSQIKWPNDILIN 125

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDI 172
            +KIAGIL E  +L + +  V++GIGLNV       P  +           G   D   I
Sbjct: 126 NKKIAGILTEMSSLNSIVNFVILGIGLNVNTKASQFPLELKETASSLFIEYGNNFDKSKI 185

Query: 173 FSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGY 232
            +        +   +  +   + I+  ++  +  +   + I  +    L     + + G 
Sbjct: 186 LADFLYIFEDLWFKFLTNGSFDHILAKYKETSTVLHKKVKIINAGKESLVFVKDITEDGS 245

Query: 233 LLLEEKKGCVRQIFTGDI 250
           LL+    G  + I +G++
Sbjct: 246 LLVVTADGDEKLIISGEV 263


>gi|24115263|ref|NP_709773.1| biotin--protein ligase [Shigella flexneri 2a str. 301]
 gi|30064740|ref|NP_838911.1| biotin--protein ligase [Shigella flexneri 2a str. 2457T]
 gi|24054555|gb|AAN45480.1| biotin-[acetyl CoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella flexneri 2a str. 301]
 gi|30043000|gb|AAP18722.1| biotin-[acetyl CoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella flexneri 2a str. 2457T]
 gi|281603363|gb|ADA76347.1| Biotin-[acetyl CoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella flexneri 2002017]
 gi|313648627|gb|EFS13067.1| bifunctional protein birA [Shigella flexneri 2a str. 2457T]
 gi|332752478|gb|EGJ82866.1| bifunctional protein birA [Shigella flexneri 2747-71]
 gi|332762921|gb|EGJ93174.1| biotin operon repressor [Shigella flexneri 2930-71]
 gi|332765532|gb|EGJ95748.1| bifunctional protein birA [Shigella flexneri K-671]
 gi|333014361|gb|EGK33714.1| bifunctional protein birA [Shigella flexneri K-304]
          Length = 321

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQFLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|332762889|gb|EGJ93144.1| bifunctional protein birA [Shigella flexneri 4343-70]
 gi|332998887|gb|EGK18480.1| bifunctional protein birA [Shigella flexneri K-218]
          Length = 321

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQFLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|333010711|gb|EGK30139.1| bifunctional protein birA [Shigella flexneri VA-6]
          Length = 321

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           VA  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQFLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGSGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


>gi|260426575|ref|ZP_05780554.1| biotin-(acetyl-CoA-carboxylase) ligase [Citreicella sp. SE45]
 gi|260421067|gb|EEX14318.1| biotin-(acetyl-CoA-carboxylase) ligase [Citreicella sp. SE45]
          Length = 248

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 116/248 (46%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + STN E  + A +   G  WI+A  QTA RGRR   W++ KGN   +
Sbjct: 3   WPAGYGRRVLAEVDSTNAEAARLAGTLA-GPEWILALRQTAARGRRGRPWVNPKGNFAGT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LL++   + D + L SF  ++A+    A+       + +KWPND+L+   K+AGIL+E+L
Sbjct: 62  LLMMPRETPDVVALRSFVASLALYDAFAAATGRVEGLALKWPNDVLLNGGKVAGILLESL 121

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             + G+  + +GIG+N+   P           PV+ L   G  ID +    LL    A  
Sbjct: 122 GQRRGVAHLAIGIGVNLAEAPDAGEVEPGALRPVSLLSESGVLIDPESFLDLLATSYAEH 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +        +   W   A  +G++IT +      +G F  VD+ G L+L  + G  +
Sbjct: 182 EARFATYG-FGPLREAWLARAARLGEVITARSGTAETVGTFETVDERGNLILTTRGGR-Q 239

Query: 244 QIFTGDIF 251
            I   D+F
Sbjct: 240 AIAAADVF 247


>gi|260588919|ref|ZP_05854832.1| biotin-[acetyl-CoA-carboxylase] ligase [Blautia hansenii DSM 20583]
 gi|260540698|gb|EEX21267.1| biotin-[acetyl-CoA-carboxylase] ligase [Blautia hansenii DSM 20583]
          Length = 253

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 15  RYEFFDTISSTNDECMKRALS---GDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASL 70
           +  + +++ ST     + A      +L     VA+ QTAG+GR    W S    N+Y +L
Sbjct: 3   KIFWKESVDSTLTWAKEEAKKSVGKELDGALFVANEQTAGKGRLGRVWTSVPGENIYMTL 62

Query: 71  L-LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L +   +  ++ + L+  + +++   +        D  IKWPNDI++ ++KI GIL E  
Sbjct: 63  LLMQPEVRAENASSLTLVMGLSVAEAVEEMAG--IDAGIKWPNDIVLSKKKICGILTEMQ 120

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
             +     +++G+G+NV              +     G  +  +++ + +     +  +L
Sbjct: 121 MKEQKPDFIMIGVGINVNQKEFQEELRNKATSVFLETGKEMSREELVTKVTACFWKNYEL 180

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K    + +   +          + I       +G   G+ D G LL+E+ +G VR++F
Sbjct: 181 FLKTQNLKALKEEYEKRLLNKNQQVRILEKGTETIGTARGITDTGELLVEDLQGKVRKVF 240

Query: 247 TGDI 250
           +G++
Sbjct: 241 SGEV 244


>gi|85860938|ref|YP_463140.1| biotin-(acetyl-CoA carboxylase) ligase [Syntrophus aciditrophicus
           SB]
 gi|85724029|gb|ABC78972.1| biotin-(acetyl-CoA carboxylase) ligase [Syntrophus aciditrophicus
           SB]
          Length = 333

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 107/240 (44%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
              F    +TN++    A  G      ++A  Q+ GRGRR   W S     +YA+++L  
Sbjct: 91  IFHFQQTDNTNNQGKALAYEGAPEGALVIAEEQSQGRGRRGRTWFSPHSQGIYATVILRP 150

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I       L+   AVA    +      G  ++IKWPNDIL   RK+AGIL E     + 
Sbjct: 151 LIPLSETPKLTLLAAVAATEALE--TQTGLPIRIKWPNDILANGRKLAGILTEIGTEMDA 208

Query: 135 LQAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +   V+G+GLNV       P D  YP TS+  E G    +      + +           
Sbjct: 209 VDFAVIGMGLNVNVPQASFPSDLRYPATSILIETGRPFPRIRLLQSWLEALEKYYSLLLQ 268

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + I++ W+     +G  I +++     +G    VD  G L+L+E  G +++IF+GD+
Sbjct: 269 GDFDNILSRWKFLTDIVGSRIAVEMPGRRYIGEVQDVDGNGVLILKESDGALQRIFSGDV 328


>gi|315303842|ref|ZP_07874329.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria ivanovii FSL
           F6-596]
 gi|313627785|gb|EFR96431.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria ivanovii FSL
           F6-596]
          Length = 329

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R E +D++SST     +   S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQRLEIYDSVSSTQIIAHQHIES-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +   L+ 
Sbjct: 199 AETIHAVIIGMGINVNQRQFPEEIKDKASSLQLELGASVSRKALLQEILTSLEKYYALFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGKVKGISDEGVLLLQDALGEVHAIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|117618897|ref|YP_858465.1| BirA bifunctional protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560304|gb|ABK37252.1| BirA bifunctional protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 321

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
              F  I STN   ++R           +A CQTAGRGRR   W+S  G  L  S+    
Sbjct: 81  VHCFPVIDSTNQYLLERVNQL-SSGESCLAECQTAGRGRRGKPWVSPFGCQLILSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS A+ VA+   + S    G +  +KWPND+    RK+AGIL+E       
Sbjct: 140 EQGMAAAMGLSLAVGVAVVQALESLGYPGVE--LKWPNDLYYQGRKLAGILVEMSGSAGA 197

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+     +      +            D   +   +   + + +  +++ 
Sbjct: 198 SCHLVIGVGLNLAMPSREGERIDQAWSELRHIQPELVDRNLLAGRVLDHLQQAMLTFEQS 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W       G  + + +    I G   G+DD G L LE  +G ++    G+I
Sbjct: 258 G-LASFVADWNRLDHFAGRPVRLLMGEQEIRGVARGIDDRGALRLETAEG-IKFYLGGEI 315


>gi|84686453|ref|ZP_01014347.1| biotin--acetyl-CoA-carboxylase ligase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665636|gb|EAQ12112.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2654]
          Length = 250

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 114/248 (45%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P+ + Y     ++ST DE   R      G  WI A+ QTA RGRR   W +  GN   +
Sbjct: 5   WPHGYGYLPLGEVTSTLDEARARVGE-MSGPTWITATHQTAARGRRGRPWSNPAGNFAGT 63

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L +     S  L SF  A+A+   + +         +KWPND+L+   K+AGIL+E+L
Sbjct: 64  LVLPNLTDPASAALRSFTTALALDEALTTLTGRPEAFALKWPNDVLLNGSKLAGILLESL 123

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             +  L  +V+GIG+N+   P           PV+ +   G  +   D    L    AR 
Sbjct: 124 TERGHLTGLVIGIGVNLASAPDPGALEPGALAPVSLMGETGLSVTPDDFLEALAPAFARW 183

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
               ++      I   W   A  IG+ +T +L    I G F  VD+ G+L+L   KG  R
Sbjct: 184 EAQLRQYG-FAPIRTAWLARAARIGETVTARLPGDEITGTFRTVDEAGHLVLSTPKGE-R 241

Query: 244 QIFTGDIF 251
            I  GD+F
Sbjct: 242 AIAAGDVF 249


>gi|300023439|ref|YP_003756050.1| biotin/acetyl-CoA-carboxylase ligase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525260|gb|ADJ23729.1| biotin/acetyl-CoA-carboxylase ligase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 258

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 77/239 (32%), Positives = 115/239 (48%), Gaps = 4/239 (1%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R    D   STN + M+ AL G+   LW++A  QTAGRGR    W+S +GNLY S+    
Sbjct: 9   RILHIDETQSTNADAMRLALKGEALPLWVIARRQTAGRGRAGRSWVSPEGNLYTSIAFCC 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNLK 132
           S   +    LS    +++   I ++  +  D   ++KWPNDIL+   K+ GIL+E+   +
Sbjct: 69  SAPMEKAGQLSLIAGISLFEAIRASTDLAQDAPLRLKWPNDILMGTAKMGGILVESTTAR 128

Query: 133 NGLQAV-VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
                + VVG GLN+   P D     T+L +         +   L     + LD+WK   
Sbjct: 129 GSPGFLAVVGFGLNLASYPDDLGRAATALSQHAQAPVAATLLDALAGQFPQWLDVWKDGD 188

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +   W   A  IG+ I++    G I G + G+ D G LL E   G +R+I  GD+
Sbjct: 189 DFAAVRRAWMERAGPIGEAISVNSIDGPIRGTYRGLADNGALLAE-VGGELREINHGDV 246


>gi|326423808|ref|NP_760132.2| Biotin-protein ligase [Vibrio vulnificus CMCP6]
 gi|319999175|gb|AAO09659.2| Biotin-protein ligase [Vibrio vulnificus CMCP6]
          Length = 322

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 93/241 (38%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  +        +A  Q+ GRGRR  +W S    NLY S+   
Sbjct: 80  NVEVIPVIDSTNQYLLERIENLQT-GHVCLAEYQSQGRGRRGRQWFSPFGSNLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + +A    + +    G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGIAAVEALETLGVQGVK--LKWPNDVYYQDKKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN++                        D  ++   L       L  +++
Sbjct: 197 GAAHLVIGMGLNMQMQADCHSIDQPWTALSQIESGARLDRTELALTLMAKWREALSEYEQ 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W       G  + + +    I G   G+D  G ++L+  +G ++    G+
Sbjct: 257 CG-LNGFIERWNRLDNFKGRQVKLLIGPREIHGEVQGIDSQGGVILKTVEG-IQTFVGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|317046434|ref|YP_004114082.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. At-9b]
 gi|316948051|gb|ADU67526.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. At-9b]
          Length = 320

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 104/250 (41%), Gaps = 12/250 (4%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           LS    P          I STN   + R     +     +A  Q AGRGRR  +W S   
Sbjct: 73  LSRLDQP---NLAVIPVIDSTNQYLLDRMDQL-VSGDACIAEYQQAGRGRRGRQWFSPFG 128

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S+         +   LS  I + M  VI S      DV++KWPND+ +  RK+AG
Sbjct: 129 ANLYMSMYWRLEQGPAAAMGLSLVIGIVMAEVIQSLG--AKDVRVKWPNDLYLHDRKLAG 186

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IL+E          +V+G G+N+               +LQ  G  ID   + + L   +
Sbjct: 187 ILVELTGKTGDAAQIVIGAGINLAMRSEGASQINQGWINLQEAGVQIDRNQLSAQLINSL 246

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              L L+++D      +  W      I   + + +    + G   GVD  G LLLE++ G
Sbjct: 247 REALPLFERDG-LAPFIERWDALDNFINRPVKLLIGDREVHGIARGVDKQGGLLLEQE-G 304

Query: 241 CVRQIFTGDI 250
            V+    G+I
Sbjct: 305 EVKAWVGGEI 314


>gi|210623233|ref|ZP_03293672.1| hypothetical protein CLOHIR_01622 [Clostridium hiranonis DSM 13275]
 gi|210153770|gb|EEA84776.1| hypothetical protein CLOHIR_01622 [Clostridium hiranonis DSM 13275]
          Length = 329

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 111/240 (46%), Gaps = 5/240 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
               ++F  I STN+       S       I++  Q+AG+GR    W S+ G      L+
Sbjct: 84  GQNIKYFQEIDSTNNYAKDNFESLK-DGTLIISEYQSAGKGRLGKNWQSNIGEGIWMSLM 142

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           +              +  A  +++ +   +G D +IKWPNDI++  +KI GIL E +   
Sbjct: 143 LKPEIPVYKAPFLTLV--AGAAILNAFRNIGVDAEIKWPNDIVLNGKKICGILTEMVAEV 200

Query: 133 NGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+G+G+NV     P +     TSL++EG  +   DI   +  +  ++   + + 
Sbjct: 201 ERVGCVVIGMGINVNTMLFPGELSEKATSLKKEGFELKRSDIIREIMHEFEKLYTTYIEY 260

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +EE++++ R ++  IG  + I           + + D G L+++   G + ++ +G++
Sbjct: 261 GSKEEVISVCRKYSVLIGKDVYIINKNHREKVYCMDISDDGNLIVKHDDGVIEEVISGEV 320


>gi|268608907|ref|ZP_06142634.1| biotin/acetyl-CoA-carboxylase ligase [Ruminococcus flavefaciens
           FD-1]
          Length = 327

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 102/241 (42%), Gaps = 6/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               + F  I STN    K A         I+A  QT GRGR    + S     +Y SL+
Sbjct: 81  GRNMQVFSEIDSTNTAAKKLASERVPDGTVIIADKQTEGRGRMGRSFESPSGTGIYMSLV 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL-- 129
           L      +   L++ A A A+   I        DV IKW ND+ +  RKI GIL E    
Sbjct: 141 LYPKFGLECAPLITSAAACAVAEAIDEVCGC--DVSIKWVNDLYLNGRKICGILTEASLG 198

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID-LKDIFSLLFQDVARVLDLWK 188
                L   V+GIG+NV+         + ++         +K   ++L   +   L+ + 
Sbjct: 199 LEMKNLDHAVIGIGVNVRSVRNVFGEELGNIATSIEDETGVKADRNVLCGAMLNKLEHYL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                 E +N +R      G+ IT  +   ++ G  +G+DD   L+++   G ++++ +G
Sbjct: 259 GMVESREFLNEYRRRELLTGNTITANVGGNTLTGMAMGIDDNANLIIKLPDGKLKKLSSG 318

Query: 249 D 249
           +
Sbjct: 319 E 319


>gi|163746991|ref|ZP_02154347.1| biotin--acetyl-CoA-carboxylase ligase, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161379552|gb|EDQ03965.1| biotin--acetyl-CoA-carboxylase ligase, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 243

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 104/242 (42%), Gaps = 3/242 (1%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +    +DT+ ST  E  +          WI+A  QTA RGRR   W + +GN  A+
Sbjct: 4   WPEGYGRRVYDTLDSTLSEAARL-QQELTAPTWILALEQTAARGRRGRSWTTPRGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++          L SF  ++A+     +         +KWPND+L+   K+AGIL+E++
Sbjct: 63  LMMPRKEPPGVAALRSFVTSLALYRAFVAVTGREDAFALKWPNDVLLRGGKVAGILLESV 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                +   V                P  +L+  G  +  +D  ++L Q+ A + D +  
Sbjct: 123 GDHLAIGIGVNLAHAPEAGTLEARALPAVTLREAGANVTAEDFLNVLAQEYAGLEDQFTT 182

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 I + W   A  +G++IT +     I G F  VD  G L+L  + G V  I   D
Sbjct: 183 YG-FATIRSAWLAHAARLGEVITARTMRDEITGVFEDVDSAGNLILRTRDGAV-SITAAD 240

Query: 250 IF 251
           +F
Sbjct: 241 VF 242


>gi|54310507|ref|YP_131527.1| biotin--protein ligase [Photobacterium profundum SS9]
 gi|46914950|emb|CAG21725.1| putative BirA bifunctional protein [Photobacterium profundum SS9]
          Length = 320

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 103/251 (41%), Gaps = 13/251 (5%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           LS+ + P   + E    I STN   + R           +A  Q AGRGRR  +W+S   
Sbjct: 73  LSQVKCP---QLELIPIIDSTNQYLLDRFG-LLPKGAVCLAEYQQAGRGRRGRQWLSPFG 128

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S+         +   LS  + VA+   + S      +V++KWPND+    +K+AG
Sbjct: 129 SNLYLSMYWRLDAGMAAAMGLSLIVGVAIAETLQSLG--ANEVRVKWPNDLYYKDKKLAG 186

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQD 179
           IL+E          +V+G+GLN+     +      +        D       + + L   
Sbjct: 187 ILVEMTGQAGDAAHLVIGMGLNIDMPDTEGSDIGQAWTNLSQACDKLPERNHLAAELIDS 246

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + + L  +++    +  +  W      +   + + +    I G   G+D  G LLLE + 
Sbjct: 247 LQKTLITYEQVG-LDGFVERWNRIDNFLNRPVKLLIGQRVIEGIARGIDKQGALLLETES 305

Query: 240 GCVRQIFTGDI 250
           G +     G+I
Sbjct: 306 G-IEPYIGGEI 315


>gi|331649828|ref|ZP_08350906.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli M605]
 gi|331041294|gb|EGI13446.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli M605]
          Length = 321

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLQVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+    V+         +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEDSVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LTPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|238786399|ref|ZP_04630326.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia bercovieri
           ATCC 43970]
 gi|238712694|gb|EEQ04779.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia bercovieri
           ATCC 43970]
          Length = 295

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 102/247 (41%), Gaps = 10/247 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNL 66
              P   +      + STN   + R           VA  Q AGRGRR  +W+S    NL
Sbjct: 50  SHLPTG-QVAVLPVVDSTNQYLLDRIAELK-SGDACVAEYQHAGRGRRGRQWVSPFGANL 107

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           Y S+         +   LS  + + M  V+        +V++KWPND+ +  +K+AGIL+
Sbjct: 108 YLSMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLG--AENVRVKWPNDLYLNDKKLAGILV 165

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           E          +V+G G+N+               +LQ  G  ID   + + L  ++   
Sbjct: 166 ELTGKTGDAAQLVIGAGINLTMRESTINVINQEWINLQEAGVIIDRNKLTAELLSELRLA 225

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           +  ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G ++
Sbjct: 226 VVKFENEG-LSAFISRWRQMDNYLDRPVKLIIGNQEIYGIARGIDQQGALLLEQ-NGDIK 283

Query: 244 QIFTGDI 250
               G+I
Sbjct: 284 PYIGGEI 290


>gi|238898677|ref|YP_002924358.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase;
           transcriptional repressor of biotin synthesis (BirA
           family) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466436|gb|ACQ68210.1| bifunctional: biotin-[acetylCoA carboxylase] holoenzyme synthetase;
           transcriptional repressor of biotin synthesis (BirA
           family) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 318

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   R +    + STN   +    +        VA  QTAGRGRR  +W+S    NLY 
Sbjct: 76  LPEG-RIKVLALVDSTNQYLLDNIETL-RSGDACVAEHQTAGRGRRGREWVSPFGQNLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  I + +  V+ +      D+++KWPND+    +K+AG+L+E 
Sbjct: 134 SMFWRLEKGTAAAVGLSLVIGIVITQVLRNLGG--IDIRVKWPNDLYYRDKKLAGVLVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           L  K     V++G+G+N+ +           + L+  G  ID   + +LL  ++   L  
Sbjct: 192 LGKKFKPAQVIIGMGININNPSSNKGIEQNWSHLKEAGITIDRNKLTALLLSELRSQLIE 251

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++K       ++ W      +   + + +    I G   G+D  G LLLE + G ++   
Sbjct: 252 FEKTG-LSTFISKWHELDNYLNRPVKLIVGDQQIQGIARGIDQHGGLLLETE-GGIKTYQ 309

Query: 247 TGDI 250
            GDI
Sbjct: 310 VGDI 313


>gi|254511677|ref|ZP_05123744.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535388|gb|EEE38376.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           KLH11]
          Length = 249

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 72/248 (29%), Positives = 114/248 (45%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + ST +E  + A +   G +WI+A  QTA RGRR   W + KGNL A+
Sbjct: 4   WPQGYGLHVLQEVDSTLNEAARLAPT-ASGPVWIMAHRQTAARGRRGRAWSNPKGNLAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LL+      +   L SF  A+A+     +       + +KWPND+++   K+AGIL+E+ 
Sbjct: 63  LLMRPPGDPEQAALRSFVAALALFDACVAVTGRAAGLSLKWPNDVVLNGGKLAGILLEST 122

Query: 130 NLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +GIG+N+   P           PV+ L   G  +  +D  + L    A  
Sbjct: 123 GQGRGVSHLAIGIGVNLSEAPGAESVEPGAVRPVSLLSETGAHVTPEDFLAELAVAYAH- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +      G + I   W   A  +G++IT + +    +G F  VD  G L+L   KG V 
Sbjct: 182 YETQFMTYGFQPIRTAWLNRAARLGEVITARTAVSETVGTFETVDAGGSLVLNTAKGRV- 240

Query: 244 QIFTGDIF 251
            I   D++
Sbjct: 241 SIPAADVY 248


>gi|304406909|ref|ZP_07388563.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343896|gb|EFM09736.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus curdlanolyticus
           YK9]
          Length = 327

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 112/254 (44%), Gaps = 10/254 (3%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
            S L +    +       D + ST +E  + A  G      ++A  Q  GRGR    W+S
Sbjct: 70  LSELLQTNR-FGRSLRLLDVVDSTQNEAQRWAEDGAPEGAIVIAEQQLGGRGRMGRSWVS 128

Query: 62  DK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
                ++ SL++  S        L+   AVA+   +      G ++ IKWPND+L+  +K
Sbjct: 129 PYTKGIWMSLIMRPSTPIHFAPQLTLLTAVALCRSLRK--STGLEIGIKWPNDLLISGKK 186

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSL 175
           I+GIL+E+      ++ V+ G G++V     D P  +         + G     + + + 
Sbjct: 187 ISGILLESAAEDERIKYVIAGTGISVNLDISDYPEELLERATSLSIQAGRRFSREQVIAD 246

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
              +  ++ DL+ KD     I  LW   A  +   +T++   G + GR  G+ + G L L
Sbjct: 247 FLLEWEQLYDLYLKDG-FGAIQTLWEALAVTLHQEVTVQTPQGQLEGRATGLHESGALEL 305

Query: 236 EEKKGCVRQIFTGD 249
               G +R +F+G+
Sbjct: 306 LLSSGELRLVFSGE 319


>gi|209964536|ref|YP_002297451.1| biotin-[acetyl-CoA-carboxylase] ligase, birA [Rhodospirillum
           centenum SW]
 gi|209958002|gb|ACI98638.1| biotin-[acetyl-CoA-carboxylase] ligase, birA [Rhodospirillum
           centenum SW]
          Length = 257

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 123/244 (50%), Gaps = 6/244 (2%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +R    +   STNDE    A +G      + A  Q AGRGRR   W S +GNLY S
Sbjct: 16  LPPWYRLVQLEVCGSTNDEAKALAQAGAPEGTLVRARRQEAGRGRRGRGWSSPEGNLYTS 75

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L   +       +SF  A+A+   ++  +P     ++KWPND+LV   KIAGIL+E+ 
Sbjct: 76  LVLRPGVPPVVAAQVSFVAALAVGQTVSDLVPGL--ARLKWPNDVLVDGAKIAGILLESE 133

Query: 130 NLKNG-LQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLW 187
              +G +  +VVG+G+NV H P    YP  SL   G    D  D+ +          + W
Sbjct: 134 PAADGRVDWLVVGVGINVLHHPDAPGYPSCSLLSRGAVSPDPADVLARYAGHFQSWYNRW 193

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +       +   W   A G+G  +T++L+  S  GRFV +DD G L++E  +G  R++  
Sbjct: 194 RAQG-FAPVRAAWLNAAHGLGGPLTVRLAGESFAGRFVDLDDDGGLIVETTEGR-RRVTA 251

Query: 248 GDIF 251
           GD+F
Sbjct: 252 GDVF 255


>gi|78045046|ref|YP_361168.1| BirA bifunctional protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77997161|gb|ABB16060.1| BirA bifunctional protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 328

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 110/239 (46%), Gaps = 10/239 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDS 75
           E+ D I STND   + A +       + A+ QTAGRGR    W S     LY SL+L  S
Sbjct: 82  EYHDLIGSTNDRAKELAANKVPEGFLVSANGQTAGRGRLGRSWNSPPGQGLYFSLVLYPS 141

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    L  L+    +A+   + +    G +V+IKWPND+L+  +K+AGIL E        
Sbjct: 142 LPPVELPRLTLLAGLALAQALENL---GVNVQIKWPNDLLINGQKVAGILTEIAAEAERT 198

Query: 136 QAVVVGIGLNVKH----CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
              VVGIG+N++           YP T+L+     +  + + ++  +   ++ + +K   
Sbjct: 199 IYAVVGIGINIEPLDEEVKSSFAYPATALKEHLPGVSRQSLLAMFLERFEKLYEEFK-KG 257

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + +  ++     +G+ + I       +G    + + G L++ +    V++   G+I
Sbjct: 258 EFAQSLTEYKKRLAFLGEEVMIITGDREYIGVLHDLGEDGSLIINDGN-TVKRFAAGEI 315


>gi|313496802|gb|ADR58168.1| BirA [Pseudomonas putida BIRD-1]
          Length = 319

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 70/239 (29%), Positives = 107/239 (44%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L
Sbjct: 76  WPVFIHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + +      DV +KWPND+LV  +KI GIL+E +   
Sbjct: 136 RVDGGMRQLEGLSLVVGLAVMRTLQAF--GVKDVGLKWPNDVLVRGQKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+GIG+NV     +       +  +  G  ID   + +LL Q +   L   ++ 
Sbjct: 194 ADVCHVVLGIGINVNMQVNEQVDQQWTSMRREVGVVIDRNHLVALLSQQLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      I G  +GVD  G L LE   G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRNVSLVAGNTRIDGVVLGVDGQGGLRLE-VDGMEKSFSGGE 310


>gi|89892961|ref|YP_516448.1| hypothetical protein DSY0215 [Desulfitobacterium hafniense Y51]
 gi|219666228|ref|YP_002456663.1| biotin/acetyl-CoA-carboxylase ligase [Desulfitobacterium hafniense
           DCB-2]
 gi|89332409|dbj|BAE82004.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536488|gb|ACL18227.1| biotin/acetyl-CoA-carboxylase ligase [Desulfitobacterium hafniense
           DCB-2]
          Length = 326

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 101/240 (42%), Gaps = 5/240 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             +  FF  +SSTND        G      ++A  QT G GR    W S +G L+ SLLL
Sbjct: 79  GRQLFFFAELSSTNDLLKDMVRQGREHGTVVIARRQTTGHGRMQRAWESPEGGLWLSLLL 138

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +S      L+ +  VA+   +           IKWPND++V  RKIAGIL E     
Sbjct: 139 KPRLSLGDAAKLTLSTGVALAQTLQDLYG--LAAGIKWPNDVVVQGRKIAGILGEVAGEW 196

Query: 133 NGLQAVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +Q +++GIG+N            P T+LQ   G     +  +              + 
Sbjct: 197 TTVQTLILGIGVNANFSGQTFSSKLPATTLQDILGYEVNLNHLAAQLLFNLEKEVQSLEQ 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + ++  W  FA GI   + I+ +     G F G+ + G L+L+ + G      +G++
Sbjct: 257 GDVQGLIQRWTSFAVGINQPVRIERAGTVYAGIFKGIREDGELILDLE-GQEMTFSSGEV 315


>gi|90581745|ref|ZP_01237531.1| putative BirA bifunctional protein [Vibrio angustum S14]
 gi|90437069|gb|EAS62274.1| putative BirA bifunctional protein [Vibrio angustum S14]
          Length = 320

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 94/241 (39%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             +    I STN   + R           +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  HLDLIPVIDSTNQYLLDRVGQL-PSGSVCLAEYQEAGRGRRGRQWVSPFGSNLYLSIYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +        DV++KWPNDI    +K+AGIL+E      
Sbjct: 139 LEAGMAAAMGLSLVVGVAIAETLQKLG--ADDVRVKWPNDIYYQDKKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQDVARVLDLWKK 189
               +V+G+GLN+     +      +        D       + + L   + + L  ++ 
Sbjct: 197 DAAHLVIGMGLNINMPLTEQSEITQAWTTLSQACDSLPSRNILAATLISHLNQTLCDYEH 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      +   + + +   +I G   G+D  G LLLE   G +     G+
Sbjct: 257 QG-LVGFVERWNKIDNFLNRPVKLLIGERTIEGTARGIDAQGALLLETDTG-ITPYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|118576521|ref|YP_876264.1| biotin-(acetyl-CoA carboxylase) ligase [Cenarchaeum symbiosum A]
 gi|118195042|gb|ABK77960.1| biotin-(acetyl-CoA carboxylase) ligase [Cenarchaeum symbiosum A]
          Length = 323

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 110/252 (43%), Gaps = 11/252 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           +   LS  +     R  +F+++ ST    ++ A         ++A  QTAGRGR   +WI
Sbjct: 77  ILDGLSTRKM--GKRIHYFESLDSTQAYALRIAGEKREDGAVVIARRQTAGRGRMGRRWI 134

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S  G ++ S++                +A ++    A     G   ++KWPND+LV   K
Sbjct: 135 SPHGGVWLSVITRP---ARGGPNTVLPLAASVALAEAIEAAAGVRPELKWPNDVLVNGGK 191

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           +AGIL++      G+   V+G+G+N+     +               D  D    + ++ 
Sbjct: 192 VAGILVDASVSPGGVDHAVIGVGINLDVKAGEISRRTGRAAASLS--DHADAAPAIVREF 249

Query: 181 ARVLDLW---KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
              L+         G   I++ W   +C +G  I+++   G++ GR + VD  G L+L+ 
Sbjct: 250 LSALERATDSLDAGGSAGILSRWTGLSCTVGRNISVETGGGTVRGRALCVDPDGALVLDC 309

Query: 238 KKGCVRQIFTGD 249
             G  R++ +GD
Sbjct: 310 -NGDRRRVVSGD 320


>gi|51594628|ref|YP_068819.1| biotin--protein ligase [Yersinia pseudotuberculosis IP 32953]
 gi|186893629|ref|YP_001870741.1| biotin--protein ligase [Yersinia pseudotuberculosis PB1/+]
 gi|51587910|emb|CAH19513.1| bifunctional protein BirA [Yersinia pseudotuberculosis IP 32953]
 gi|186696655|gb|ACC87284.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Yersinia pseudotuberculosis PB1/+]
          Length = 319

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P          + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 76  LPTG-HVTVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+ +       V++KWPND+ +  +K+AGIL+E 
Sbjct: 134 SMYWRLEQGPAAAMGLSLVVGIVMAEVLQNLG--AEKVRVKWPNDLYLNDKKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+               +LQ  G  ID   + + +  ++   + 
Sbjct: 192 TGKTGDAAQLVIGAGINLTMRGSETNAINQDWINLQDAGVTIDRNKLTAEILSELRLAVV 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ D      ++ W+     +   + + +    I G   G+D  G LLLE+  G ++  
Sbjct: 252 KFENDG-LSAFLSRWQKMDNYLNRPVKLIIGNQEIFGIARGIDQQGALLLEQ-DGNIKPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|149204774|ref|ZP_01881737.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. TM1035]
 gi|149141743|gb|EDM29796.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. TM1035]
          Length = 252

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 113/248 (45%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +      ++ STN E  + A     G  WI+A  QTA RGRR   W +  GN  A+
Sbjct: 7   WPQGYGRRVLASVDSTNAEAARLAPHLA-GPEWILAHQQTAARGRRGRAWANPAGNFAAT 65

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++  + S D + L SF  ++A+   + +         +KWPND+L+   K+AGIL+E+ 
Sbjct: 66  LVMRPTESPDRVALRSFVASLALFDALVAATGRAEVFALKWPNDVLLNGGKLAGILLESA 125

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
                L    +GIG+N+   P  +        PV+ L   G  ID +    LL    AR 
Sbjct: 126 GAGGSLSHFAIGIGVNLHSAPEVSEVEPGALRPVSLLSETGIAIDPEAFLDLLAPAYARA 185

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +        I   W   A  +G++IT + +     GRF  VD+ G L+L   +G  +
Sbjct: 186 EAQFVTYG-FAPIRTAWLARAARLGEVITARTTREVYEGRFETVDEAGNLVLLTAQGR-Q 243

Query: 244 QIFTGDIF 251
            I   ++F
Sbjct: 244 AIAAAEVF 251


>gi|322613106|gb|EFY10055.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322617852|gb|EFY14747.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622210|gb|EFY19057.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626642|gb|EFY23446.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631290|gb|EFY28052.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635191|gb|EFY31910.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642623|gb|EFY39216.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647427|gb|EFY43917.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650778|gb|EFY47173.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653442|gb|EFY49774.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657323|gb|EFY53600.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663323|gb|EFY59526.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322667368|gb|EFY63531.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672016|gb|EFY68134.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675088|gb|EFY71169.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322679343|gb|EFY75391.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684746|gb|EFY80748.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323196008|gb|EFZ81173.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323196224|gb|EFZ81379.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204940|gb|EFZ89929.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205619|gb|EFZ90583.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323212385|gb|EFZ97204.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323214252|gb|EFZ99007.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221166|gb|EGA05596.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225215|gb|EGA09456.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229177|gb|EGA13304.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235780|gb|EGA19861.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238653|gb|EGA22707.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242325|gb|EGA26353.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249739|gb|EGA33643.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251545|gb|EGA35415.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256805|gb|EGA40524.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262784|gb|EGA46336.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323263974|gb|EGA47484.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268467|gb|EGA51936.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 320

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 101/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     IG  + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIGRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|163789955|ref|ZP_02184391.1| biotin-protein ligase [Carnobacterium sp. AT7]
 gi|159874895|gb|EDP68963.1| biotin-protein ligase [Carnobacterium sp. AT7]
          Length = 327

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 57/244 (23%), Positives = 95/244 (38%), Gaps = 7/244 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASL 70
            SF    F TI STN+E  K AL   +    +++  QT GRGR    + S  +  +Y S 
Sbjct: 80  QSFPIYAFKTIDSTNNEARKIALKDPINQGLVLSEEQTKGRGRMGKTFYSPNQTGVYMSF 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
            L  ++      L++ A AVA+   I          +IKW NDI +   KI GIL E ++
Sbjct: 140 FLKPNLDMADAPLVTTATAVAVCLAIEKL--TAKKPQIKWVNDIYLDGTKICGILTEAVS 197

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSL----QREGGCIDLKDIFSLLFQDVARVLDL 186
                +   + +G+ +      T +P                     + L  ++A   D 
Sbjct: 198 DFESGKIETLIVGIGLNVKEPLTGFPAELDTIAGSLMSSKETENINRNRLIAEIANQFDG 257

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +       +  ++     +G  IT K          + +D  G L+++   G  R + 
Sbjct: 258 IYQTIEERSFLADYKKRCFVMGKKITFKERKQEFEAIPIDIDPQGGLVVQMADGQKRTLS 317

Query: 247 TGDI 250
            G+I
Sbjct: 318 YGEI 321


>gi|159899868|ref|YP_001546115.1| biotin--acetyl-CoA-carboxylase ligase [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892907|gb|ABX05987.1| biotin--acetyl-CoA-carboxylase ligase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 272

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 66/238 (27%), Positives = 103/238 (43%), Gaps = 8/238 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK--GNLYASLLLIDSI 76
            +  +STN    +RA +G    L IVA+ QTAGRGRR   W +      L + LL    +
Sbjct: 29  LEQTASTNSLIRERAFAGVSEGLVIVANEQTAGRGRRGRTWSAPAGSSLLLSLLLRPTWL 88

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE-TLNLKNGL 135
                 LL+   AVA+   I         V++KWPND+L+  RK+AGIL+E        L
Sbjct: 89  LPSESFLLTMLAAVAISEAIERETNC--KVELKWPNDLLINGRKLAGILVELETAGPERL 146

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW---KKDTG 192
           +  V+G G+NV   P + P    +              + L + + +  D      +   
Sbjct: 147 RWAVIGSGINVNWQPTEDPSINQAATSLALECGKDVDRAALLRAILQSYDRQYLSLRSGR 206

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           RE +   W      +G  + ++LS  +  G    VD  G L +    G +  ++ GD+
Sbjct: 207 REALRQAWLSRLTTLGQTVEVELSSHNFTGVAESVDQHGGLQVRSSDGQLHTVYAGDV 264


>gi|22124387|ref|NP_667810.1| biotin--protein ligase [Yersinia pestis KIM 10]
 gi|45443040|ref|NP_994579.1| biotin--protein ligase [Yersinia pestis biovar Microtus str. 91001]
 gi|108809419|ref|YP_653335.1| biotin--protein ligase [Yersinia pestis Antiqua]
 gi|108810372|ref|YP_646139.1| biotin--protein ligase [Yersinia pestis Nepal516]
 gi|145600630|ref|YP_001164706.1| biotin--protein ligase [Yersinia pestis Pestoides F]
 gi|153948890|ref|YP_001402822.1| biotin--protein ligase [Yersinia pseudotuberculosis IP 31758]
 gi|153997207|ref|ZP_02022314.1| bifunctional protein BirA [Yersinia pestis CA88-4125]
 gi|162420268|ref|YP_001607738.1| biotin--protein ligase [Yersinia pestis Angola]
 gi|165926369|ref|ZP_02222201.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940016|ref|ZP_02228552.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166012137|ref|ZP_02233035.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214628|ref|ZP_02240663.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399581|ref|ZP_02305105.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422998|ref|ZP_02314751.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426806|ref|ZP_02318559.1| birA bifunctional protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470586|ref|ZP_02335290.1| birA bifunctional protein [Yersinia pestis FV-1]
 gi|170022586|ref|YP_001719091.1| biotin--protein ligase [Yersinia pseudotuberculosis YPIII]
 gi|218930764|ref|YP_002348639.1| biotin--protein ligase [Yersinia pestis CO92]
 gi|229836497|ref|ZP_04456664.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis Pestoides A]
 gi|229839442|ref|ZP_04459601.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900005|ref|ZP_04515143.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900548|ref|ZP_04515675.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis Nepal516]
 gi|270488903|ref|ZP_06205977.1| biotin-(acetyl-CoA-carboxylase) ligase [Yersinia pestis KIM D27]
 gi|294505427|ref|YP_003569489.1| biotin--protein ligase [Yersinia pestis Z176003]
 gi|21957168|gb|AAM84061.1|AE013648_3 biotin-[acetyl CoA carboxylase] holoenzyme synthetase [Yersinia
           pestis KIM 10]
 gi|45437907|gb|AAS63456.1| bifunctional protein BirA [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774020|gb|ABG16539.1| bifunctional protein BirA [Yersinia pestis Nepal516]
 gi|108781332|gb|ABG15390.1| bifunctional protein BirA [Yersinia pestis Antiqua]
 gi|115349375|emb|CAL22346.1| bifunctional protein BirA [Yersinia pestis CO92]
 gi|145212326|gb|ABP41733.1| bifunctional protein BirA [Yersinia pestis Pestoides F]
 gi|149289315|gb|EDM39394.1| bifunctional protein BirA [Yersinia pestis CA88-4125]
 gi|152960385|gb|ABS47846.1| birA bifunctional protein [Yersinia pseudotuberculosis IP 31758]
 gi|162353083|gb|ABX87031.1| birA bifunctional protein [Yersinia pestis Angola]
 gi|165912056|gb|EDR30697.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921893|gb|EDR39090.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165988938|gb|EDR41239.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204191|gb|EDR48671.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166957096|gb|EDR55117.1| birA bifunctional protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052085|gb|EDR63493.1| birA bifunctional protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054188|gb|EDR64013.1| birA bifunctional protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749120|gb|ACA66638.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Yersinia pseudotuberculosis YPIII]
 gi|229682403|gb|EEO78492.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis Nepal516]
 gi|229686949|gb|EEO79027.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695808|gb|EEO85855.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706565|gb|EEO92572.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Yersinia pestis Pestoides A]
 gi|262363492|gb|ACY60213.1| biotin--protein ligase [Yersinia pestis D106004]
 gi|262367421|gb|ACY63978.1| biotin--protein ligase [Yersinia pestis D182038]
 gi|270337407|gb|EFA48184.1| biotin-(acetyl-CoA-carboxylase) ligase [Yersinia pestis KIM D27]
 gi|294355886|gb|ADE66227.1| biotin--protein ligase [Yersinia pestis Z176003]
          Length = 319

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P          + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 76  LPTG-HVTVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+ +       V++KWPND+ +  +K+AGIL+E 
Sbjct: 134 SMYWRLEQGPAAAMGLSLVVGIVMAEVLQNLG--AEKVRVKWPNDLYLNDKKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+               +LQ  G  ID   + + +  ++   + 
Sbjct: 192 TGKTGDAAQLVIGAGINLTMRGSETNAINQDWINLQDAGVTIDRNKLTAEILSELRLAVV 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ W+     +   + + +    I G   G+D  G LLLE+  G ++  
Sbjct: 252 KFENEG-LSAFLSRWQKMDNYLNRPVKLIIGNQEIFGIARGIDQQGALLLEQ-DGNIKPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|325292648|ref|YP_004278512.1| biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. H13-3]
 gi|325060501|gb|ADY64192.1| biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. H13-3]
          Length = 246

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 116/241 (48%), Positives = 150/241 (62%), Gaps = 1/241 (0%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             FR+E      STN EC  RA +GD GNLWI A  QT GRGRR   W+S+ GNLYASLL
Sbjct: 4   DDFRHEAMAETPSTNIECFARARAGDGGNLWITAIRQTGGRGRRGRPWVSEPGNLYASLL 63

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLN 130
           LID    D +  L  A A+A+   I + LP G D ++IKWPND+L+ +RK  GIL+E   
Sbjct: 64  LIDPAPMDRIGSLPLAFALAVYRAIRAVLPTGGDPLEIKWPNDVLIGRRKTCGILMEAEL 123

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           L +G +A+V+GIG+N+ H P +  YPVT L   G      ++F+ LF++ A VL  W + 
Sbjct: 124 LPDGRRAIVIGIGINIAHKPENPLYPVTMLSEHGASCSPDELFAHLFRETADVLQSWDEG 183

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   +M  WR  ACGIG+ IT+     SI GRFVG+DD GYLLL+E +G  R I  GD+
Sbjct: 184 RGVSGVMAGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDEDEGTRRSIAAGDV 243

Query: 251 F 251
           F
Sbjct: 244 F 244


>gi|238798653|ref|ZP_04642127.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia mollaretii
           ATCC 43969]
 gi|238717471|gb|EEQ09313.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia mollaretii
           ATCC 43969]
          Length = 295

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 52  LPAG-QVAVLPVVDSTNQYLLDRIGELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 109

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V++KWPND+ +  +K+AGIL+E 
Sbjct: 110 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLG--AEKVRVKWPNDLYLNDKKLAGILVEL 167

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T                ID   + + L  ++   + 
Sbjct: 168 TGKTGDAAQLVIGAGINLTMRESTTNVINQDWINLQEAGVIIDRNKLTAELLSELRLAVV 227

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G ++  
Sbjct: 228 KFENEG-LSAFISRWREMDNYLDRPVRLIIGNQEIYGVARGIDQQGALLLEQ-DGVIKPY 285

Query: 246 FTGDI 250
             G+I
Sbjct: 286 IGGEI 290


>gi|114765014|ref|ZP_01444161.1| biotin--acetyl-CoA-carboxylase ligase [Pelagibaca bermudensis
           HTCC2601]
 gi|114542561|gb|EAU45586.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. HTCC2601]
          Length = 248

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 113/248 (45%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       I STN E  + A +   G  WI A  QTAGRGRR   W + +GN  A+
Sbjct: 3   WPAGYGRRVLAEIDSTNAEAARLAGTLA-GPEWICALRQTAGRGRRGRAWANPEGNFAAT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+ +   +   + L SF  ++A+    ++       + +KWPND+L+   K+AGIL+E+L
Sbjct: 62  LVTMPREAPQLVALRSFVASLALFDAFSAATGRVDGLALKWPNDVLLNGGKVAGILLESL 121

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             + G+  + +GIG+N+   P           PV+ L   G  ++ +    LL    A  
Sbjct: 122 GQRRGVAHLAIGIGVNLVAAPGADEVEPGALRPVSLLSETGVHVEPEAFLELLASAYAEH 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +        +   W   A  +G++IT +     I G F  VD  G L+L+   G  +
Sbjct: 182 EARFVTYG-FAPLREAWLARAARLGEVITARTGTAEITGTFETVDAGGNLVLKSSAGR-Q 239

Query: 244 QIFTGDIF 251
            I   D+F
Sbjct: 240 AIAAADVF 247


>gi|260779614|ref|ZP_05888504.1| biotin-protein ligase/biotin operon repressor [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260604423|gb|EEX30727.1| biotin-protein ligase/biotin operon repressor [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 320

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R E    I STN   + R  S +      +A  Q  GRGRR  +W+S    NLY S+   
Sbjct: 79  RIELIPIIDSTNQYLLDRVDSLE-SGSVCLAEYQAQGRGRRGREWVSPFGSNLYLSMFWR 137

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +      G    +KWPND+    +K+AGIL+E      
Sbjct: 138 LDAGMAAAMGLSLVVGVAIVEALEEMGLTGVK--LKWPNDLYYQDKKLAGILVEMSGQAG 195

Query: 134 GLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
               +V+G+GLN+        +  P+       +   ID   +   +   + + LD ++ 
Sbjct: 196 AAANLVIGMGLNLMMSEATEGITQPWASLDDVADNQQIDRNQLAITMITTLHKALDDYEL 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      I   + + +    I G   G+++ G ++LE + G +     G+
Sbjct: 256 YGMAG-FVERWNRLDNFINRPVKLLMGPREIAGIARGINEQGAVILETESG-LETFIGGE 313

Query: 250 I 250
           I
Sbjct: 314 I 314


>gi|148555906|ref|YP_001263488.1| biotin--acetyl-CoA-carboxylase ligase [Sphingomonas wittichii RW1]
 gi|148501096|gb|ABQ69350.1| biotin--acetyl-CoA-carboxylase ligase [Sphingomonas wittichii RW1]
          Length = 261

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 70/237 (29%), Positives = 102/237 (43%), Gaps = 8/237 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
                   STND+    A  G     W+ A  Q  GRGR+   W+S  GNL+AS L+   
Sbjct: 30  IRHVAVTGSTNDDMTALAREGAAEGTWLRADRQEGGRGRQGRAWVSPPGNLHASTLVRRL 89

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                   L+   AVA+  ++ +       + IKWPND+L    KI+GIL+E        
Sbjct: 90  GGDPPAPSLAMVAAVALDELLQA-WLGPDRLAIKWPNDLLADGAKISGILLEGAGD---- 144

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTS-LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
            AVVVGIG+N+ H P     P TS         +  D  + L    A  L  W+ +    
Sbjct: 145 -AVVVGIGVNLAHRPEGIDRPATSLAALGLSPPEPGDFAAELAAVFAAWLARWRTEG-LG 202

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            ++  W+  A   G  + ++   G I G + G+   G L L    G +  +  GD+F
Sbjct: 203 VVLARWQARAHPPGTALRVRAPEGEIEGLYEGLAADGALRLRTSDGRIHLVHAGDVF 259


>gi|168333678|ref|ZP_02691933.1| biotin--acetyl-CoA-carboxylase ligase [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 255

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 104/242 (42%), Gaps = 5/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                F+D + STN    +   + ++     I+A  QT+G+GR    W S K   ++ S+
Sbjct: 6   GSNMIFYDEVESTNQIAKELIKTSNIQSGAIIIADTQTSGKGRLGRSWSSPKGEGIFMSI 65

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++  +++ + +  L+    +AM   + +      D +IKWPNDIL+ ++K+ GIL E + 
Sbjct: 66  VVCPTLAINQIPKLTLISGLAMCHTLKNICG-SNDTRIKWPNDILINEKKVCGILCELVG 124

Query: 131 LKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
              G   +++GIG+NV     P   PY  +           + I     +    +   + 
Sbjct: 125 NNTGKNFIIIGIGVNVNQTTFPSTLPYATSLRLEYKVEFSRQRIIDEFAKIFDEMYKTYL 184

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            +      +  +       G  + +     + +     +++ G+L + +  G   +I +G
Sbjct: 185 IEKNLSPFIKDYANLCINTGKKVYVNTENTTEIVTVEKINEEGFLEVIDMYGNKHEIQSG 244

Query: 249 DI 250
           ++
Sbjct: 245 EV 246


>gi|332304678|ref|YP_004432529.1| biotin/acetyl-CoA-carboxylase ligase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172007|gb|AEE21261.1| biotin/acetyl-CoA-carboxylase ligase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 328

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 97/239 (40%), Gaps = 7/239 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +    + I STN     R  +        +A  QTAGRGRR   W+S    +LY S    
Sbjct: 89  QLTLLNVIDSTNQYLKDRISTLH-NGDVCLAEAQTAGRGRRGRTWVSPYGASLYLSQYWQ 147

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +    S+  LS A+ VA+   +        D+++KWPNDI    +K+AG+LIE      
Sbjct: 148 FAGGYQSIGGLSLAVGVAITRALEKAGYQ--DIELKWPNDIYARGKKLAGVLIEVEGQMG 205

Query: 134 GLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
                ++G+GLN+           P   L         ++  S L  D           +
Sbjct: 206 SACDCIIGVGLNMALDIGSEQIDQPWIDLTTLDPEHVDRNRVSALLLDELTHCAQVFSQS 265

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G E  +  WR         + + +   ++ G   G+D+ G LLL  + G V+    G+I
Sbjct: 266 GLEPFIESWREKNVFKDKPVRLIIGNKTVQGICKGIDNNGALLLAHENG-VQAYSGGEI 323


>gi|238756069|ref|ZP_04617392.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia ruckeri ATCC
           29473]
 gi|238705736|gb|EEP98130.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia ruckeri ATCC
           29473]
          Length = 311

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 95/245 (38%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      I STN   + R           VA  Q AGRGRR   W+S    NLY 
Sbjct: 67  LPEG-QVTVLPVIDSTNQYLLDRISELQ-SGDACVAEYQQAGRGRRGRPWVSPFGANLYL 124

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V  KWPND+ +  +K+AGIL+E 
Sbjct: 125 SMFWRLDQGPAAAMGLSLVVGIVMTEVLRKLGAAEVKV--KWPNDLYLNDKKLAGILVEL 182

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL---QREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+                 Q  G  ID   + + L  ++   + 
Sbjct: 183 TGKTGDAAQLVIGAGINLTMRESLNNVINQDWINLQEAGVSIDRNKLTAELLSELRSAII 242

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G +   
Sbjct: 243 KFESEG-LSVFISRWRELDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-NGILNSY 300

Query: 246 FTGDI 250
             G+I
Sbjct: 301 IGGEI 305


>gi|289435253|ref|YP_003465125.1| birA bifunctional protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171497|emb|CBH28041.1| birA bifunctional protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 326

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  D+++ST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHDSVTSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG---CIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +      +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 NKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|313632657|gb|EFR99636.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria seeligeri FSL
           N1-067]
          Length = 326

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  D+++ST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHDSVTSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG---CIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +      +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWEAKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGVVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|84387758|ref|ZP_00990774.1| BirA bifunctional protein [Vibrio splendidus 12B01]
 gi|84377441|gb|EAP94308.1| BirA bifunctional protein [Vibrio splendidus 12B01]
          Length = 321

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 99/241 (41%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  + +      +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  SLELIPIIGSTNQHLLERTSTLE-SGSVCIAEYQAAGRGRRGREWVSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +      G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGVAVVEALEEMGVEGVK--LKWPNDLYHNDKKLAGILVELSGQSG 196

Query: 134 GLQAVVVGIGLNVKHCPVD----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN+   P       P+       +G   D   +   L     + L  ++ 
Sbjct: 197 GAAHIVIGLGLNLSMDPTTSGIGQPWTSLKEVCDGKVPDRNQLAQALINAWDKSLADYEL 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      +G  + + +    I G   G+D+ G +LL+ + G V     G+
Sbjct: 257 KGMSN-FVERWNRLDNFLGRNVRLIIGPREIEGVVQGIDEQGAVLLKTENG-VESYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|83942651|ref|ZP_00955112.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. EE-36]
 gi|83846744|gb|EAP84620.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. EE-36]
          Length = 263

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 105/245 (42%), Gaps = 2/245 (0%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL 66
               P  +  + FD++ ST  E  ++A     G+ WI+A  QTA RGRR   W + +GN 
Sbjct: 20  NASWPDGYGRQVFDSVDSTLSEAARQASEL-TGSTWILAQEQTAARGRRGRSWATPRGNF 78

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
            A+L++  S S  +  L SF  ++A+R    +T        +KWPND+L+   K+AGIL+
Sbjct: 79  AATLMMRRSESPSTAALRSFVASLALRRAFVATTRDEGAFTLKWPNDVLLNGGKVAGILL 138

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E++     +   V                   S+  E G +   ++F          L+ 
Sbjct: 139 ESIGDFLAIGIGVNLAHAPGADQVEAGALRPVSVVAETGKVVPPEVFLDALAAEYAQLET 198

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +  G   I   W   A  +G+ I  +       G F  VD  G L+L   KG V  I 
Sbjct: 199 QFQTYGFAPIRTAWLSHAARLGEEIVARTMKDETRGVFEDVDAQGNLILRTPKGRV-PIT 257

Query: 247 TGDIF 251
             D+F
Sbjct: 258 AADVF 262


>gi|145220515|ref|YP_001131224.1| biotin--acetyl-CoA-carboxylase ligase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206679|gb|ABP37722.1| biotin--acetyl-CoA-carboxylase ligase [Chlorobium phaeovibrioides
           DSM 265]
          Length = 325

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 103/242 (42%), Gaps = 5/242 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASL 70
           ++    + + + STN      A  G    L + A  QT GRGR    W S    N++ SL
Sbjct: 80  FAREMVWEEELVSTNTTARVLAGKGAAEGLVVSADRQTGGRGRLGRSWESAPGVNIHCSL 139

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +    +  L+  +AVA+   IAS LP      IKWPNDI    RK+AG+L E  +
Sbjct: 140 VLRPRVPLQRIPQLTLLVAVAIHKAIASLLP-DLSAAIKWPNDIYSDGRKLAGVLCEMES 198

Query: 131 LKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             +    VVVGIG+NV      P  +    + L   G       + + +F     +   W
Sbjct: 199 EADCAHFVVVGIGINVNQESFPPHLSQSATSLLLASGRIASRPQLLAEIFNHFEPLYHEW 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +      +++     A      + +   +G I GR  G+   G L + E  G V  I +
Sbjct: 259 CEVDDLAFVLDYLERHAWLKDREVEVSRLHGKIAGRVSGLSALGELRVVESDGTVHLIGS 318

Query: 248 GD 249
           G+
Sbjct: 319 GE 320


>gi|89076734|ref|ZP_01163017.1| putative BirA bifunctional protein [Photobacterium sp. SKA34]
 gi|89047609|gb|EAR53219.1| putative BirA bifunctional protein [Photobacterium sp. SKA34]
          Length = 320

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 94/241 (39%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             +    I STN   + R           +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  HLDLIPVIDSTNQYLLDRVGQL-PSGSVCLAEYQEAGRGRRGRQWVSPFGSNLYLSIYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +        DV++KWPNDI    +K+AGIL+E      
Sbjct: 139 LEAGMAAAMGLSLVVGVAIAETLQKLG--ADDVRVKWPNDIYYQDKKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQDVARVLDLWKK 189
               +V+G+GLN+     +      +        D       + + L   + + L  ++ 
Sbjct: 197 DAAHLVIGMGLNINMPLAEQSEITQAWTTLSQACDSLPSRNILAATLISHLNQTLCDYEY 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      +   + + +   +I G   G+D  G LLLE   G +     G+
Sbjct: 257 QG-LVGFVERWNKIDNFLNRPVKLLIGERTIEGTARGIDAQGALLLETDTG-ITPYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|330444932|ref|ZP_08308586.1| biotin-[acetyl-CoA-carboxylase] ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328493050|dbj|GAA03083.1| biotin-[acetyl-CoA-carboxylase] ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 320

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 96/241 (39%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   + R           +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  HLELIPVIDSTNQYLLDRVGQL-PSGSVCLAEYQEAGRGRRGRQWLSPFGSNLYLSIYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +        DV++KWPNDI    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGVAIAETLQQLG--APDVRVKWPNDIYYKDQKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSL----QREGGCIDLKDIFSLLFQDVARVLDLWKK 189
               +V+G+GLNV     +      +     Q          + + L   + + L  +++
Sbjct: 197 DAAHLVIGMGLNVSMPIKEQAEITQAWTNLAQACDNLPSRNQLAAQLISHLTQTLIDYEQ 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W      +   + + +   +I G   G+D  G LLLE  +G V     G+
Sbjct: 257 QG-LTGFVERWNKIDNFLNRPVKLLIGERTIEGIARGIDVQGALLLETDEG-VAPYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|110807828|ref|YP_691348.1| biotin--protein ligase [Shigella flexneri 5 str. 8401]
 gi|110617376|gb|ABF06043.1| biotin--protein ligase [Shigella flexneri 5 str. 8401]
          Length = 321

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQFLLDRIGELK-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|15888613|ref|NP_354294.1| birA bifunctional protein [Agrobacterium tumefaciens str. C58]
 gi|15156335|gb|AAK87079.1| birA bifunctional protein [Agrobacterium tumefaciens str. C58]
          Length = 256

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 148/241 (61%), Gaps = 1/241 (0%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             FR+E      STN EC  RA +GD GNLW+ A  QT GRGRR   W+S+ GNLYASLL
Sbjct: 14  DDFRHEAMAETPSTNLECFARARAGDGGNLWVTAIRQTGGRGRRGRPWVSEPGNLYASLL 73

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETLN 130
           LID    + +  L  A A+A+   I + LP     ++IKWPND+L+ +RK  GIL+E   
Sbjct: 74  LIDPAPVERIGSLPLAFALAVYRAIRAVLPTAGEPLEIKWPNDVLIGRRKTCGILMEAEL 133

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           L +G +A+V+GIG+N+ H P +  YPVT L   G      ++F+ LF++ A VL  W + 
Sbjct: 134 LPDGRRAIVIGIGINIAHKPDNPLYPVTMLSEHGASCSPDELFAHLFRETAEVLRNWDEG 193

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   IM  WR  ACGIG+ IT+     SI GRFVG+DD GYLLL+E +G  R I  GD+
Sbjct: 194 RGVSGIMTGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDEDEGARRSIAAGDV 253

Query: 251 F 251
           F
Sbjct: 254 F 254


>gi|288560103|ref|YP_003423589.1| biotin-acetyl-CoA-carboxylase ligase BirA [Methanobrevibacter
           ruminantium M1]
 gi|288542813|gb|ADC46697.1| biotin-acetyl-CoA-carboxylase ligase BirA [Methanobrevibacter
           ruminantium M1]
          Length = 303

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 114/240 (47%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
              F  + STN      A  G      +++  QT  RGR   KW +  G ++ S++L   
Sbjct: 64  ILCFRKVFSTNSISKFLANHGAKEGTVLISEIQTNARGRSGKKWEAPDGGVWMSMILRPD 123

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    + L++ A  VA+   I S      D KIKWPNDIL+   KI+G+L E +   N +
Sbjct: 124 VPPAKIGLITLATGVAIARAIRSF---DVDAKIKWPNDILIHGNKISGVLTEVIATFNQI 180

Query: 136 QAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           + V+VG+G++                 T  +     +D  ++  +   +  ++ D++  +
Sbjct: 181 EYVIVGVGIDSNLKLEDFSEDIREGTTTLEEEIPVKVDENELIGIFLNEFEKIYDIYL-N 239

Query: 191 TGREEIMNLWRCFACGIGDLITI-KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
              EEI++ WR  +  IG  ++I +    +  G  VG++  G L++E++ G + +I +G+
Sbjct: 240 GDVEEILSEWRALSDTIGKYVSITQTGGKTTQGYVVGINKEGSLIIEKQDGNLEKIISGE 299


>gi|324009000|gb|EGB78219.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 57-2]
          Length = 321

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 63/239 (26%), Positives = 101/239 (42%), Gaps = 9/239 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVAVLPVIDSTNQYLLDRIGELK-SGDACVAEYQHAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + ++L +++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+
Sbjct: 257 G-LTPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGE 313


>gi|299821658|ref|ZP_07053546.1| biotin--[acetyl-CoA-carboxylase] ligase [Listeria grayi DSM 20601]
 gi|299817323|gb|EFI84559.1| biotin--[acetyl-CoA-carboxylase] ligase [Listeria grayi DSM 20601]
          Length = 324

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 108/254 (42%), Gaps = 9/254 (3%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           +  NL+           F++T+ ST     K    G      IV   Q  G+GR +  W 
Sbjct: 71  LLLNLATTFM--GKNLYFYETVGSTQLVAKKAVNDGAPEGTVIVGDQQETGKGRMNRNWD 128

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S K   ++ SL++   I        +F  ++A+   I          +IKWPNDI + +R
Sbjct: 129 SQKGQGIWMSLIVKPDIPIAKAPQFTFIASLAIVEAIEKVTD--LTPQIKWPNDIYIGKR 186

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS---LQREGGCIDLKDIFSLL 176
           K+ G+L E     + ++A+++GIG+NV            +    Q  G  +    +F   
Sbjct: 187 KVCGVLTEMQAEADQIEALILGIGINVNQAAFPDEIKNKATSLRQEIGETVSRTILFQAA 246

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
                +   L+  + G E I  LW   A      +      GSI G+  G+ D G LL+E
Sbjct: 247 MLYFEKYYQLY-TEKGFEPIKLLWESKAIPFQSTMIASTLKGSIRGKVKGISDEGVLLME 305

Query: 237 EKKGCVRQIFTGDI 250
           + +G + +I++ DI
Sbjct: 306 DAQGVIHEIYSADI 319


>gi|169630705|ref|YP_001704354.1| biotin--acetyl-CoA-carboxylase ligase (BirA bifunctional protein)
           [Mycobacterium abscessus ATCC 19977]
 gi|169242672|emb|CAM63700.1| Possible biotin--acetyl-CoA-carboxylase ligase (BirA bifunctional
           protein) [Mycobacterium abscessus]
          Length = 264

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 112/257 (43%), Gaps = 14/257 (5%)

Query: 3   SNLSECQNPYS--FRYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKW 59
             L+   +P     R +  +   STN + + RA +G D+  + ++A  QTAGRGR    W
Sbjct: 4   DRLTLTDSPGGHWRRIDVVEETGSTNADLVTRAAAGEDIDGVVLLAEHQTAGRGRHGRSW 63

Query: 60  ISDKGNLYASL--LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF 117
            +      +    + +  +  D   L+     VA+   +A          +KWPND+LV 
Sbjct: 64  GAPAHTQLSMSVGIGVGEVPPDRWGLVPLLAGVAIVDAVAEVSG--IQAGLKWPNDVLVD 121

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE--GGCIDLKDIFSL 175
            RK+ GIL E         A+V+G+GLN      + P P  +          D  ++   
Sbjct: 122 GRKLCGILAEVATPHQ---AIVLGLGLNATFAQHELPDPNATSLTILGWADPDRDELARA 178

Query: 176 LFQDVARVLDLWKKDTGREEI-MNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYL 233
           + +++   ++ W+   G +E  +  +R  +  +G  +  +L     ++G  VG+ + G L
Sbjct: 179 VLRELGGRIEHWRAARGLDERLLEDYRERSVTLGSRVRAELPGERELVGVAVGLGNDGQL 238

Query: 234 LLEEKKGCVRQIFTGDI 250
            +E   G V  +  GDI
Sbjct: 239 RIEAADGTVTAVTAGDI 255


>gi|56461103|ref|YP_156384.1| biotin--protein ligase [Idiomarina loihiensis L2TR]
 gi|56180113|gb|AAV82835.1| Biotin operon repressor/biotin--protein ligase fusion protein
           [Idiomarina loihiensis L2TR]
          Length = 331

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 68/260 (26%), Positives = 111/260 (42%), Gaps = 14/260 (5%)

Query: 1   MFSNLSECQNPYSFR----YEFFDTISSTNDECMKRALSGDLG-NLWIVASCQTAGRGRR 55
           + + + E ++P  +R    +E    + S+ND   + A  G L     I A  QTAGRGRR
Sbjct: 67  LQARVIENESPEKWRQSPEFEVKSVVDSSNDRVKELAKEGPLEAGFSIFAEAQTAGRGRR 126

Query: 56  DNKWISDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDI 114
             KWIS    NLY S+             LS A  VA+          G  V  KWPND+
Sbjct: 127 GKKWISPFGNNLYFSVYWPLDEGIHGAMGLSLAAGVALAECFTDLGIEGVSV--KWPNDV 184

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL----QREGGCIDLK 170
            +  +K+ GIL++      G    ++GIG+N+            +           +   
Sbjct: 185 YIRGKKVTGILVDLETSPEGAAHSIIGIGINLTMPEHVGASIDQAWTDLNSELPQPMSRN 244

Query: 171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDF 230
            I + +   V   L  +++          WR + C +   + + +     LG   G+D+ 
Sbjct: 245 HIAAQVRASVLSALQQYEQHG-LAAFQQSWRRYDCFLDKPVKLIMGQRVCLGTCRGIDEN 303

Query: 231 GYLLLEEKKGCVRQIFTGDI 250
           G LL+E+++G VR+ F G++
Sbjct: 304 GALLVEDEQG-VRRYFGGEV 322


>gi|90415128|ref|ZP_01223082.1| putative BirA bifunctional protein [Photobacterium profundum 3TCK]
 gi|90323753|gb|EAS40374.1| putative BirA bifunctional protein [Photobacterium profundum 3TCK]
          Length = 320

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 103/251 (41%), Gaps = 13/251 (5%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK- 63
           LS+ + P   + E    I STN   + R           +A  Q AGRGRR  +W+S   
Sbjct: 73  LSQVKCP---QLELIPIIDSTNQYLLDRFG-LLSKGTVCLAEYQQAGRGRRGRQWLSPFG 128

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S+         +   LS  + VA+   + S      +V++KWPND+    +K+AG
Sbjct: 129 SNLYLSMYWRLDAGMAAAMGLSLVVGVAIAETLQSLGAD--EVRVKWPNDLYYRDKKLAG 186

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQD 179
           IL+E          +V+G+GLN+     +      +        D       + + L   
Sbjct: 187 ILVEMTGQAGDAAHLVIGMGLNINMPDTEGSSIGQAWTNLSQACDKLPERNHLAAELIDS 246

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + + L  +++    +  +  W      +   + + +    + G   G+D  G LLLE + 
Sbjct: 247 LQKTLITYEQVG-LDGFVERWNKIDNFLNRPVKLLIGQRVVEGIARGIDKQGALLLETES 305

Query: 240 GCVRQIFTGDI 250
           G +     G+I
Sbjct: 306 G-IEPYIGGEI 315


>gi|83953892|ref|ZP_00962613.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. NAS-14.1]
 gi|83841837|gb|EAP81006.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. NAS-14.1]
          Length = 253

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 105/245 (42%), Gaps = 2/245 (0%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL 66
               P  +  + FD++ ST  E  ++A     G+ WI+A  QTA RGRR   W + +GN 
Sbjct: 10  NASWPDGYGRQVFDSVDSTLSEAARQASEL-TGSTWILAQEQTAARGRRGRSWATPRGNF 68

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
            A+L++  S S  +  L SF  ++A+R    +T        +KWPND+L+   K+AGIL+
Sbjct: 69  AATLMMRRSESPSTAALRSFVASLALRRAFVATTRDEGAFTLKWPNDVLLNGGKVAGILL 128

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E++     +   V                   S+  E G +   ++F          L+ 
Sbjct: 129 ESIGDFLAIGIGVNLSHAPGADQVEAGALRPVSVVAETGKVVPPEVFLDALAAEYAQLET 188

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             +  G   I   W   A  +G+ I  +       G F  VD  G L+L   KG V  I 
Sbjct: 189 QFQTYGFAPIRTAWLSHAARLGEEIIARTMKDETRGVFEDVDAQGNLILRTPKGRV-PIT 247

Query: 247 TGDIF 251
             D+F
Sbjct: 248 AADVF 252


>gi|302672116|ref|YP_003832076.1| biotin-acetyl-CoA-carboxylase ligase BirA [Butyrivibrio
           proteoclasticus B316]
 gi|302396589|gb|ADL35494.1| biotin-acetyl-CoA-carboxylase ligase BirA [Butyrivibrio
           proteoclasticus B316]
          Length = 289

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/265 (18%), Positives = 101/265 (38%), Gaps = 27/265 (10%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                + +   STND+  +  + G      +VA  QT GRG R   W + +  N+  SLL
Sbjct: 16  GQNLIYKEKTGSTNDDARELGVLGAPSGTLVVADLQTKGRGSRGRSWETPQTDNIAMSLL 75

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIAS----------------------TLPVGTDVKIK 109
           +      + +++L+  + +++   I                                +IK
Sbjct: 76  IRPDAPPERISMLTLIMGLSIAEGIEDALVSARDAQLSRSTEVNIPGQIITECKYFPQIK 135

Query: 110 WPNDILVFQRKIAGILIE-TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGG 165
           WPNDI++  +KI GIL E  +N  N ++ VV+G+G+NV            +       G 
Sbjct: 136 WPNDIVIAGKKICGILTELHMNDDNTIRDVVIGVGINVNMTEFPEEIKDIAGSILTTTGV 195

Query: 166 CIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV 225
            +  +D+ +   +      + +  +     +   +         ++ +    G       
Sbjct: 196 ELAREDVIAFCMKRFEENYEKYSVNYDLTLLHEQYEVRLINRHKIVKVLDPKGEYEAVAH 255

Query: 226 GVDDFGYLLLEEKKGCVRQIFTGDI 250
           G++  G L++  + G   +I  G++
Sbjct: 256 GINSLGALIVSNEDGEEYEINAGEV 280


>gi|313608007|gb|EFR84107.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes FSL
           F2-208]
          Length = 325

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKNKASSLKLELGESISRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|86148788|ref|ZP_01067057.1| BirA bifunctional protein [Vibrio sp. MED222]
 gi|85833426|gb|EAQ51615.1| BirA bifunctional protein [Vibrio sp. MED222]
          Length = 321

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 100/241 (41%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  + +      +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  SLELIPIIGSTNQHLLERTNTLE-SGSVCIAEYQAAGRGRRGREWVSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +      G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGVAVVEALEEMGVEGIK--LKWPNDLYHNDKKLAGILVELSGQSG 196

Query: 134 GLQAVVVGIGLNVKHCPVD----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN+   P       P+       +G   D   +   L     + L  ++ 
Sbjct: 197 GAAHIVIGLGLNLSMDPTTSGIGQPWTSLKEVCDGKVPDRNQLAQALINAWDKSLVDYEL 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W  F   +G  + + +    I G   G+D+ G +LL+ + G +     G+
Sbjct: 257 KGMSN-FVERWNRFDNFLGRNVRLIIGPREIEGVVQGIDEQGAVLLKTENG-IESYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|296105270|ref|YP_003615416.1| biotin--protein ligase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059729|gb|ADF64467.1| biotin--protein ligase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 320

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 103/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   ++R    +      VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLERIGELE-SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAVGLSLVIGIVMAEVLHELG--ADKVRVKWPNDLYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G GLN+    V         T+LQ  G  ID   +   + +++   L L++++
Sbjct: 197 DAAQIVIGAGLNMVMRNVQSDVVNQAWTNLQEAGITIDRNTLAVRMIKELRTSLSLFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LASFLSRWEKLDNFINRPVKLLIGDKEIYGISRGIDAQGALLLEQ-DGVIKPWVGGEI 314


>gi|291615760|ref|YP_003518502.1| BirA [Pantoea ananatis LMG 20103]
 gi|291150790|gb|ADD75374.1| BirA [Pantoea ananatis LMG 20103]
 gi|327396025|dbj|BAK13447.1| BirA bifunctional protein BirA [Pantoea ananatis AJ13355]
          Length = 319

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 104/254 (40%), Gaps = 15/254 (5%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           +   LS+              I STN   ++R  S        +A  Q AGRGRR   W 
Sbjct: 72  ILGQLSQA------DIAVIPVIDSTNQYLLERMHSL-PSGSVCLAEYQQAGRGRRGRHWF 124

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S    NLY S+         +   LS  I + M   + S      DV++KWPNDI +  R
Sbjct: 125 SPFGANLYMSMYWRLEQGPAAAMGLSLVIGIIMAETLRSLGAQ--DVRVKWPNDIYLHDR 182

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLL 176
           K+AGIL+E          +V+G G+N+               +LQ  G  I+  ++ + L
Sbjct: 183 KLAGILVELTGKTGDAAQIVIGAGINLAMRTAEAAQINQGWINLQEAGVTINRNELAATL 242

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
              +   L +++++      +  W      I   + + +    + G   G+D+ G L LE
Sbjct: 243 INRLREALPVFEQEG-LTPFVTRWAELDNFINRPVKLLIGEREVHGIARGIDNQGGLQLE 301

Query: 237 EKKGCVRQIFTGDI 250
           +  G ++    G+I
Sbjct: 302 Q-DGKIQSWVGGEI 314


>gi|148642826|ref|YP_001273339.1| biotin-[acetyl-CoA-carboxylase] ligase/biotin operon regulator
           bifunctional protein, BirA [Methanobrevibacter smithii
           ATCC 35061]
 gi|222445057|ref|ZP_03607572.1| hypothetical protein METSMIALI_00674 [Methanobrevibacter smithii
           DSM 2375]
 gi|261350374|ref|ZP_05975791.1| biotin-[acetyl-CoA-carboxylase] ligase [Methanobrevibacter smithii
           DSM 2374]
 gi|148551843|gb|ABQ86971.1| biotin-[acetyl-CoA-carboxylase] ligase/biotin operon regulator
           bifunctional protein, BirA [Methanobrevibacter smithii
           ATCC 35061]
 gi|222434622|gb|EEE41787.1| hypothetical protein METSMIALI_00674 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861157|gb|EFC93455.1| biotin-[acetyl-CoA-carboxylase] ligase [Methanobrevibacter smithii
           DSM 2374]
          Length = 305

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 116/243 (47%), Gaps = 7/243 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
                 F+ + STN      +++G      +++  QT  RGR    W S  G ++ S++L
Sbjct: 61  GKDMYIFNEVMSTNTIAKFLSMNGVGNGAVVISEKQTKARGRSGKNWESPLGGVWLSIIL 120

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +++   + L++ A  VA+ + +        + +IKWPNDIL+  +K+ GIL E +   
Sbjct: 121 NPNVTHSKIPLITLATGVAVENTLKRIGI--ENAEIKWPNDILIQDKKVCGILTEAITSF 178

Query: 133 NGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           N +++V++G+G++      + P +    +T+L  E G    +++   LF +    +    
Sbjct: 179 NTIESVIIGVGIDANINTENFPQELQENMTTLNEEIGEKVDENLLIRLFLEEFEKISEQF 238

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +   E I+  WR  +  IG ++ +         G  +G+   G L++E+  G + ++ +
Sbjct: 239 INEEYETILKEWRKNSYTIGKIVEVHEPFSKPYDGYVLGISRDGSLVVEKIDGTLEKVIS 298

Query: 248 GDI 250
           G+ 
Sbjct: 299 GEC 301


>gi|217963944|ref|YP_002349622.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes
           HCC23]
 gi|217333214|gb|ACK39008.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes
           HCC23]
 gi|307571486|emb|CAR84665.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Listeria monocytogenes L99]
          Length = 325

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|156972596|ref|YP_001443503.1| biotin--protein ligase [Vibrio harveyi ATCC BAA-1116]
 gi|156524190|gb|ABU69276.1| hypothetical protein VIBHAR_00240 [Vibrio harveyi ATCC BAA-1116]
          Length = 321

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 98/240 (40%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            E    I STN   + R     +     +A  Q  GRGRR  +WIS    NLY S+    
Sbjct: 81  LELISVIDSTNQYLLDRVND-SVKGRVCLAEYQAKGRGRRGRQWISPFGTNLYLSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  + +A    I      G    +KWPNDI    +K+AGIL+E      G
Sbjct: 140 DAGMAAAMGLSLVVGIAAVEAIEELGIQGVK--LKWPNDIYYQDKKLAGILVEMSGQAGG 197

Query: 135 LQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+        +D P+   +   +G  ID  D+     +     L+ ++  
Sbjct: 198 AAHLVIGMGLNIGMPDLQPDIDQPWTTLNQVSDGFSIDRNDLALKFIKHWKMALEEYEMT 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      IG  + + +    + G   G+D  G ++LE + G +     G+I
Sbjct: 258 G-LAGFVERWNRLDNFIGRPVKLLMGPREVHGVVKGIDQQGGVVLETENG-LETYIGGEI 315


>gi|254977184|ref|ZP_05273656.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-66c26]
 gi|255316265|ref|ZP_05357848.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-76w55]
 gi|255518926|ref|ZP_05386602.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-97b34]
 gi|255652105|ref|ZP_05399007.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-37x79]
 gi|260685078|ref|YP_003216363.1| BirA bifunctional protein [Clostridium difficile CD196]
 gi|260688736|ref|YP_003219870.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile R20291]
 gi|306521839|ref|ZP_07408186.1| BirA bifunctional protein [includes: biotin operon repressor and
           biotin--[acetyl-CoA-carboxylase] synthetase [Clostridium
           difficile QCD-32g58]
 gi|260211241|emb|CBA66767.1| BirA bifunctional protein [Clostridium difficile CD196]
 gi|260214753|emb|CBE07449.1| BirA bifunctional protein [Clostridium difficile R20291]
          Length = 325

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 111/241 (46%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLL 71
               E  DTI STN+   + A++  +    I++  Q  G+GR   +W S     ++ S++
Sbjct: 80  GKNIEHLDTIDSTNEHAKRIAIN-SVDGTVILSEHQDMGKGRLGRRWDSKTHEGIWMSII 138

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   +       ++     ++   + +    G +  IKWPND+++  +KI GIL E    
Sbjct: 139 LKPDMEPFKAPFITLIAGASVTKALNNL---GANTLIKWPNDVILNGKKICGILTELSAE 195

Query: 132 KNGLQAVVVGIGLN--VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
                 VV+GIG+N  +     +     TSL +EG  +   DI   +  +  ++   +  
Sbjct: 196 IERTNYVVLGIGINVKIMDFEQEIADKATSLYKEGYMLSRVDIVRNVLTEFEKLYLDYTV 255

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           +  +E+ + + R ++  I   I +       L + + +++ G LL++   G +++I +G+
Sbjct: 256 NNSKEKTLKICRDYSAIIDKNIYVLKGDNRELVKCLDINEEGNLLVQRSDGSIKEIISGE 315

Query: 250 I 250
           +
Sbjct: 316 V 316


>gi|16767397|ref|NP_463012.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167995333|ref|ZP_02576423.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|197266060|ref|ZP_03166133.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|17865658|sp|P37416|BIRA_SALTY RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|6960333|gb|AAF33493.1| Salmonella typhimurium bifunctional protein (BIRA) (SW:P37416)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|16422700|gb|AAL22971.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|197239850|gb|EDY22471.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205326992|gb|EDZ13756.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261249248|emb|CBG27110.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267996440|gb|ACY91325.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160639|emb|CBW20170.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312915249|dbj|BAJ39223.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321223345|gb|EFX48412.1| Biotin-protein ligase / Biotin operon repressor [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323132478|gb|ADX19908.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332990961|gb|AEF09944.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 320

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|238765319|ref|ZP_04626245.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia kristensenii
           ATCC 33638]
 gi|238696446|gb|EEP89237.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia kristensenii
           ATCC 33638]
          Length = 312

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 96/245 (39%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 69  LPAG-QVAVLPVVDSTNQYLLDRISELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 126

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V  KWPND+ +  +K+AGIL+E 
Sbjct: 127 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLGAGQVRV--KWPNDLYLNDKKLAGILVEL 184

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T                ID   + + L  ++   + 
Sbjct: 185 TGKTGDAAQLVIGAGINLTMRESTTNVISQDWINLQETGVIIDRNKLTAELLSELRLAVV 244

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G V+  
Sbjct: 245 KFENEG-LSAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-NGNVKPY 302

Query: 246 FTGDI 250
             G+I
Sbjct: 303 IGGEI 307


>gi|238790606|ref|ZP_04634371.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia frederiksenii
           ATCC 33641]
 gi|238721275|gb|EEQ12950.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Yersinia frederiksenii
           ATCC 33641]
          Length = 289

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      + STN   + R           VA  Q AGRGRR  +W+S    NLY 
Sbjct: 46  LPTG-QVAVLPVVDSTNQYLLDRITELK-SGDACVAEYQQAGRGRRGRQWVSPFGANLYL 103

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + M  V+         V++KWPND+ +  +K+AGIL+E 
Sbjct: 104 SMFWRLEQGPAAAMGLSLVVGIVMAEVLHKLG--AEQVRVKWPNDLYLNDKKLAGILVEL 161

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+      T                ID   + + L  ++   + 
Sbjct: 162 TGKTGDAAQLVIGAGINLTMRESTTNVISQDWINLQEAGVIIDRNKLTAELLSELRLAVV 221

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ WR     +   + + +    I G   G+D  G LLLE+  G V+  
Sbjct: 222 KFENEG-LSAFISRWREMDNYLDRPVKLIIGNQEIFGIARGIDQQGALLLEQ-DGNVKPY 279

Query: 246 FTGDI 250
             G+I
Sbjct: 280 IGGEI 284


>gi|149914598|ref|ZP_01903128.1| Biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. AzwK-3b]
 gi|149811391|gb|EDM71226.1| Biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. AzwK-3b]
          Length = 256

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 111/251 (44%), Gaps = 9/251 (3%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL 66
           +   P          + STN E  + A  G  G  WI+A  QTA RGRR   W   KGN 
Sbjct: 8   DTTWPMGVGRRVLAEVDSTNAEAARLAP-GLSGPEWILALNQTAARGRRGRPWTHPKGNF 66

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
            A+L++  + S D + L SF  ++A+     +       + +KWPND+L+   K+AGIL+
Sbjct: 67  AATLVMRPTESPDQVALRSFVASLALFDAFVAATGQSGGLSLKWPNDVLLNGGKLAGILL 126

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDV 180
           E+   + GL    +GIG+N+   P           PV+ L   G  I  ++   LL    
Sbjct: 127 ESAGTREGLSYFAIGIGVNLAQAPGRDMVEAGALQPVSLLSEAGVTITPEEFLDLLAPAY 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           AR    +        I   W   A  +G  IT + S  +I G F  VD+ G L+L   + 
Sbjct: 187 ARYEAQFTTYG-FAPIRREWLARAAKLGQTITARTSRDAITGVFETVDEAGNLVLTTPQ- 244

Query: 241 CVRQIFTGDIF 251
               I   ++F
Sbjct: 245 TRHAIPAAEVF 255


>gi|254992072|ref|ZP_05274262.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes FSL
           J2-064]
          Length = 325

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|77463088|ref|YP_352592.1| putative biotin protein ligase [Rhodobacter sphaeroides 2.4.1]
 gi|77387506|gb|ABA78691.1| putative biotin protein ligase [Rhodobacter sphaeroides 2.4.1]
          Length = 242

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 73/241 (30%), Positives = 112/241 (46%), Gaps = 9/241 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
              D++ STN    + A S   G  WIVA+ QTAGRGRR   W S +GN Y + LL  + 
Sbjct: 4   HALDSVDSTNAVAARLASSL-SGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTHLLHPTE 62

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
            ++ + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L     +Q
Sbjct: 63  PREVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLGQGGRVQ 122

Query: 137 AVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            + +GIG+N+   P           PV+ L   G  +  +     L    AR  + + + 
Sbjct: 123 HLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARREESFTRL 182

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                    W   A  +G+ I  +  +    G F  VD  G L+L+   G V  I   ++
Sbjct: 183 G-FGPTREAWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTGSGRV-AIPAAEV 240

Query: 251 F 251
           F
Sbjct: 241 F 241


>gi|254827211|ref|ZP_05231898.1| birA [Listeria monocytogenes FSL N3-165]
 gi|258599594|gb|EEW12919.1| birA [Listeria monocytogenes FSL N3-165]
          Length = 325

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  ++++ST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEVHESVNSTQIIAHQQIET-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGENVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|323498809|ref|ZP_08103795.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Vibrio sinaloensis DSM 21326]
 gi|323316171|gb|EGA69196.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Vibrio sinaloensis DSM 21326]
          Length = 320

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 104/244 (42%), Gaps = 10/244 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           +    E    I STN   + +  S +      +A  Q+AGRGRR  +W+S    NLY S+
Sbjct: 76  FDRLVELIPVIDSTNQYLLNKVDSLEC-GAVCLAEYQSAGRGRRGREWVSPFGANLYMSM 134

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  + VA+   +      G    +KWPND+    RK+AGIL+E   
Sbjct: 135 FWRLDAGMAAAMGLSLVVGVAVVEALEELGMHGVK--LKWPNDLYYQDRKLAGILVEMSG 192

Query: 131 LKNGLQAVVVGIGLNVKHCPV----DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
              G  ++V+G+G+N+           P+   +       +D   +   L + + + L  
Sbjct: 193 QAGGAASLVIGMGMNLMMPERVDGITQPWASLNEVARPHNLDRNQLAITLIKTLHQALSD 252

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++    +   +  W      +G  I + +    I G   G+++ G +LLE ++G +    
Sbjct: 253 YELKGMQG-FVERWNRLDNFLGRPIKLIIGPREISGLCRGINEQGAVLLETERG-IESFI 310

Query: 247 TGDI 250
            G+I
Sbjct: 311 GGEI 314


>gi|320155001|ref|YP_004187380.1| biotin-protein ligase/Biotin operon repressor [Vibrio vulnificus
           MO6-24/O]
 gi|319930313|gb|ADV85177.1| biotin-protein ligase / biotin operon repressor [Vibrio vulnificus
           MO6-24/O]
          Length = 322

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 93/241 (38%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  +        +A  Q+ GRGRR  +W S    NLY S+   
Sbjct: 80  NVELIPVIDSTNQYLLERIENLQT-GHVCLAEYQSQGRGRRGRQWFSPFGSNLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + +A    + +    G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGIAAVEALETLGVQGVK--LKWPNDVYYQDKKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN++                        D  ++   L       L  +++
Sbjct: 197 GAAHLVIGMGLNIQMQADCHSIDQPWTALSQIESGARLDRTELALTLMAKWREALSEYEQ 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W       G  + + +    I G   G+D  G ++L+  +G ++    G+
Sbjct: 257 CG-LNGFIERWNRLDNFKGRQVKLLIGPREIHGEVQGIDSQGGVILKTVEG-IQTFVGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|148982169|ref|ZP_01816617.1| biotin--protein ligase [Vibrionales bacterium SWAT-3]
 gi|145960641|gb|EDK25989.1| biotin--protein ligase [Vibrionales bacterium SWAT-3]
          Length = 321

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/253 (24%), Positives = 102/253 (40%), Gaps = 12/253 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
             LS   +  +   E    I STN   + R    +      VA  Q +GRGRR  +W+S 
Sbjct: 70  ERLSAANS--NASLELIPIIGSTNQHLLDRTNELE-SGSVCVAEYQASGRGRRGREWVSP 126

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY S+         +   LS  + VA+   +      G    +KWPND+    +K+
Sbjct: 127 FGANLYLSMYWRLDAGMAAAMGLSLVVGVAVVEALEEMGVEGVK--LKWPNDLYHNDKKL 184

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLF 177
           AGIL+E      G   +V+G+GLN+   P    +  P+       +G   D   +   L 
Sbjct: 185 AGILVELSGQSGGAAHIVIGLGLNLSMDPATSGIGQPWTSLKEVCDGQVPDRNQLAQTLI 244

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
               + L  ++        +  W      +G  + + +    I G   G+D+ G +LL+ 
Sbjct: 245 NAWDKALVDYEMKGMSN-FVERWNRLDNFLGRNVKLIIGPREIEGVVQGIDEQGAVLLKT 303

Query: 238 KKGCVRQIFTGDI 250
           + G +     G+I
Sbjct: 304 ENG-IESYIGGEI 315


>gi|114798329|ref|YP_760463.1| biotin--acetyl-CoA-carboxylase ligase [Hyphomonas neptunium ATCC
           15444]
 gi|114738503|gb|ABI76628.1| biotin--acetyl-CoA-carboxylase ligase [Hyphomonas neptunium ATCC
           15444]
          Length = 255

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 114/239 (47%), Gaps = 5/239 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           S+    F+ I STN E  +RA  G   N WIVAS QTAGRGR+D  W S  GN++ + L 
Sbjct: 15  SWPLYRFEEIDSTNTEAKRRAAEGSFNNQWIVASTQTAGRGRQDRAWSSPVGNIFTTALF 74

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
            +         + FA A+A+   + S  P    V++KWPND+ V  +K++GIL+ET    
Sbjct: 75  AEPGGISVALRVPFAAALAVVDTVLSVAP-AAPVRVKWPNDVRVDHQKVSGILVETGGAG 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDT 191
           + L  +  G G+NV + P +     TSL R    + DLK++           L       
Sbjct: 134 DRLW-IAAGTGINVAYAPDNVGQGATSLNRLSAQVLDLKEVLDFYHSAFEARLAQ--AKV 190

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             + +   W  +A G  + +++++      G F  ++  G L L    G  R I  G++
Sbjct: 191 TFDGVRKDWLKYAEGRNEKVSVRVGDTYEEGVFEDLEQDGALRLRLPDGSARIIRAGEV 249


>gi|168468123|ref|ZP_02701960.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195628795|gb|EDX48225.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 320

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|110668802|ref|YP_658613.1| biotin--[acetyl-CoA-carboxylase] ligase [Haloquadratum walsbyi DSM
           16790]
 gi|109626549|emb|CAJ53012.1| biotin--[acetyl-CoA-carboxylase] ligase [Haloquadratum walsbyi DSM
           16790]
          Length = 324

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 79/249 (31%), Positives = 116/249 (46%), Gaps = 19/249 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS-LL 71
           S+R E+ D   STND   + A  G   ++ +VA  QT GRGR D +W S  G ++ S LL
Sbjct: 76  SYRIEYADQYESTNDRARELAKMGTTDDVAVVADAQTGGRGRLDRQWSSPSGGIWVSLLL 135

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----------RKI 121
           L    S   L + +FA AVA+   +      G DV IKWPND+L+ +          RKI
Sbjct: 136 LHPHCSPAELPVYTFAAAVAVVRAVQQ---CGIDVNIKWPNDVLLSRDTPEINPSDGRKI 192

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           AGIL ET    + +  ++VGIGLN        P   TSLQ   G +D + +     Q + 
Sbjct: 193 AGILTETAGEADQVSWLIVGIGLNANVDSTALPPEATSLQSVIGAVDRRALL----QRLL 248

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
                       + I++ WR  +  +   + I     +I G  V +   G L+++   G 
Sbjct: 249 NSFAELTNPIDLDNIIDAWRTHSTTLNQRVRITTPRETIEGVAVDIQTPGALIVQTNNG- 307

Query: 242 VRQIFTGDI 250
           ++ I  GD 
Sbjct: 308 IKTIHAGDC 316


>gi|16762310|ref|NP_457927.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29143798|ref|NP_807140.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56415970|ref|YP_153045.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161617278|ref|YP_001591243.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167554330|ref|ZP_02348071.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168234507|ref|ZP_02659565.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239819|ref|ZP_02664877.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168245297|ref|ZP_02670229.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168262954|ref|ZP_02684927.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168823315|ref|ZP_02835315.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194443558|ref|YP_002043395.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194449709|ref|YP_002048130.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194471545|ref|ZP_03077529.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734870|ref|YP_002117046.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197251475|ref|YP_002149054.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197364897|ref|YP_002144534.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198245209|ref|YP_002218061.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|205354453|ref|YP_002228254.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207859322|ref|YP_002245973.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213163737|ref|ZP_03349447.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213428735|ref|ZP_03361485.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213580233|ref|ZP_03362059.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213612440|ref|ZP_03370266.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213649752|ref|ZP_03379805.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213854978|ref|ZP_03383218.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|238913976|ref|ZP_04657813.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289824156|ref|ZP_06543751.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|25293808|pir||AG0934 bifunctional protein, biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16504614|emb|CAD09497.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29139433|gb|AAO71000.1| biotin operon repressor [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130227|gb|AAV79733.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|161366642|gb|ABX70410.1| hypothetical protein SPAB_05125 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402221|gb|ACF62443.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408013|gb|ACF68232.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194457909|gb|EDX46748.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710372|gb|ACF89593.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197096374|emb|CAR61979.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197215178|gb|ACH52575.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197287551|gb|EDY26944.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939725|gb|ACH77058.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205274234|emb|CAR39253.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205321454|gb|EDZ09293.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205331585|gb|EDZ18349.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205335978|gb|EDZ22742.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340454|gb|EDZ27218.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348231|gb|EDZ34862.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206711125|emb|CAR35499.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|320088538|emb|CBY98296.1| biotin [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|326625854|gb|EGE32199.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326629586|gb|EGE35929.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 320

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|37681353|ref|NP_935962.1| biotin--protein ligase [Vibrio vulnificus YJ016]
 gi|37200105|dbj|BAC95933.1| biotin-(acetyl-CoA carboxylase) ligase [Vibrio vulnificus YJ016]
          Length = 322

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 93/241 (38%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  +        +A  Q+ GRGRR  +W S    NLY S+   
Sbjct: 80  SVELIPVIDSTNQYLLERIENLQT-GHVCLAEYQSQGRGRRGRQWFSPFGSNLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + +A    + +    G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGIAAVEALETLGVQGVK--LKWPNDVYYQDKKLAGILVEMTGQAG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI----DLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN++                        D  ++   L       L  +++
Sbjct: 197 GAAHLVIGMGLNMQMQADCHSIDQPWTALSQIESGARLDRTELALTLMAKWREALSEYEQ 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W       G  + + +    I G   G+D  G ++L+  +G ++    G+
Sbjct: 257 CG-LNGFIERWNRLDNFKGRQVKLLIGPREIHGEVQGIDSQGGVILKTVEG-IQTFVGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|313637212|gb|EFS02728.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria seeligeri FSL
           S4-171]
          Length = 326

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  D+++ST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHDSVTSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG---CIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +      +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGVVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|189219642|ref|YP_001940283.1| Biotin-(acetyl-CoA carboxylase) ligase [Methylacidiphilum
           infernorum V4]
 gi|189186500|gb|ACD83685.1| Biotin-(acetyl-CoA carboxylase) ligase [Methylacidiphilum
           infernorum V4]
          Length = 333

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           L +      +R + F  I ST+DE ++R   G+   L ++A  Q  GRGR+   W S   
Sbjct: 89  LEKLNCRIPWRVKIFQVIDSTSDEVLRRGRRGEKEGLVVIAERQLRGRGRQGRSWESSLA 148

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
             LY +LLL  S         +   +VA+   + +      +V IKWPNDI+V  RK+ G
Sbjct: 149 LGLYMTLLLEPSFQPLLPQQFALMSSVAVVEALNNL--GLENVGIKWPNDIVVDSRKLGG 206

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQ 178
           ILIET    N  + + +GIG+NV    +    P+ +         G  +   ++ + + +
Sbjct: 207 ILIETDRGINSKRFIAIGIGINVNQAEIHFSGPLQNKATSIYMERGQPMRRVELMAEVLK 266

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
            + R   L        EI   W          +  +     I G   G+D+ G+L++E++
Sbjct: 267 RIDRNYGL-----SFFEIKEKWMKKMVNRDREVEFEEDGQRIKGIIRGIDEMGWLVVEKE 321

Query: 239 KGCVRQIFT 247
            G +++ F+
Sbjct: 322 NGSIQKFFS 330


>gi|200387950|ref|ZP_03214562.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199605048|gb|EDZ03593.1| biotin-[acetyl-CoA-carboxylase] ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 320

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|57640922|ref|YP_183400.1| biotin--protein ligase [Thermococcus kodakarensis KOD1]
 gi|57159246|dbj|BAD85176.1| biotin-protein ligase [Thermococcus kodakarensis KOD1]
          Length = 232

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 106/239 (44%), Gaps = 17/239 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +     D + STN+   K           +VA  QT+GRGR+   W S +G L+ S++L 
Sbjct: 3   WNVIRLDEVDSTNEYAKKLIPD-VSEGTVVVAKRQTSGRGRKGRAWASPEGGLWMSVILK 61

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                     L F  A+A+   +      G    IKWPND+ V  RKI+G+L E      
Sbjct: 62  P---PMIDPRLVFVGALAVSDTLRDF---GIGAWIKWPNDVWVGNRKISGVLTEVKGD-- 113

Query: 134 GLQAVVVGIGLNVKHCPVD--TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
               V++G+GLNV +   D       + ++  G  +D+ ++   L + + R    + ++ 
Sbjct: 114 ---FVIMGVGLNVNNEIPDGLKETATSMMEALGEPVDIGEVLERLLEYLGRWYKTFLENP 170

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               ++   R     IG  + + L    ++GR + + D G L+L +  G   ++  GD+
Sbjct: 171 PL--VVEEVRGRTMLIGKEVRVLLDGNDLVGRVITISDDGSLIL-DVDGQTVKVVYGDV 226


>gi|89053688|ref|YP_509139.1| biotin--acetyl-CoA-carboxylase ligase [Jannaschia sp. CCS1]
 gi|88863237|gb|ABD54114.1| Biotin--acetyl-CoA-carboxylase ligase [Jannaschia sp. CCS1]
          Length = 251

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 75/249 (30%), Positives = 113/249 (45%), Gaps = 12/249 (4%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
             P         T  ST  E  + A +   G  W++A  QTA RGRR   W+   GN  A
Sbjct: 8   AWPLGVSRRVLATTDSTMLEAARAAPTL-TGPEWVLALHQTAARGRRGRAWVMPSGNFAA 66

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           SL L  S     + L SFA A A+R  + +      DV +KWPND+L+   K+AGIL+E+
Sbjct: 67  SLTLQPSGPLAQIALRSFAAATALRDALIAVGCPPGDVSLKWPNDVLLRGGKVAGILLES 126

Query: 129 LNL-KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR-----EGGCIDLKDIFSLLFQDVAR 182
           +   + G+  +++GIG+N+ H P  +     ++       +    D  D  +  F     
Sbjct: 127 IGDGRGGVSHLIIGIGVNLAHAPDPSEVEARAVTPVALGLDVTPEDFLDALAPAFASREY 186

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L  +    G +     W   A  + ++IT +L    I G F  +D+ G L+LE   G  
Sbjct: 187 SLATY----GFDPTRTEWLAHAARLEEVITARLPGEEITGTFRTIDETGNLILETAHGP- 241

Query: 243 RQIFTGDIF 251
           R I   DI+
Sbjct: 242 RAIAAADIY 250


>gi|313111435|ref|ZP_07797238.1| BirA protein [Pseudomonas aeruginosa 39016]
 gi|310883740|gb|EFQ42334.1| BirA protein [Pseudomonas aeruginosa 39016]
          Length = 312

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 110/239 (46%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +  E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S    NLY SL +
Sbjct: 71  WPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAI 130

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + S      D  +KWPND+L   +KIAGIL+E     
Sbjct: 131 TVRGGARELEGLSLVVGLAVLRALESLGVR--DAGLKWPNDVLQGGKKIAGILLELSGDP 188

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             L  VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++
Sbjct: 189 ADLCHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSRE 248

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  + +  +  SI GR +GVD  G L LE   G  +    G+
Sbjct: 249 G-FAASREEWESCNLWQGAQVILSTALSSIEGRVLGVDSRGALRLE-VDGVEQGFSGGE 305


>gi|218710889|ref|YP_002418510.1| biotin--protein ligase [Vibrio splendidus LGP32]
 gi|218323908|emb|CAV20269.1| BirA bifunctional protein [Vibrio splendidus LGP32]
          Length = 321

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 99/241 (41%), Gaps = 10/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
             E    I STN   ++R  +        +A  Q AGRGRR  +W+S    NLY S+   
Sbjct: 80  SLELIPIIGSTNQHLLER-TNILESGSVCIAEYQAAGRGRRGREWVSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + VA+   +      G    +KWPND+    +K+AGIL+E      
Sbjct: 139 LDAGMAAAMGLSLVVGVAVVEALEEMGVEGIK--LKWPNDLYHNDKKLAGILVELSGQSG 196

Query: 134 GLQAVVVGIGLNVKHCPVD----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           G   +V+G+GLN+   P       P+       +G   D   +   L     + L  ++ 
Sbjct: 197 GAAHIVIGLGLNLSMDPTTSGIGQPWTSLKEVCDGKVPDRNQLAQALINAWDKSLVDYEL 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                  +  W  F   +G  + + +    I G   G+D+ G +LL+ + G +     G+
Sbjct: 257 KGMSN-FVERWNRFDNFLGRNVRLIIGPREIEGVVQGIDEQGAVLLKTENG-IESYIGGE 314

Query: 250 I 250
           I
Sbjct: 315 I 315


>gi|40063405|gb|AAR38216.1| birA bifunctional protein [uncultured marine bacterium 580]
          Length = 329

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLL 72
           F  +  D+I STN+   K A +G      + A+ Q  G+GRR  +W S    +L  S L 
Sbjct: 81  FDIKVLDSIDSTNNYLSKIAATGHPHASVVAANIQMQGKGRRGRQWQSALGESLTFSFLW 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIET 128
             +     L+ LS A+ VA+   +           +KWPNDIL+F     +K+AGILIE 
Sbjct: 141 RFTKGAAGLSGLSLAVGVALIRALKKINIST--ALLKWPNDILIFDEGVYKKLAGILIEL 198

Query: 129 LNLKNGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
               +G  A ++GIGLN+                        ID     +++ +++A+ L
Sbjct: 199 QGDTDGQSAAIIGIGLNLNLSKTQLEKIDQPATDINNLVSEKIDSNFFMAIIIKELAQAL 258

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSY-GSILGRFVGVDDFGYLLLEEKKGCVR 243
             ++     +   + W  +      LI I L    +I G+ + + D G L++   +G  +
Sbjct: 259 ASFE-SDQFKPFKDEWLSYHAFQDKLIDIMLGNSQTITGKAIDISDTGALIVRTDEGS-K 316

Query: 244 QIFTGDI 250
              +G++
Sbjct: 317 SFASGEV 323


>gi|148545722|ref|YP_001265824.1| biotin--protein ligase [Pseudomonas putida F1]
 gi|148509780|gb|ABQ76640.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas putida F1]
          Length = 319

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 70/239 (29%), Positives = 107/239 (44%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L
Sbjct: 76  WPVFIHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + +      DV +KWPND+LV  +KI GIL+E +   
Sbjct: 136 RVDGGMRQLEGLSLVVGLAVMRTLQAF--GVKDVGLKWPNDVLVRGQKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+GIG+NV     +       +  +  G  ID   + +LL Q +   L   ++ 
Sbjct: 194 ADVCHVVLGIGINVNMQVNEQVDQQWTSMRREVGAAIDRNHLVALLSQQLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      I G  +GVD  G L LE   G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE-VDGMEKSFSGGE 310


>gi|253991697|ref|YP_003043053.1| biotin--protein ligase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253783147|emb|CAQ86312.1| bifunctional protein [includes: biotin operon repressor; biotin
           [acetyl-coa-carboxylase] synthetase (biotin-protein
           ligase)] [Photorhabdus asymbiotica]
          Length = 319

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   R      I STN   ++R           VA  Q AGRGRR  KW+S    NLY 
Sbjct: 76  LPEG-RIAVLPVIDSTNQYLLERLSELK-SGDACVAEYQYAGRGRRGRKWVSPFGKNLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  + + +  V+         V  KWPND+ +  +K+AGIL+E 
Sbjct: 134 SMYWRLEQGPAAAIGLSLVVGIIIAEVLHRLGADRIKV--KWPNDLYLDDKKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +        VV+G G+N+     D         +LQ+ G  +D   +   +  ++ + L 
Sbjct: 192 MGKTGDAAQVVIGAGINIAMDHKDKESINQQWINLQQAGIEVDRNKLVVEIVLELRKALI 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++ +      ++ W      +   + + +    + G   G++  G LLL ++ G +   
Sbjct: 252 QFENEG-LSSFVSRWFELDNFMDRPVKLIIGNQEVYGIAKGINQQGALLL-DQDGAITPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|26987178|ref|NP_742603.1| biotin--protein ligase [Pseudomonas putida KT2440]
 gi|24981814|gb|AAN66067.1|AE016236_1 birA bifunctional protein [Pseudomonas putida KT2440]
          Length = 319

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 70/239 (29%), Positives = 107/239 (44%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L
Sbjct: 76  WPVFIHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + +      DV +KWPND+LV  +KI GIL+E +   
Sbjct: 136 RVDGGMRQLEGLSLVVGLAVMRTLQAF--GVKDVGLKWPNDVLVRGQKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+GIG+NV     +       +  +  G  ID   + +LL Q +   L   ++ 
Sbjct: 194 ADVCHVVLGIGINVNMQVNEQVDQQWTSMRREVGAAIDRNHLVALLSQQLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      I G  +GVD  G L LE   G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE-VDGMEKSFSGGE 310


>gi|292486717|ref|YP_003529587.1| biotin-protein ligase [Erwinia amylovora CFBP1430]
 gi|292897951|ref|YP_003537320.1| bifunctional protein BirA [Erwinia amylovora ATCC 49946]
 gi|291197799|emb|CBJ44894.1| bifunctional protein BirA [includes: biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase] [Erwinia
           amylovora ATCC 49946]
 gi|291552134|emb|CBA19171.1| biotin-protein ligase [Erwinia amylovora CFBP1430]
 gi|312170783|emb|CBX79044.1| biotin-protein ligase [Erwinia amylovora ATCC BAA-2158]
          Length = 320

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   M R  S        VA  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  RLTVIPVIDSTNQYLMDRMASLQ-SGDACVAEYQQAGRGRRGRQWFSPFGSNLYLSMYWH 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +   +        D+++KWPNDI +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVIAEALQQ--QGAPDIRVKWPNDIYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+        +      +L   G  +D   + +L+   +   L  +++D
Sbjct: 197 DAAQIVIGAGINLAMRDPAQDEINQGWINLHEAGCNVDRNALSALIVNKMRTALAQFEQD 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I+G   G+D  G L+LE+  G  +    G+I
Sbjct: 257 G-LTPFIQRWAALDNFINRPVKLLIGDREIVGIARGIDQQGGLMLEQ-DGVTKSWVGGEI 314


>gi|218889392|ref|YP_002438256.1| biotin--protein ligase [Pseudomonas aeruginosa LESB58]
 gi|254242922|ref|ZP_04936244.1| hypothetical protein PA2G_03707 [Pseudomonas aeruginosa 2192]
 gi|126196300|gb|EAZ60363.1| hypothetical protein PA2G_03707 [Pseudomonas aeruginosa 2192]
 gi|218769615|emb|CAW25375.1| BirA bifunctional protein [Pseudomonas aeruginosa LESB58]
          Length = 312

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 110/239 (46%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +  E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S    NLY SL +
Sbjct: 71  WPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAI 130

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + S      D  +KWPND+L   +KIAGIL+E     
Sbjct: 131 TVRGGARELEGLSLVVGLAVLRALESLGVR--DAGLKWPNDLLQGGKKIAGILLELSGDP 188

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             L  VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++
Sbjct: 189 ADLCHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSRE 248

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  + +  +  SI GR +GVD  G L LE   G  +    G+
Sbjct: 249 G-FAASREEWESCNLWQGAQVILSTALSSIEGRVLGVDSRGALRLE-VDGVEQGFSGGE 305


>gi|221638944|ref|YP_002525206.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           KD131]
 gi|221159725|gb|ACM00705.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           KD131]
          Length = 242

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 73/241 (30%), Positives = 111/241 (46%), Gaps = 9/241 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
              D++ STN    + A S   G  WIVA+ QTAGRGRR   W S +GN Y + LL  + 
Sbjct: 4   HALDSVDSTNAVAARLASSL-SGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTHLLHPAE 62

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L     +Q
Sbjct: 63  LPEVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLGQGGRVQ 122

Query: 137 AVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            + +GIG+N+   P           PV+ L   G  +  +     L    AR  + + + 
Sbjct: 123 HLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARREESFTRL 182

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                    W   A  +G+ I  +  +    G F  VD  G L+L+   G V  I   ++
Sbjct: 183 G-FGPTRETWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTGSGRV-AIPAAEV 240

Query: 251 F 251
           F
Sbjct: 241 F 241


>gi|330505224|ref|YP_004382093.1| biotin--protein ligase [Pseudomonas mendocina NK-01]
 gi|328919510|gb|AEB60341.1| biotin--protein ligase [Pseudomonas mendocina NK-01]
          Length = 321

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 68/251 (27%), Positives = 108/251 (43%), Gaps = 7/251 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
             +S+      +      ++ STN E  +R  +G+     ++A  QTAGRGRR   W S 
Sbjct: 65  ERISQGALGSGWPVAVEPSVDSTNAEIFRRLEAGERAPFVLLAERQTAGRGRRGRVWASP 124

Query: 63  K-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY S++L        +  LS  + +A+   + S    G  V++KWPND+LV  RKI
Sbjct: 125 FAENLYCSVVLRVDGGMSQVEALSLTVGLAVAKTLQSLGLNG--VQLKWPNDVLVDGRKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           +GIL+E       +  VV+GIG+NV      P     P  S+++  G +  ++  +    
Sbjct: 183 SGILLELAGDPADVCHVVIGIGINVNMANDAPGAIDQPWASVRQCVGRMLDRNDLAAELL 242

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
              R         G   +   W       G  + +     + LG  +GVD+ G + L   
Sbjct: 243 LQLRDCLSMHWQHGFAGLREEWEALHAWRGRSVALTAGNNATLGVVLGVDERGAVRL-NV 301

Query: 239 KGCVRQIFTGD 249
            G  R    G+
Sbjct: 302 DGVDRAFSGGE 312


>gi|154151330|ref|YP_001404948.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Methanoregula
           boonei 6A8]
 gi|153999882|gb|ABS56305.1| biotin--acetyl-CoA-carboxylase ligase [Methanoregula boonei 6A8]
          Length = 326

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 105/247 (42%), Gaps = 11/247 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL---GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
             +  + +   ST     +    GD+     + I+A  QT G GR    W+S  G ++ +
Sbjct: 81  GKKMRYLENTPSTIWAGKQLCAEGDVEKMHGMVIIAEEQTGGVGRMGRAWVSPSGGIWVT 140

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++L   I  D + +++ A +VA+   I           IKWPNDI +  +K+AG+L+E  
Sbjct: 141 VVLKPHIPIDHVFMITMAGSVAVARAIRK--EFSLSALIKWPNDIFIGNKKVAGLLLELA 198

Query: 130 NLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              + +   ++G+G++         P       +     G  +D     + + ++     
Sbjct: 199 AESDTVHYCLLGMGIDANISLAQFAPGLRDLITSISAELGHEVDRAAFLARVLKEFESQY 258

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            L +       I   W+  +C +   + I+    S  G  V +D+FG L++ +  G + +
Sbjct: 259 LLVESGEYDTIIRE-WKSLSCTLEHRVDIRTLKNSFSGEAVDIDEFGALIIRKDNGKLER 317

Query: 245 IFTGDIF 251
           +  GD F
Sbjct: 318 VIAGDCF 324


>gi|315501897|ref|YP_004080784.1| biotin/acetyl-CoA-carboxylase ligase [Micromonospora sp. L5]
 gi|315408516|gb|ADU06633.1| biotin/acetyl-CoA-carboxylase ligase [Micromonospora sp. L5]
          Length = 290

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 70/268 (26%), Positives = 104/268 (38%), Gaps = 26/268 (9%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDK 63
           L     P+  R E      STN + +  A +G+   L +VA  QTAGRGRR   W    +
Sbjct: 23  LVAPHGPW-RRLELLAETGSTNADVVAAARAGEPEGLVVVAERQTAGRGRRGRVWQSPPR 81

Query: 64  GNLYASLLLIDSISKDSLTLLSFA----------IAVAMRSVIASTLPVGTDVKIKWPND 113
             L  S+LL    +                      VA+   +        D ++KWPND
Sbjct: 82  AGLATSVLLRPGEAVAERGWSPVPTTGYGWLPLLAGVALAEAVRLLAE--LDARLKWPND 139

Query: 114 ILVFQRKIAGILIETL-NLKNGLQAVVVGIGLNVKHCPVDTPYPVTS------LQREGGC 166
           +LV   K AG+L E +    +   A+VVG+GLNV     + P   T              
Sbjct: 140 LLVDGAKCAGVLAEAVPGENDRPPAIVVGVGLNVTLRADELPENPTGLPATSLQLAGATA 199

Query: 167 IDLKDIFSLLFQDVARVLDLWKKDTGREEI---MNLWRCFACGIGDLITIKLSYG-SILG 222
            D   +   L + +A   + W+   G  E       +      +G  + + L  G  + G
Sbjct: 200 TDRDPLLRALLRSLADWYERWRDAGGDAEASGLREAYLAGCATVGRQVRVLLPDGREVHG 259

Query: 223 RFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              GVD  G LL+E     +R +  GD+
Sbjct: 260 TATGVDADGQLLVETGAETLR-LAAGDV 286


>gi|255027109|ref|ZP_05299095.1| hypothetical protein LmonocytFSL_13668 [Listeria monocytogenes FSL
           J2-003]
          Length = 325

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  ++++ST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEVHESVNSTQIIAHQQIET-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|304399348|ref|ZP_07381209.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. aB]
 gi|304353121|gb|EFM17507.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. aB]
          Length = 319

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/240 (25%), Positives = 102/240 (42%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   ++R    +      +A  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  NISVIPVIDSTNQYLLERMHEME-SGAACIAEYQQAGRGRRGRQWFSPFGANLYMSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +   + S      DV++KWPNDI +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIIIAETLRSLG--ADDVRVKWPNDIYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  ++  ++ + L  ++   L L++++
Sbjct: 197 DAAHIVMGAGINLAMRTADASQINQGWINLQEAGVSVNRNELAAHLINNLREALPLFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    + G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LTPFVTRWMVLDNFIHRPVKLLIGEREVHGIARGIDSQGGLLLEQ-DGEIKAWVGGEI 314


>gi|49085164|gb|AAT51257.1| PA4280 [synthetic construct]
          Length = 313

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 110/239 (46%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +  E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S    NLY SL +
Sbjct: 71  WPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAI 130

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + S      D  +KWPND+L   +KIAGIL+E     
Sbjct: 131 TVRGGARELEGLSLVVGLAVLRALESLGVQ--DTGLKWPNDLLQGGKKIAGILLELSGDP 188

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             L  VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++
Sbjct: 189 ADLCHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSRE 248

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  + +  +  SI GR +GVD  G L LE   G  +    G+
Sbjct: 249 G-FAASREEWESCNLWQGAQVILSTALSSIEGRVLGVDSRGALRLE-VDGVEQGFSGGE 305


>gi|15599476|ref|NP_252970.1| biotin--protein ligase [Pseudomonas aeruginosa PAO1]
 gi|9950499|gb|AAG07668.1|AE004843_10 BirA bifunctional protein [Pseudomonas aeruginosa PAO1]
          Length = 312

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 110/239 (46%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +  E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S    NLY SL +
Sbjct: 71  WPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAI 130

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + S      D  +KWPND+L   +KIAGIL+E     
Sbjct: 131 TVRGGARELEGLSLVVGLAVLRALESLGVQ--DTGLKWPNDLLQGGKKIAGILLELSGDP 188

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             L  VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++
Sbjct: 189 ADLCHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSRE 248

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  + +  +  SI GR +GVD  G L LE   G  +    G+
Sbjct: 249 G-FAASREEWESCNLWQGAQVILSTALSSIEGRVLGVDSRGALRLE-VDGVEQGFSGGE 305


>gi|46908137|ref|YP_014526.1| birA bifunctional protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47094229|ref|ZP_00231941.1| BirA bifunctional protein [Listeria monocytogenes str. 4b H7858]
 gi|226224508|ref|YP_002758615.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes Clip81459]
 gi|254825601|ref|ZP_05230602.1| birA [Listeria monocytogenes FSL J1-194]
 gi|254852808|ref|ZP_05242156.1| birA [Listeria monocytogenes FSL R2-503]
 gi|254931925|ref|ZP_05265284.1| birA [Listeria monocytogenes HPB2262]
 gi|255520918|ref|ZP_05388155.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes FSL J1-175]
 gi|300763786|ref|ZP_07073783.1| BirA bifunctional protein [Listeria monocytogenes FSL N1-017]
 gi|46881407|gb|AAT04703.1| birA bifunctional protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017401|gb|EAL08222.1| BirA bifunctional protein [Listeria monocytogenes str. 4b H7858]
 gi|225876970|emb|CAS05679.1| Putative transcriptional regulator and biotin
           acetyl-CoA-carboxylase synthetase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258606135|gb|EEW18743.1| birA [Listeria monocytogenes FSL R2-503]
 gi|293583477|gb|EFF95509.1| birA [Listeria monocytogenes HPB2262]
 gi|293594844|gb|EFG02605.1| birA [Listeria monocytogenes FSL J1-194]
 gi|300515522|gb|EFK42572.1| BirA bifunctional protein [Listeria monocytogenes FSL N1-017]
 gi|328466254|gb|EGF37411.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes 1816]
 gi|332312345|gb|EGJ25440.1| BirA bifunctional protein [Listeria monocytogenes str. Scott A]
          Length = 325

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIES-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I ++     + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENSTK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|269968146|ref|ZP_06182180.1| biotin--protein ligase [Vibrio alginolyticus 40B]
 gi|269827242|gb|EEZ81542.1| biotin--protein ligase [Vibrio alginolyticus 40B]
          Length = 321

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 95/240 (39%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            E    I STN   + R    +      +A  Q  GRGRR  +W+S    NLY S+    
Sbjct: 81  VELVPVIDSTNQYLLDRVADSEK-GRVCIAEYQAQGRGRRGRQWVSPFGSNLYLSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  I +A    +      G    +KWPND+    +K+AGIL+E      G
Sbjct: 140 DAGMAAAMGLSLVIGIAAVEALEEVGIQGVK--LKWPNDLYYQDKKLAGILVEMSGQAGG 197

Query: 135 LQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+        +D P+   +   +   ID   +   L +     L  ++  
Sbjct: 198 AAHLVIGMGLNIGMPDDQPEIDQPWTTLNQVNQSLKIDRNVLAMTLIKHWNSALVEYEMK 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      +   + + +    + G   G+D  G +L+E  +G +     G+I
Sbjct: 258 G-LTGFIERWNRLDNFLNRQVKLLIGPREVHGVVRGIDHQGGILIETSQG-LETYIGGEI 315


>gi|62182596|ref|YP_219013.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224585685|ref|YP_002639484.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|62130229|gb|AAX67932.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase/biotin operon
           transcriptional repressor (BirA family) [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|224470213|gb|ACN48043.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322717093|gb|EFZ08664.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 320

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELGAD--KVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L   +   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEDVINQAWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W+     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLSRWKKLDNFIDRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|144900800|emb|CAM77664.1| Biotin-(acetyl-CoA carboxylase) ligase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 248

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 112/247 (45%), Gaps = 10/247 (4%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNL 66
            + P  F     D++ STNDE  + A SG   +  +V A  Q+AGRGRR   W+S  GNL
Sbjct: 4   ARLPAPFGLISLDSVGSTNDEARRLAQSGAAADFLVVSAESQSAGRGRRGRAWVSPAGNL 63

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + SLL+       +  L   A A  + ++             KWPND++   RK AG+L+
Sbjct: 64  HFSLLIRIQSLSSAAQLGFAAAAALVSALSTLLPQGQFQA--KWPNDVMAAGRKCAGMLL 121

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
                  G   +V+GIG+NV   P      +P  +L   G      D+ +    D   ++
Sbjct: 122 ----ESAGTDWLVLGIGVNVVAAPPPVGLNHPACALADLGFSGTADDVLAAFCTDFLPLV 177

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             W+       +   W   A G+G    ++L   +  G F G+D+ G LLL++     R+
Sbjct: 178 QAWRGQG-FAPVRQAWLNCARGLGQPTVVRLETDTQTGIFAGLDEEGALLLDQGASGFRR 236

Query: 245 IFTGDIF 251
           I  GD+F
Sbjct: 237 ILAGDVF 243


>gi|116052314|ref|YP_788839.1| biotin--protein ligase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296387163|ref|ZP_06876662.1| biotin--protein ligase [Pseudomonas aeruginosa PAb1]
 gi|115587535|gb|ABJ13550.1| BirA bifunctional protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 312

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 110/239 (46%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +  E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S    NLY SL +
Sbjct: 71  WPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAI 130

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + S      +  +KWPND+L   +KIAGIL+E     
Sbjct: 131 TVRGGARELEGLSLVVGLAVLRALESLGVR--EAGLKWPNDVLQGGKKIAGILLELSGDP 188

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             L  VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++
Sbjct: 189 ADLCHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSRE 248

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  + +  +  SI GR +GVD  G L LE   G  +    G+
Sbjct: 249 G-FAASREEWESCNLWQGAQVILSTALSSIEGRVLGVDSRGALRLE-VDGVEQGFSGGE 305


>gi|15965033|ref|NP_385386.1| biotin--[acetyl-CoA-carboxylase] synthetase protein [Sinorhizobium
           meliloti 1021]
 gi|307301105|ref|ZP_07580874.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti
           BL225C]
 gi|307317839|ref|ZP_07597277.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti AK83]
 gi|15074212|emb|CAC45859.1| Probable biotin--[acetyl-CoA-carboxylase] synthetase [Sinorhizobium
           meliloti 1021]
 gi|306896601|gb|EFN27349.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti AK83]
 gi|306904060|gb|EFN34646.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti
           BL225C]
          Length = 255

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 114/243 (46%), Positives = 145/243 (59%), Gaps = 1/243 (0%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +P  FR+       STN EC+ RA  GD GNLWI A  QT GRGRR   W S+ GNLYAS
Sbjct: 11  SPEDFRHVALAETVSTNSECLLRAREGDPGNLWITAVRQTGGRGRRGRAWFSEPGNLYAS 70

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIET 128
           LLLID    D L  L  A AVA+   I   +P G  +  IKWPNDIL+  RK  GIL+E 
Sbjct: 71  LLLIDPAPVDRLHALPLAAAVAVHRAIRRVMPPGGAEAAIKWPNDILIDGRKTCGILLEG 130

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             L +G +A+V+G G+NV   P D  YPVTSL+REG  I  +++F+ LF  +A  L +W 
Sbjct: 131 EVLADGRRALVIGCGINVAVMPEDALYPVTSLRREGATISPEELFAHLFVTMAETLAVWD 190

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +  G   I++ WR  A GIG+ IT+ L   S+ GRF G+D  G LLL+   G  + I  G
Sbjct: 191 RGAGVAAIIDQWRAAAKGIGEAITVNLPDRSLSGRFAGIDRDGRLLLDTGSGPPQTIAAG 250

Query: 249 DIF 251
           D+F
Sbjct: 251 DVF 253


>gi|302341650|ref|YP_003806179.1| biotin/acetyl-CoA-carboxylase ligase [Desulfarculus baarsii DSM
           2075]
 gi|301638263|gb|ADK83585.1| biotin/acetyl-CoA-carboxylase ligase [Desulfarculus baarsii DSM
           2075]
          Length = 333

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/259 (23%), Positives = 106/259 (40%), Gaps = 12/259 (4%)

Query: 1   MFSNLSECQNPYS---FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           + +   E + P          + TI STN E  + A +G      + A  Q+AGRGR   
Sbjct: 66  VLAERVEARLPEGCLGRPLLHYQTIDSTNLEARRLAEAGAAHGACLCAEHQSAGRGRLGR 125

Query: 58  KWISD--KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
            W +      L++ LL    +  D + LL+  +++A+   +           +KWPND+ 
Sbjct: 126 AWQAPVGASLLFSLLLRPVDLPVDLVFLLNNVVSLAVCRAVEGLCG--LRAMVKWPNDVF 183

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKD 171
           +  RK+ G+L E     + +  VVVG GLNV   P    +      + L   G   D   
Sbjct: 184 LDGRKLVGVLTEFTCRADRIDHVVVGAGLNVNWSPEDLAMLPAPAASLLAASGRRWDRAV 243

Query: 172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
           + + + +    +          E + + ++  +  +G  +TI      + G+  G +  G
Sbjct: 244 LLAAILRQADALYASLL-AGQLEALRDEYQRQSLLLGRQVTIDDGGALVGGQVAGFEPDG 302

Query: 232 YLLLEEKKGCVRQIFTGDI 250
            L L    G VR +  GD+
Sbjct: 303 ALRLSTGPGRVRIVRHGDV 321


>gi|6690793|gb|AAF24346.1|AF201721_1 BirA [Sinorhizobium meliloti]
          Length = 257

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 114/243 (46%), Positives = 145/243 (59%), Gaps = 1/243 (0%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +P  FR+       STN EC+ RA  GD GNLWI A  QT GRGRR   W S+ GNLYAS
Sbjct: 13  SPEDFRHVALAETVSTNSECLLRAREGDPGNLWITAVRQTGGRGRRGRAWFSEPGNLYAS 72

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIET 128
           LLLID    D L  L  A AVA+   I   +P G  +  IKWPNDIL+  RK  GIL+E 
Sbjct: 73  LLLIDPAPVDRLHALPLAAAVAVHRAIRRVMPPGGAEAAIKWPNDILIDGRKTCGILLEG 132

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             L +G +A+V+G G+NV   P D  YPVTSL+REG  I  +++F+ LF  +A  L +W 
Sbjct: 133 EVLADGRRALVIGCGINVAVMPEDALYPVTSLRREGATISPEELFAHLFVTMAETLAVWD 192

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +  G   I++ WR  A GIG+ IT+ L   S+ GRF G+D  G LLL+   G  + I  G
Sbjct: 193 RGAGVAAIIDQWRAAAKGIGEAITVNLPDRSLSGRFAGIDRDGRLLLDTGSGPPQTIAAG 252

Query: 249 DIF 251
           D+F
Sbjct: 253 DVF 255


>gi|304412749|ref|ZP_07394351.1| biotin/acetyl-CoA-carboxylase ligase [Shewanella baltica OS183]
 gi|307307966|ref|ZP_07587690.1| biotin/acetyl-CoA-carboxylase ligase [Shewanella baltica BA175]
 gi|304348829|gb|EFM13245.1| biotin/acetyl-CoA-carboxylase ligase [Shewanella baltica OS183]
 gi|306910025|gb|EFN40466.1| biotin/acetyl-CoA-carboxylase ligase [Shewanella baltica BA175]
          Length = 319

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 105/237 (44%), Gaps = 9/237 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +FD I+STN   +             VA  Q+AGRGRR   W+S    +LY SL      
Sbjct: 83  YFDEIASTNGFMLSHTTELK-NGDVCVAEYQSAGRGRRGRTWVSPYGHHLYFSLFWTFPQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LS  +A A+  V+ S      ++ +KWPNDI +  +K+AGILIE     +   
Sbjct: 142 GMAQAMGLSLVVACALVEVLKSFG--VENIGVKWPNDIYLDNKKLAGILIEMSGQADSQC 199

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV---LDLWKKDTGR 193
            +++G+G+N+                    +D+ D  +L+ +   ++   + L++++   
Sbjct: 200 QLIIGVGVNMAMSEEQGKGIDQPWSDLSDLVDMPDKTALVIELQKQLKRDIQLFEREG-L 258

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 W+      G  I + +   S+ G   GVD+ G +LLE   G V+    G+I
Sbjct: 259 AAFKARWQAADLFYGREIRLLMGEKSVEGICRGVDEQGAVLLETADG-VQAFIGGEI 314


>gi|255264857|ref|ZP_05344199.1| biotin-(acetyl-CoA-carboxylase) ligase [Thalassiobium sp. R2A62]
 gi|255107192|gb|EET49866.1| biotin-(acetyl-CoA-carboxylase) ligase [Thalassiobium sp. R2A62]
          Length = 254

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 114/246 (46%), Gaps = 7/246 (2%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     D   ST  E  +R  S   G+ WI+A  QTA  GRR   W +  GN  A+
Sbjct: 11  WPAGYDRVILDHTDSTMAEA-RRISSSASGHTWILAREQTAAHGRRGRAWTNPAGNFSAT 69

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LLL    +  +  L SF +AVA+R  +A T+P    + +KWPND ++   K+AGIL+E++
Sbjct: 70  LLLRVDDTPANAALRSFVMAVALRQTLAMTVP-PEQLSLKWPNDAMIAGGKVAGILLESV 128

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR----EGGCIDLKDIFSLLFQDVARVLD 185
                +  + +GIG+N+   P        + +     + G       F           +
Sbjct: 129 GRAGRVDWLSIGIGVNLTQAPDVAEVETGAFRPVAVSQYGTAPSPQDFLFWLVSHFADRE 188

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              +  G + I  LW   A  +G++IT K +  ++ G F  VD  G L+L+   G V+ I
Sbjct: 189 QSFRSFGFDPIRRLWLAHAARLGEVITAKTTRDTLTGTFETVDADGNLVLKTPSG-VQAI 247

Query: 246 FTGDIF 251
              D++
Sbjct: 248 PAADVY 253


>gi|16801084|ref|NP_471352.1| hypothetical protein lin2018 [Listeria innocua Clip11262]
 gi|16414519|emb|CAC97248.1| birA [Listeria innocua Clip11262]
          Length = 325

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E +++++ST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIYESVNSTQIIAHQQMNS-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKEKASSLKLELGESVSRKALLQAILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G +  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEIHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|197287062|ref|YP_002152934.1| biotin--protein ligase [Proteus mirabilis HI4320]
 gi|227354941|ref|ZP_03839354.1| biotin--[acetyl-CoA-carboxylase] ligase [Proteus mirabilis ATCC
           29906]
 gi|194684549|emb|CAR46368.1| BirA bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-coa-carboxylase] synthetase] [Proteus
           mirabilis HI4320]
 gi|227164974|gb|EEI49816.1| biotin--[acetyl-CoA-carboxylase] ligase [Proteus mirabilis ATCC
           29906]
          Length = 320

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 98/238 (41%), Gaps = 9/238 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDS 75
                I STN   ++R           +A  Q+AGRGRR  +WIS    NLY S+     
Sbjct: 82  RVIPVIDSTNQYMIQRISEL-TSGDVCIAEYQSAGRGRRGRQWISPFGRNLYLSMYWKLD 140

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               +   LS  + V +  V+      G  V  KWPND+ +  +K++GIL+E       +
Sbjct: 141 QGPAAAIGLSLVVGVILAEVLQQFGANGVKV--KWPNDLYLNDKKLSGILVELTGKTGDV 198

Query: 136 QAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             +V GIG+N+               +L++ G  ID   +   +   + +    ++K   
Sbjct: 199 AHIVTGIGINIAMSNNQKDAINQQWINLEQVGIKIDRNQLACEITNALRKAFVQFEKQG- 257

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +  W+     I   + + +    I G   G+++ G LLLE+    +     G+I
Sbjct: 258 LSAFIERWKSLDNFIDRRVKLIIGDKEIFGIAKGINEQGALLLEQNN-KIVPYIGGEI 314


>gi|188532305|ref|YP_001906102.1| biotin--protein ligase [Erwinia tasmaniensis Et1/99]
 gi|188027347|emb|CAO95192.1| Bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Erwinia
           tasmaniensis Et1/99]
          Length = 320

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 97/240 (40%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   + R  S        VA  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  RLAVIPVIDSTNQYLLDRMASLQ-SGDACVAEYQQAGRGRRGRQWFSPFGSNLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +   +        D+++KWPNDI +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVIAEALQQ--QGAPDIRVKWPNDIYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +L   G  +D   + +L+   +   L  +++D
Sbjct: 197 DAAQIVIGAGINLAMRAPAHDVINQGWINLHEAGCSVDRNALSALIINKMRTALAQFEQD 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G L+LE+  G  +    G+I
Sbjct: 257 G-LVPFIERWAALDNFINRPVKLLIGDREINGIARGIDQQGGLILEQ-DGITKSWVGGEI 314


>gi|163793201|ref|ZP_02187177.1| birA biofunctional protein, putative [alpha proteobacterium BAL199]
 gi|159181847|gb|EDP66359.1| birA biofunctional protein, putative [alpha proteobacterium BAL199]
          Length = 248

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 112/238 (47%), Gaps = 8/238 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +    FD +SST DE  + A+ G      + A  QT GRGR    W+S  GN+Y + +L
Sbjct: 17  GWTIASFDRVSSTMDEARRLAVEGAPDRTVVRADVQTGGRGRLGRPWVSSIGNVYTTAIL 76

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +IS      LS   AVA+   +A        V++KWPND+L+   K++G+L+E +   
Sbjct: 77  RPAISTARAAELSLVAAVAVADTVARF---SESVRLKWPNDVLLNGGKVSGVLLEAVAEG 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             L AV+VGIG+NV   P     P + ++      D   +F+ L     +    W +   
Sbjct: 134 VSLSAVLVGIGVNVGSHPDLPDRPTSRIE----TADADTVFAALLDAFDQRYRQWSQHG- 188

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I   W      +G  + + L    + G F G++  G L LE   G VRQI +G++
Sbjct: 189 LGGIRFAWLERGPDLGSPMIVGLGADRVRGTFAGLEPDGSLRLELADGSVRQISSGEV 246


>gi|127511076|ref|YP_001092273.1| biotin--protein ligase [Shewanella loihica PV-4]
 gi|126636371|gb|ABO22014.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella loihica PV-4]
          Length = 319

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 105/236 (44%), Gaps = 7/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +F+ I+STN   ++            VA  Q+AGRGRR  +W+S    +LY S     S 
Sbjct: 83  YFNEINSTNGFLLEHVKDL-SSGDICVAEYQSAGRGRRGRQWVSPYGCHLYTSFYWQFSQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LS  +  ++ +V+ S    G  V  KWPNDI +  +K+AGILIE     + + 
Sbjct: 142 GMAQAMGLSLVVGCSLVTVLRSLGVDGIGV--KWPNDIYLNHKKLAGILIEMSGQADSVC 199

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR--E 194
            +V+GIG+N+   P                  L D   L+     +++   +    +  +
Sbjct: 200 DLVIGIGINLSMSPAQADKIDQPWSDLSELTQLPDKTELMIALQQQLVTDLELFQRQGLK 259

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + WR      G+ I + +   S+ G   G+D+ G +LL+ ++G  +    G+I
Sbjct: 260 AFQSRWREADLFDGEPIKLLMGENSVEGICCGIDEQGAILLKTEEGT-KAFVGGEI 314


>gi|290894258|ref|ZP_06557226.1| birA protein [Listeria monocytogenes FSL J2-071]
 gi|290556197|gb|EFD89743.1| birA protein [Listeria monocytogenes FSL J2-071]
          Length = 325

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIES-SSEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|322834831|ref|YP_004214858.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Rahnella sp. Y9602]
 gi|321170032|gb|ADW75731.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Rahnella sp. Y9602]
          Length = 319

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYA 68
            P   +      I STN   + R           VA  Q AGRGRR  KW S    NLY 
Sbjct: 76  LPAG-QVRVLSVIDSTNQYLLDRIGEL-SSGDACVAEYQQAGRGRRGRKWFSPFGSNLYL 133

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S+         +   LS  I + M  V+        DV++KWPND+ +  RK+AGIL+E 
Sbjct: 134 SMYWKLEQGPAAAMGLSLVIGIVMAEVLQRLG--AKDVRVKWPNDLYLNDRKLAGILVEL 191

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                    +V+G G+N+K              +LQ  G  ID  ++ ++L +++   L 
Sbjct: 192 TGKTGDAAQLVIGAGINLKMREPASDAITQGWINLQEAGVNIDRNELTAMLLKELRSALL 251

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            ++++      +  WR     +   + + +    I G   G+D  G LLLE+    V+  
Sbjct: 252 HFEQEG-LAPFIPRWRGLDNFLDRQVKLLIGDQEIHGIERGIDPQGALLLEQDA-VVKPY 309

Query: 246 FTGDI 250
             G+I
Sbjct: 310 IGGEI 314


>gi|91776433|ref|YP_546189.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacillus flagellatus
           KT]
 gi|91710420|gb|ABE50348.1| Biotin--acetyl-CoA-carboxylase ligase [Methylobacillus flagellatus
           KT]
          Length = 325

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 73/243 (30%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           F+   FD+I STN   M++A  G        A  QT GRGRR   W S    +L  SLL 
Sbjct: 81  FKLLMFDSIESTNSYLMQQAALGAAHGTVAAALLQTKGRGRRGRSWQSAFGASLTFSLLW 140

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +   +L+ LS A+ +A+   +          ++KWPNDILV  RK+AGILIE     
Sbjct: 141 RFQLGASALSGLSLAVGLALVRTLHEYGLRS--AQLKWPNDILVRGRKLAGILIELHGDM 198

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            G  A V+G+GLN+K                       I+  D+   L + +A+VL+ ++
Sbjct: 199 EGPSAAVIGVGLNLKLPVAAREKIDQPVTDLASHLPLEINPNDMLGQLLKQLAQVLEEFE 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +      +   W       G+ + +    G    GR  G+ D G LL++ + G  R   +
Sbjct: 259 RAG-FAGMREEWMSHHIFQGETVKLLFPDGREQYGRVEGIADDGVLLIKNEHGNQR-FSS 316

Query: 248 GDI 250
           G+I
Sbjct: 317 GEI 319


>gi|168213862|ref|ZP_02639487.1| BirA bifunctional protein [Clostridium perfringens CPE str. F4969]
 gi|170714613|gb|EDT26795.1| BirA bifunctional protein [Clostridium perfringens CPE str. F4969]
          Length = 328

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      ++A  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILIAEEQTAGRGRFQRKFFSPSNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKTDSKDFPEDIKNIAGSIFGGEKPTITRNQLVAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G++
Sbjct: 262 LEDKSIMTEYRILSLVLGKEVSFLKNNKLNKGLAIDITDEGALVVKYENGEIEYLNSGEV 321


>gi|259906920|ref|YP_002647276.1| biotin--protein ligase [Erwinia pyrifoliae Ep1/96]
 gi|224962542|emb|CAX53997.1| Bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Erwinia
           pyrifoliae Ep1/96]
 gi|283476713|emb|CAY72542.1| biotin-protein ligase [Erwinia pyrifoliae DSM 12163]
          Length = 320

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 98/240 (40%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   + R  S        VA  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  RLAVIPVIDSTNQYLLDRMASLQ-SGDACVAEYQQAGRGRRGRQWFSPFGSNLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +   +        D+++KWPNDI + +RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVIAEALQQ--QGAPDIRVKWPNDIYLHERKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +L   G  +D   + +L+   +   L  +++D
Sbjct: 197 DAAQIVIGAGINLAMRAPAQDVINQGWINLHETGCNVDRNALSALIVNKMRTALAQFEQD 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G L+LE+  G  +    G+I
Sbjct: 257 G-LTPFIQRWAALDNFINRPVKLLIGDREINGIARGIDQQGGLILEQ-DGVTKSWVGGEI 314


>gi|73666871|ref|YP_302887.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia canis str. Jake]
 gi|72394012|gb|AAZ68289.1| Biotin--acetyl-CoA-carboxylase ligase [Ehrlichia canis str. Jake]
          Length = 247

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 6/247 (2%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN 65
           S    P  +  E    + STN E +K A  G      I++  Q  GRGR +  W S KGN
Sbjct: 3   SNINLPNGYSLEHHKILYSTNYEAIKLAECGAKDGTIIISDEQIKGRGRYERIWHSPKGN 62

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY S+++   +    +  ++          I       + V+ KWPND+L+  +KI+GIL
Sbjct: 63  LYFSIIITKFVEIFPIPFIAALSVGKTLEEILE-NKEISKVQYKWPNDVLINSKKISGIL 121

Query: 126 IETLNLKNGLQ-AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           +E+  L N  Q  +VVGIG+N+   P                            +    L
Sbjct: 122 LESKTLNNAPQKWIVVGIGINMYKAPEYATTIKQHNINFTLS---NLELLEKVINHFNNL 178

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             +  + G  +I +LW    C +   IT+K    +  G+FV +D  G ++++++      
Sbjct: 179 RKYYINYGFTKIKDLWLKQTCHLNSKITVKSHNNTYTGKFVTIDMKGNMIMQQEDKTT-C 237

Query: 245 IFTGDIF 251
           I +G+IF
Sbjct: 238 ITSGEIF 244


>gi|89093743|ref|ZP_01166689.1| biotin operon repressor [Oceanospirillum sp. MED92]
 gi|89081873|gb|EAR61099.1| biotin operon repressor [Oceanospirillum sp. MED92]
          Length = 324

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 67/235 (28%), Positives = 109/235 (46%), Gaps = 9/235 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSISKD 79
           TI STN   MK +  GD      +A  QT GRGRR   W+S    NLY SL+        
Sbjct: 88  TIPSTNALAMKESQRGDCHGRIYLAEQQTEGRGRRGRTWVSPFARNLYFSLVWRFEQGAA 147

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
           ++  LS  + +AM   +         V++KWPND+L   RK+AGIL+E     +G   VV
Sbjct: 148 AIEGLSLLVGLAMVKAMEKLKIDA--VQLKWPNDLLSQGRKLAGILLEVHGEASGQCQVV 205

Query: 140 VGIGLNVKHCPVDTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           +G+G+NV+                       +D   + + +  ++   L+ ++++    E
Sbjct: 206 IGVGVNVEMPRDLGEQIDQPWIDLKTVSGRPVDRNLLLAEILNELVLRLNQFERNG-FAE 264

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            ++ W  +       IT+++   +I G   G+D  G LLLE + G +R    G++
Sbjct: 265 FVDEWHGYHAMQSQPITLQVGSKAIEGVCQGIDTSGALLLESEDG-LRAYHGGEV 318


>gi|168204676|ref|ZP_02630681.1| BirA bifunctional protein [Clostridium perfringens E str. JGS1987]
 gi|170663770|gb|EDT16453.1| BirA bifunctional protein [Clostridium perfringens E str. JGS1987]
          Length = 328

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      +++  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILISEEQTAGRGRFQRKFFSPSNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKTDSKDFPEDIKNIAGSIFGGEKPTITRNQLIAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G++
Sbjct: 262 LEDKSIMTEYRILSLVLGKEVSFLKNNKMNKGLAIDITDDGALVVKYENGEIEYLNSGEV 321


>gi|315445617|ref|YP_004078496.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Mycobacterium sp.
           Spyr1]
 gi|315263920|gb|ADU00662.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Mycobacterium sp.
           Spyr1]
          Length = 266

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 100/240 (41%), Gaps = 10/240 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           R +  D   STN + + RA  G D+    ++A  QTAGRGR    W +   +  +    +
Sbjct: 25  RVDVVDETGSTNADLIARAARGEDIAGAVLLAEHQTAGRGRHGRTWSAPPRSQISMSFGV 84

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D+            +   +          G D  +KWPND++V  RK+AGIL E      
Sbjct: 85  DTTGVPPAGWGWLPLLTGLAVAHTLRESYGVDAGVKWPNDVMVGPRKLAGILAEVSA--- 141

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWK-KDT 191
               +VVG+GLNV+    + P P            D   + + L Q+ +  L  W+    
Sbjct: 142 --PVIVVGLGLNVEMSADELPDPNALSLSLLNHHADRTQLAASLLQEFSSRLRGWRLAGG 199

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              ++   +R  +  IG  +   L     I+G   G+D+ G LL++   G    +  GDI
Sbjct: 200 ADADLAADYRERSTTIGTRVRAILPGDSEIIGMATGIDESGRLLIDT-DGTTVTVSAGDI 258


>gi|119478590|ref|ZP_01618512.1| biotin--protein ligase [marine gamma proteobacterium HTCC2143]
 gi|119448425|gb|EAW29675.1| biotin--protein ligase [marine gamma proteobacterium HTCC2143]
          Length = 320

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            +  D + STN   + RA  G        A  QTAG+GRR   W S    NLY S +   
Sbjct: 82  LDVRDVVDSTNIIALNRASPG-SSGYICTAEHQTAGKGRRGKVWASPYASNLYLSAVWEF 140

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +    +L  LS A+ VA+   ++     G    +KWPNDILV  RK+AGIL+E      G
Sbjct: 141 ADGAAALEGLSLAVGVAVADALSRAGVNGVK--LKWPNDILVDNRKLAGILLEVTGEPAG 198

Query: 135 LQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDTG 192
              VVVGIGLNV      D   P   ++       +   + +L+  ++  +L  + +   
Sbjct: 199 PCRVVVGIGLNVNMITATDIDQPWIDVKEISLEAANRNQLLALILNELMPLLSSFSQRGF 258

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                + W       G  +TI +   S+ G+ +GVD+ G LL++   G +++   G++
Sbjct: 259 L-SYRDRWLALDAYAGLDVTILMGKESVNGKAMGVDNSGALLVQTDAG-IQKFSGGEV 314


>gi|300714838|ref|YP_003739641.1| bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Erwinia
           billingiae Eb661]
 gi|299060674|emb|CAX57781.1| Bifunctional protein: biotin operon repressor and
           biotin-[acetyl-CoA carboxylase] synthetase [Erwinia
           billingiae Eb661]
          Length = 320

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 107/254 (42%), Gaps = 15/254 (5%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + + L E       R      I STN   ++R  S        VA  Q AGRGRR  +W 
Sbjct: 72  IMAQLKEK------RLAVIPVIDSTNQYLLERMDSLQ-SGDACVAEYQQAGRGRRGRQWF 124

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S    NLY SL         +   LS  I + +  V+ S      DV++KWPND+ +  R
Sbjct: 125 SPFGSNLYLSLYWRLDQGPMAAMGLSLVIGIVIAEVLQSLG--AKDVRVKWPNDLYLNDR 182

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLL 176
           K+AGIL+E          +V+G G+N+               +LQ  G  +D   + + L
Sbjct: 183 KLAGILVELTGKTGDAAQLVIGAGINLAMRSPDAGIVNQGWINLQEAGVNVDRNTLTAHL 242

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             ++   L +++++      ++ W      I   + + +    I G   G+D  G L+LE
Sbjct: 243 INNMRESLPIFEREG-LAPFIDRWSELDNFINRPVKLLIGDKEIPGIARGIDQQGGLILE 301

Query: 237 EKKGCVRQIFTGDI 250
           +  G  +    G+I
Sbjct: 302 Q-DGVRKSWVGGEI 314


>gi|18309655|ref|NP_561589.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Clostridium perfringens str. 13]
 gi|110801046|ref|YP_695117.1| BirA bifunctional protein [Clostridium perfringens ATCC 13124]
 gi|168209954|ref|ZP_02635579.1| BirA bifunctional protein [Clostridium perfringens B str. ATCC
           3626]
 gi|18144332|dbj|BAB80379.1| biotin-protein ligase [Clostridium perfringens str. 13]
 gi|110675693|gb|ABG84680.1| BirA bifunctional protein [Clostridium perfringens ATCC 13124]
 gi|170712022|gb|EDT24204.1| BirA bifunctional protein [Clostridium perfringens B str. ATCC
           3626]
          Length = 328

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      ++A  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILIAEEQTAGRGRFQRKFFSPSNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKTDSKDFPEDIKNIAGSVFGGEKPTITRNQLVAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G++
Sbjct: 262 LEDKSIMTEYRILSLVLGKEVSFLKNNKLNKGLAIDITDEGALVVKYENGEIEYLNSGEV 321


>gi|219850088|ref|YP_002464521.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus aggregans DSM
           9485]
 gi|219544347|gb|ACL26085.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus aggregans DSM
           9485]
          Length = 267

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 97/246 (39%), Gaps = 14/246 (5%)

Query: 16  YEFFDTISSTNDECMKRALSGDLG--NLWIVASCQTAGRGRRDNKWISDKGN--LYASLL 71
              +D + ST D       +       + IVA  QTAGRGR   +W++  G+  L++  L
Sbjct: 21  IYCYDQVGSTMDLARTAIATLPPSALPVLIVAEEQTAGRGRLGRRWVAPPGSALLFSLGL 80

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIE 127
              + +  + T L +  AVA+   I +         +KWPND+LV       K AGIL+E
Sbjct: 81  QPPAAATSTPTALIWLAAVALLETIEA--ETPLTAGLKWPNDVLVNTSAGWAKTAGILLE 138

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
               +  L   ++G G+N+   P                   +D       L +     L
Sbjct: 139 GGWDEGQLVWAIIGCGINISAAPDPQTTLYPATALTLAGAPDVDRLRFLQALLRRYDFWL 198

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                          WR     +G  +TI   +G I G  + VD  G L++    G + +
Sbjct: 199 QRLYAGDSDSLWST-WRSRLLTLGQNVTINTGHGVIHGEAIDVDRQGTLIVRAPHGNIHR 257

Query: 245 IFTGDI 250
           I +GD+
Sbjct: 258 IESGDV 263


>gi|126736044|ref|ZP_01751788.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. CCS2]
 gi|126714601|gb|EBA11468.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. CCS2]
          Length = 264

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 113/246 (45%), Gaps = 8/246 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +     DT+ ST  E  +RA + +    WI+A  QT  RGRR  +W+  +GNL A+
Sbjct: 22  WPEGYARVVLDTVDSTMAEAARRAKNLE-RPTWIMAKTQTDARGRRGREWVVPEGNLNAT 80

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+     +       SF  A A+   +A  + V   + +KWPND+L+   K+AGIL+E+ 
Sbjct: 81  LIFRPEATAAEAAKRSFLAANALYQALAIYVNVD-KLALKWPNDVLLSGGKVAGILLESS 139

Query: 130 NLKNGLQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                +  + +GIG+N++H P         P +     GG +D +D    L    A    
Sbjct: 140 GQGPFVDWLSIGIGVNLQHTPEGVTDTLFPPTSLADGGGGTVDPQDFLFTLADAYATQEA 199

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              +      I + W   A  +G++IT + +   I G F  +D  G L+L    G  R I
Sbjct: 200 KLLRLGFDR-IRDDWLASAARLGEVITARTTREEITGIFDSIDHDGNLVLITGTGP-RAI 257

Query: 246 FTGDIF 251
              D+F
Sbjct: 258 PAADVF 263


>gi|114327952|ref|YP_745109.1| biotin--[acetyl-CoA-carboxylase] synthetase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316126|gb|ABI62186.1| biotin operon repressor [Granulibacter bethesdensis CGDNIH1]
          Length = 261

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 110/246 (44%), Gaps = 10/246 (4%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P+ +R E   ++ ST+D  + RA  G+   L ++A  QT  R  R   W   +GNL  S
Sbjct: 11  LPHPWRLEVHASLPSTSDYLVARASQGEPDGLAVLALRQTLPRATRGRAWTEPEGNLALS 70

Query: 70  LLLIDSISKDSLT-----LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           LL+        L+       +F   +A+   I   +     V +KWPNDI+V  RK+ GI
Sbjct: 71  LLIRPGQGPAFLSAREAGHWAFVAGLAVFDAIWPYVDDPQAVFLKWPNDIMVGDRKLGGI 130

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           LI+        + +V+GIG+NV   P     P           D   +  +L Q +   L
Sbjct: 131 LIDAAIAAAEPEWLVIGIGVNVASAP---VVPGRMTACLADISDRVPMPQVLAQKIVTRL 187

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             W+      EI + WR  A   G  +T++     + G F G+ + G LLL+   G  R 
Sbjct: 188 SAWRHAAPL-EIRDAWRRAAHPPGTRLTVRCQGEVLDGLFTGIGEDGALLLDCG-GECRV 245

Query: 245 IFTGDI 250
           + TG+I
Sbjct: 246 VHTGEI 251


>gi|310766065|gb|ADP11015.1| biotin--protein ligase [Erwinia sp. Ejp617]
          Length = 320

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 62/240 (25%), Positives = 97/240 (40%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   + R  S        VA  Q AGRGRR  +W S    NLY S+   
Sbjct: 80  RLAVIPVIDSTNQYLLDRMASLQ-SGDACVAEYQQAGRGRRGRQWFSPFGSNLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +   +        D+++KWPNDI +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVIAEALQQ--QGAPDIRVKWPNDIYLNDRKLAGILVEITGKTG 196

Query: 134 GLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +L   G  +D   + +L+   +   L  +++D
Sbjct: 197 DAAQIVIGAGINLAMRAPAQDVINQGWINLHETGCNVDRNALSALIINKMRTALAQFEQD 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G L+LE+  G  +    G+I
Sbjct: 257 G-LTPFIQRWAALDNFINRPVKLLIGDREINGIARGIDQQGGLILEQ-DGVTKSWVGGEI 314


>gi|254172464|ref|ZP_04879139.1| biotin-(acetyl-CoA-carboxylase) ligase [Thermococcus sp. AM4]
 gi|214033393|gb|EEB74220.1| biotin-(acetyl-CoA-carboxylase) ligase [Thermococcus sp. AM4]
          Length = 240

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 110/239 (46%), Gaps = 11/239 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +       + STND   + A         +VA  Q +G+GR+  KW S +G L+ + +L 
Sbjct: 6   WNVIRLTEVGSTNDYAREIAED-VPEGTVVVARRQRSGKGRKGRKWASPEGGLWMTAILK 64

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
              + + L  L F  A+A+   +      G   ++KWPND+LV  RKIAGIL E      
Sbjct: 65  PRSNPEHLPKLVFVGALAVLDTLHEY---GIRGELKWPNDVLVNGRKIAGILSECR---F 118

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTG 192
           G  A++          P +      S+    G  +DL+++   L ++++R   L++    
Sbjct: 119 GRFALIGIGLNANNEIPDELKESAVSMGEILGRNVDLEELLEKLLRNLSRWYGLFR-SGR 177

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSI-LGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             EI+   R  +  +G  + I      I  G  V +D+ G L++E  +G VR ++ GD+
Sbjct: 178 HGEILKAVRNRSAVLGKRVRIIEEGKVIAEGTAVDIDESGALMVEGAEGTVRVLY-GDV 235


>gi|313618191|gb|EFR90273.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria innocua FSL
           S4-378]
          Length = 325

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E +++++ST     ++  S       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIYESVNSTQIIAHQQMNS-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKEKASSLKLELGESVSRKALLQAILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|91228951|ref|ZP_01262847.1| biotin--protein ligase [Vibrio alginolyticus 12G01]
 gi|91187495|gb|EAS73831.1| biotin--protein ligase [Vibrio alginolyticus 12G01]
          Length = 321

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 95/240 (39%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            E    I STN   + R    +      +A  Q  GRGRR  +W+S    NLY S+    
Sbjct: 81  VELVPVIDSTNQYLLDRVADSEK-GRVCIAEYQAQGRGRRGRQWVSPFGSNLYLSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  I +A    +      G    +KWPND+    +K+AGIL+E      G
Sbjct: 140 DAGMAAAMGLSLVIGIAAVEALEEVGMQGVK--LKWPNDLYYQDKKLAGILVEMSGQAGG 197

Query: 135 LQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+        +D P+   +   +   ID   +   L +     L  ++  
Sbjct: 198 AAHLVIGMGLNIGMPDDQPEIDQPWTTLNQVNQSLKIDRNVLAMTLIKHWNSALVEYEMK 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      +   + + +    + G   G+D  G +L+E  +G +     G+I
Sbjct: 258 G-LTGFIERWNRLDNFLNRQVKLLIGPREVYGVVRGIDHQGGILIETSQG-LETYIGGEI 315


>gi|315282931|ref|ZP_07871226.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria marthii FSL
           S4-120]
 gi|313613419|gb|EFR87268.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria marthii FSL
           S4-120]
          Length = 325

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVSSTQIIAHQQIEA-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENVTK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILVALEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|116873339|ref|YP_850120.1| bifunctional protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742217|emb|CAK21341.1| bifunctional protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 325

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 113/242 (46%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++SST     ++          IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHIEIHESVSSTQIIAHQQI-DTSPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + +IKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPRIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV     P +     +SL+ E G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQVFPEEIKDKASSLKLELGESISRKALLQEILASLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIYGKVQGISDEGVLLLQDNLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|16803943|ref|NP_465428.1| hypothetical protein lmo1904 [Listeria monocytogenes EGD-e]
 gi|47096487|ref|ZP_00234079.1| BirA bifunctional protein [Listeria monocytogenes str. 1/2a F6854]
 gi|224501297|ref|ZP_03669604.1| hypothetical protein LmonFR_02030 [Listeria monocytogenes FSL
           R2-561]
 gi|254831495|ref|ZP_05236150.1| hypothetical protein Lmon1_09078 [Listeria monocytogenes 10403S]
 gi|254899399|ref|ZP_05259323.1| hypothetical protein LmonJ_06284 [Listeria monocytogenes J0161]
 gi|254912462|ref|ZP_05262474.1| BirA [Listeria monocytogenes J2818]
 gi|254936789|ref|ZP_05268486.1| birA [Listeria monocytogenes F6900]
 gi|255029020|ref|ZP_05300971.1| hypothetical protein LmonL_07411 [Listeria monocytogenes LO28]
 gi|284802349|ref|YP_003414214.1| hypothetical protein LM5578_2105 [Listeria monocytogenes 08-5578]
 gi|284995491|ref|YP_003417259.1| hypothetical protein LM5923_2056 [Listeria monocytogenes 08-5923]
 gi|16411357|emb|CAC99982.1| birA [Listeria monocytogenes EGD-e]
 gi|47015140|gb|EAL06081.1| BirA bifunctional protein [Listeria monocytogenes str. 1/2a F6854]
 gi|258609384|gb|EEW21992.1| birA [Listeria monocytogenes F6900]
 gi|284057911|gb|ADB68852.1| hypothetical protein LM5578_2105 [Listeria monocytogenes 08-5578]
 gi|284060958|gb|ADB71897.1| hypothetical protein LM5923_2056 [Listeria monocytogenes 08-5923]
 gi|293590444|gb|EFF98778.1| BirA [Listeria monocytogenes J2818]
          Length = 325

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  ++++ST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEVHESVNSTQIIAHQQIET-SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDTLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|226356961|ref|YP_002786701.1| bifunctional biotin operon repressor/biotin--acetyl-CoA-carboxylase
           ligase [Deinococcus deserti VCD115]
 gi|226318951|gb|ACO46947.1| putative bifunctional protein BirA: biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Deinococcus deserti VCD115]
          Length = 321

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 20/243 (8%)

Query: 12  YSFRYEFFDTISSTNDECMKRAL---SGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           +     +  T +ST D+    A    S       +VA  QTAGRGRR   W + +  L  
Sbjct: 81  FGRALRYTGTTTSTQDDLRLWAEHPTSPAPHGAVVVAERQTAGRGRRGRAWDTPQDTLVF 140

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDI-LVFQRKIAGILIE 127
           S+LL   ++   L L+  A  VA+     +         +KWPND+  +  RK+AGIL+E
Sbjct: 141 SVLLCAPLTLPDLALMPLAAGVAVHEACRT-------GGLKWPNDLLTLDGRKLAGILLE 193

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                   +  V+GIG+NV   P         L      +   ++   L   +   L   
Sbjct: 194 ADLRGEEARRAVLGIGVNVGSAP----PGAAHLHETQPGLTRAELLGRLLGALEHWL--- 246

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
                 E++++ WR  +  +G  + +    G++ G  + +D  G L +++  G V  I  
Sbjct: 247 --VQPAEDVLSAWRAASLTLGQAVHVNTPRGTVQGTAIDLDTHGNLQVQDPDGQVHTISA 304

Query: 248 GDI 250
           GD+
Sbjct: 305 GDV 307


>gi|85703317|ref|ZP_01034421.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. 217]
 gi|85672245|gb|EAQ27102.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. 217]
          Length = 252

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 72/250 (28%), Positives = 114/250 (45%), Gaps = 9/250 (3%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
              P  +      T+ STN E  + A     G  WI+A  QTA RGRR   W++  GN  
Sbjct: 5   SGWPSGYGRRVLTTVDSTNAEAARLAPYL-TGPEWILAHQQTAARGRRGRAWVNPAGNFA 63

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
           A+L++  + S D + L SF  ++A+   + +         +KWPND+L+   K+AGIL+E
Sbjct: 64  ATLVMRPTESPDRVALRSFVASLALFEALVAATGRAEVFALKWPNDVLLNGGKLAGILLE 123

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVA 181
           +      L    +GIG+N+   P  +        PV+ L   G  +D ++   LL    A
Sbjct: 124 SAGAGGSLSHFAIGIGVNLCSAPDVSEVEQGALRPVSLLSETGIVLDPEEFLDLLAPAYA 183

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           R+   +        I   W   A  +G++IT + +     G F  VD+ G L+L    G 
Sbjct: 184 RLESQFVTYG-FAPIRTAWLARAARLGEVITARTTREVYEGTFQTVDEAGNLVLLTAMGR 242

Query: 242 VRQIFTGDIF 251
            + I   ++F
Sbjct: 243 -QTIAAAEVF 251


>gi|114771833|ref|ZP_01449226.1| biotin--acetyl-CoA-carboxylase ligase [alpha proteobacterium
           HTCC2255]
 gi|114547649|gb|EAU50540.1| biotin--acetyl-CoA-carboxylase ligase [alpha proteobacterium
           HTCC2255]
          Length = 242

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 113/243 (46%), Gaps = 3/243 (1%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           + P  F     DTI STN E  + A S      WI+A  QT+G GRR  KW S KGN  +
Sbjct: 2   EWPDGFGRITLDTIDSTNKEASRLA-SDITQPTWILAEEQTSGVGRRGRKWSSQKGNFSS 60

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           +LL+  S    S+ L SF  ++A+R              +KWPND+L+   K+AGIL+ET
Sbjct: 61  TLLMPISGDLSSVALHSFVASLALRDTFLHITNEPNKFNLKWPNDVLMDGCKVAGILLET 120

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             +      + +G+ L++           T     G  I   D  ++L    A  L+ + 
Sbjct: 121 CGIGPSHLNIGIGVNLSILPESDKIETLSTKPICLGIEILPIDFLTILANFFAIRLEQFD 180

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
               R+  ++ W   A  IG +IT ++    I G+FV VD+ G ++L+        I   
Sbjct: 181 TSGFRQIRLD-WLKSAANIGKVITARMPNSEITGKFVTVDEQGAVVLQADD-MKHTIHAA 238

Query: 249 DIF 251
           DIF
Sbjct: 239 DIF 241


>gi|145225319|ref|YP_001135997.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium gilvum
           PYR-GCK]
 gi|145217805|gb|ABP47209.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium gilvum
           PYR-GCK]
          Length = 266

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 101/240 (42%), Gaps = 10/240 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           R +  D   STN + + RA  G D+    ++A  QTAGRGR    W +   +  +    +
Sbjct: 25  RVDVVDETGSTNADLIARADRGEDIAGAVLLAEHQTAGRGRHGRTWSAPPRSQISMSFGV 84

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D+            +   +          G +  +KWPND++V  RK+AGIL E      
Sbjct: 85  DTTGVPPAGWGWLPLLTGLAVAHTLRESYGVNAGVKWPNDVMVGPRKLAGILAEVSG--- 141

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDTG 192
               +VVG+GLNV+    + P P            D   + + L Q+ +  L  W+   G
Sbjct: 142 --PVIVVGLGLNVEMTVDELPDPNAMSLSMLNHHADRTQLTASLLQEFSSRLRRWRLAGG 199

Query: 193 REEIMN-LWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +  +   +R  +  IG  +   L     I+G   G+DD G LL++ + G    +   DI
Sbjct: 200 ADAGLATDYRERSTTIGTRVRALLPGDSEIIGVATGIDDAGRLLIDTE-GTTVTVSAADI 258


>gi|224500254|ref|ZP_03668603.1| hypothetical protein LmonF1_11484 [Listeria monocytogenes Finland
           1988]
          Length = 325

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  ++++ST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEVHESVNSTQIIAHQQIET-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  +  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDTLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|161505375|ref|YP_001572487.1| biotin--protein ligase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866722|gb|ABX23345.1| hypothetical protein SARI_03524 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 320

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 99/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  NVAVLPVIDSTNQYLLDRIGEL-RSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLRELG--ADKVRVKWPNDLYLLDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+               +LQ  G  +D   + + L  ++   L+L++++
Sbjct: 197 DAAQIVIGAGINMAMRRVEEGVINQGWITLQEAGITLDRNTLTAKLIYELRIALELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LSPYLTRWEKLDNFIHRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|85859786|ref|YP_461988.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Syntrophus aciditrophicus SB]
 gi|85722877|gb|ABC77820.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Syntrophus aciditrophicus SB]
          Length = 273

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 101/243 (41%), Gaps = 9/243 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +  I STN        SG      ++A  Q  GRGR    W S    NLY S+L
Sbjct: 28  GRAVYLYPEIDSTNSAAFHLGHSGAGEGTIVIADTQLKGRGRLHRPWQSPPGRNLYTSIL 87

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I       L+    VA+  +++   P    V++KWPND+ +  +K+ GIL E    
Sbjct: 88  LKPPIEPSVAPQLTLLAGVAVADLLSFYCPGS--VRLKWPNDVQINGKKVCGILAEMKTS 145

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-----DLKDIFSLLFQDVARVLDL 186
            +G+  + +GIG+NV     +      +L               DI   L+    +   L
Sbjct: 146 AHGIDYIAIGIGINVNIRNEEFDETFRNLATSLREETGQVLPRMDIAVSLYDHFEKCYTL 205

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +  +   + +   W  +A  +G+ + +        G   G+DD G LLL +++G + ++ 
Sbjct: 206 YLAEG-FQSLKERWLIYARILGEQLQVIFREEVQSGEVAGLDDSGALLLCDREGKITRVI 264

Query: 247 TGD 249
            GD
Sbjct: 265 AGD 267


>gi|260434161|ref|ZP_05788132.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417989|gb|EEX11248.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 249

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 117/248 (47%), Gaps = 9/248 (3%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +       + ST +E  + A +   G +WI+A  QTA RGRR   W + KGNL A+
Sbjct: 4   WPQGYGLHILQEVDSTLNEAARIAPT-AAGPVWIMAHHQTAARGRRGRVWANPKGNLAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LL+    + +   L SF  A+A+   + S       + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LLMRPEGNPEQAALRSFVAALALFDAVVSVTGRAAGLSLKWPNDVLLNGGKLAGILLEST 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +GIG+N+   P           PV+ L   G  ++ +D  + L    AR 
Sbjct: 123 GQGRGVSHLAIGIGVNLADAPAPDTVEPGALRPVSLLSETGAQVEAEDFLTELAAAYARY 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +      E I   W   A  +G++IT + +    +G F  VD  G L+L   KG V 
Sbjct: 183 EAQFTTYG-FEPIRTAWLSRAAKLGEVITARTATSESVGTFETVDAGGNLVLNTAKGRV- 240

Query: 244 QIFTGDIF 251
            I   D++
Sbjct: 241 SIPAADVY 248


>gi|313623172|gb|EFR93433.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria innocua FSL
           J1-023]
          Length = 325

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               E  +++ ST     ++  +       IVA  QTAG+GR    W S K   ++ S++
Sbjct: 82  GQHLEIHESVKSTQIIAHQQIET-SPEGTVIVADEQTAGKGRLLRPWNSKKGEGIWMSVI 140

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I    +   +F  ++A+   I +      + KIKWPNDI + +RKI G+L E    
Sbjct: 141 LKPQIPIQKVPQFTFIASLAITEAIENITK--LEPKIKWPNDIYIGKRKICGVLTEMQAE 198

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE---GGCIDLKDIFSLLFQDVARVLDLWK 188
              + AV++G+G+NV            +   +   G  I  K +   +   + +  +L+ 
Sbjct: 199 AETIHAVIIGMGINVNQQEFPEEIKEKASSLKLELGESISRKALLQAILTSLEKYYELFL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  I  LW   A   G+ +T   + G I G+  G+ + G LLL++  G V  I++ 
Sbjct: 259 DKG-FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISEEGVLLLQDSLGEVHSIYSA 317

Query: 249 DI 250
           DI
Sbjct: 318 DI 319


>gi|261346943|ref|ZP_05974587.1| biotin-[acetyl-CoA-carboxylase] ligase [Providencia rustigianii DSM
           4541]
 gi|282564959|gb|EFB70494.1| biotin-[acetyl-CoA-carboxylase] ligase [Providencia rustigianii DSM
           4541]
          Length = 325

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 100/243 (41%), Gaps = 11/243 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +      I STN   ++R  + + G+   +A  Q+AGRGRR  +WIS    NLY S    
Sbjct: 80  KIIVEPVIDSTNQYMLERIPNLNSGDT-CLAEYQSAGRGRRGRQWISPFGCNLYLSTYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  + + +   +         V  KWPND+ +  +K+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVVGIVIAETLNKVCGNKVKV--KWPNDLYMNDKKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID------LKDIFSLLFQDVARVLDLW 187
               +++GIG+N+              Q      D         +   +   + + L L+
Sbjct: 197 DAAHIIIGIGINIGMNENILQKEKPINQAWSSLTDEVENIERNKLAGNIINALRQSLLLF 256

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +K+   +  +  W      +G  + + +    I G   G+++ G LLL+ + G +     
Sbjct: 257 EKEG-LKPFLAKWFDLDNFLGRSVKLLIGNDVITGIEKGINEQGALLLQTENGEIIPYIG 315

Query: 248 GDI 250
           G+I
Sbjct: 316 GEI 318


>gi|325261217|ref|ZP_08127955.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. D5]
 gi|324032671|gb|EGB93948.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. D5]
          Length = 326

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 99/242 (40%), Gaps = 6/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                +++   STN    +    G      + A  Q+AGRGRR   W S    ++Y S+L
Sbjct: 78  GQEVYYYNITDSTNIRAKQLGDEGAPHGTLVTADQQSAGRGRRGRGWESPPGCSVYMSIL 137

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   I      +L+  +A+++   +        DV+IKWPNDI++  +K+ GIL E    
Sbjct: 138 LRPDIPPVKAPMLTLVMALSVAGSLK--DCTDLDVQIKWPNDIILNGKKLVGILTEMSTE 195

Query: 132 KNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + +  VV+G+G+NV              +     G  +   ++ +   +   R   L+ 
Sbjct: 196 IDYINHVVIGVGINVNMEYLPEGIRDKATSLRLATGHVVRRSELIASTMKQFERYYGLFL 255

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +    E +   +       G  + I           +G++  G LL+  + G    +F G
Sbjct: 256 ESRNLESMREEYNQLLVNRGKEVRILGGKEEYNAVALGINSEGELLVRREDGSEEAVFAG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|229592919|ref|YP_002875038.1| biotin--protein ligase [Pseudomonas fluorescens SBW25]
 gi|229364785|emb|CAY52793.1| bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-CoA-carboxylase] synthetase
           (biotin--protein ligase)] [Pseudomonas fluorescens
           SBW25]
          Length = 319

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 111/240 (46%), Gaps = 7/240 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           ++     D+I STN E ++   +G      ++A  QTAGRGRR  KW+S    N+Y SL+
Sbjct: 75  AWPVHISDSIDSTNAEALRLVDAGCAAPFLVLAEQQTAGRGRRGRKWVSPFAQNVYYSLV 134

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L        L  LS  + +A+   +  +   G    +KWPND+LV Q+KIAGIL+E +  
Sbjct: 135 LRIESGLRQLEGLSLVVGLAVMQALRESGVRG--AALKWPNDVLVGQKKIAGILLELVGD 192

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPV--TSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
              +  VV+GIG+NV     D       + L   G  +D   + + L   + R L+  + 
Sbjct: 193 PADICHVVLGIGINVNMQRADEVDQQWTSVLLETGSSVDRNALVAQLGVQLQRYLERHR- 251

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           + G   +   W       G  +++      + G  +GVD  G L L   +G  +    G+
Sbjct: 252 EGGFVALQEEWEQSHAWQGRSVSLIAGVNQVDGVVLGVDRQGALRL-SVEGVEKIYSGGE 310


>gi|231637|sp|P29906|BIRA_PARDE RecName: Full=Biotin--[acetyl-CoA-carboxylase] synthetase; AltName:
           Full=Biotin--protein ligase
 gi|150617|gb|AAA25601.1| biotin [acetyl-CoA carboxylase] ligase [Paracoccus denitrificans]
          Length = 240

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 75/239 (31%), Positives = 108/239 (45%), Gaps = 9/239 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
                STN E +K A  G  G+ W++A  Q AGRGRR  +W+   GN   +L+L      
Sbjct: 2   LARTDSTNAEALKLAP-GLSGSAWVLAREQFAGRGRRGREWVMPAGNFAGTLVLRPQGGA 60

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
            +   LSF  A+A+   +         + IKWPND+L+   K+AGIL+E+     G+QAV
Sbjct: 61  LAAAQLSFVAALALYDALGLACGPAARLAIKWPNDVLLNGGKVAGILLESSGSGPGVQAV 120

Query: 139 VVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            VGIG+N+   P           PV+     G  +D ++   LL    AR          
Sbjct: 121 AVGIGVNLAGAPDAGAVEPGATPPVSVQGETGHAVDPEEFLDLLAPAFARWQAQLDTYG- 179

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I N W   A  +G+ I  +       G F G+DD G L+L    G  + I   ++F
Sbjct: 180 FAPIRNAWLARAARLGEPIIARTGTAESHGIFEGIDDSGALILRGPAGR-QVIPAAEVF 237


>gi|299135018|ref|ZP_07028209.1| biotin/acetyl-CoA-carboxylase ligase [Afipia sp. 1NLS2]
 gi|298589995|gb|EFI50199.1| biotin/acetyl-CoA-carboxylase ligase [Afipia sp. 1NLS2]
          Length = 259

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 121/238 (50%), Gaps = 2/238 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FDT++STN E + R  +G+ G LW+  + QTAG GRR   WIS  GNL  S++  
Sbjct: 14  YRLVSFDTLNSTNAEALTRLRAGERGPLWLATAHQTAGHGRRQRAWISPPGNLACSVVET 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +        L FA  +A+ + +          ++KWPND+L  + K+AGILIE     +
Sbjct: 74  LTADHAGAATLGFAAGLALETALRQVSGDAALFRLKWPNDVLANEAKLAGILIEAEATPD 133

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            L AVV G+GLNV   P  TPYP TSL+  G   D + +F+ L    A    +W    G 
Sbjct: 134 SLAAVV-GMGLNVVAAPEGTPYPATSLKALGLVTDAETLFAALTDAWAEWFSIWDHGRGF 192

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           E I   W   A G+G  I ++     I G F  +D+ G L++    G    +  GD++
Sbjct: 193 EAIRTQWLARAAGLGAAIQVRQGDRVIDGTFETIDEAGRLVVSHGGGAT-TVAAGDVY 249


>gi|269958954|ref|YP_003328743.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma centrale str.
           Israel]
 gi|269848785|gb|ACZ49429.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma centrale str.
           Israel]
          Length = 242

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 104/243 (42%), Gaps = 7/243 (2%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           + F         STN E ++ A SG      ++A  QT+G GR   +W S KGNLY S++
Sbjct: 2   HGFVIHHTRVSRSTNLEAIELAQSGAPDGTVVIADEQTSGTGRYGREWHSPKGNLYCSII 61

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD---VKIKWPNDILVFQRKIAGILIET 128
                   +L+ LS          +       T    ++ KWPND++V  +KI+G+L++T
Sbjct: 62  TRMDAQVAALSFLSSLAVGVTIEQVFEAYNCSTKKALIRYKWPNDVMVDGKKISGVLVKT 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             +   +   V GIG+N+   P    Y  +                 L       L    
Sbjct: 122 KMIGGEIDWAVCGIGVNIYAPP---QYAASLHNHIPELKLSNLELLDLMLKNFAKLSDVL 178

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSI-LGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           K+ G  ++ +LW       GD I I  +  ++  G+FV ++  G ++LE   G +  +  
Sbjct: 179 KNMGFAQLRSLWMNRGHRPGDRICITTNNNTVMEGKFVDINTQGAMVLESDSGTLVSVNY 238

Query: 248 GDI 250
           G+I
Sbjct: 239 GEI 241


>gi|212634812|ref|YP_002311337.1| biotin--protein ligase [Shewanella piezotolerans WP3]
 gi|212556296|gb|ACJ28750.1| Biotin--acetyl-CoA-carboxylase ligase [Shewanella piezotolerans
           WP3]
          Length = 320

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 99/241 (41%), Gaps = 7/241 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
             R  +FD I STN   +K A   D      VA  Q+AGRGRR   W+S    +LY S+ 
Sbjct: 78  GQRCFYFDEIESTNGFILKHAEELD-SGDICVAEYQSAGRGRRGRTWVSPYGCHLYFSMY 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                       LS  +A ++  V+        ++ +KWPNDI +  +K+AG+LIE    
Sbjct: 137 WQFPQGMAQAMGLSLVVACSIVKVLKQLN--VDEIGVKWPNDIYLAGKKLAGVLIEMSGQ 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG--GCIDLKDIFSLLFQDVARVLDLWKK 189
            +    +V+G+GLN+            +         +  K     L Q   +      +
Sbjct: 195 TDNECNLVIGVGLNMAMSEQHGKSIDQAWSDLTSLKSMPNKTELLTLLQKQLQQDLSLFQ 254

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           ++G     + W      I   I + +    + G   G+D  G +LLE   G V+    G+
Sbjct: 255 ESGLTPFQSRWEEADLFIDQQIKLLIGTDEVHGICRGIDKQGAVLLETDDG-VKSFIGGE 313

Query: 250 I 250
           I
Sbjct: 314 I 314


>gi|104779738|ref|YP_606236.1| biotin--protein ligase [Pseudomonas entomophila L48]
 gi|95108725|emb|CAK13419.1| putative biotin-[acetylCoA carboxylase] holoenzyme synthetase;
           transcriptional repressor of biotin synthesis BirA
           [Pseudomonas entomophila L48]
          Length = 319

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 104/239 (43%), Gaps = 7/239 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +       I STN E ++ A +       ++A  Q+AGRGRR  +W+S    NLY S++L
Sbjct: 76  WPLFIHQDIDSTNAEGLRLAAAEQSAPFVVLAERQSAGRGRRGRQWVSPFAENLYYSVVL 135

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   + +      DV +KWPND+L   +KI GIL+E +   
Sbjct: 136 RVEGGMRQLEGLSLVVGLAVMRTLQAFGLQ--DVGLKWPNDVLAGGKKITGILLELVGDP 193

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYP--VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +  VV+GIG+NV     D       +   + G  ID   + +LL + +   L   ++ 
Sbjct: 194 ADVCHVVLGIGINVNMQHNDQVDQAWSSMRTQTGKVIDRNHLVALLTKQLQHELARHRRY 253

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                    W       G  +++      I G  +GVD  G L L +  G  +    G+
Sbjct: 254 G-FAAFQEEWEQAHLWQGRKVSLVAGNTRIDGVVLGVDGQGGLRL-DVDGVEKSYSGGE 310


>gi|120402722|ref|YP_952551.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955540|gb|ABM12545.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium vanbaalenii
           PYR-1]
          Length = 257

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 11/240 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            R +  +   STN + + RA +G D+    ++A  QTAGRGR    W +   +  +  + 
Sbjct: 20  RRVDVVEETGSTNADLIARAAAGEDIAGAVLLAEHQTAGRGRHGRSWSAPPRSQISMSVG 79

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           +D+    +       +   +          G D  +KWPNDILV   K+AGIL E     
Sbjct: 80  VDATGVPAERWGWLPLLTGLAVAHVVREDYGVDAGVKWPNDILVGTGKLAGILAEVSA-- 137

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDT 191
                +VVG+GLNV     + P P        G   D   + + + Q+++R L  W+   
Sbjct: 138 ---PVIVVGLGLNVSFTADELPDPNAVSLMMLGHDADRTALAATVLQELSRQLHRWRAGD 194

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +   +R  +  +G  +   L  G  I+G   G+DD G LL+ +  G    +  GDI
Sbjct: 195 --PGLAADYRNASTTLGAPVRAVLPGGSEIVGVATGIDDAGRLLI-DDDGTTVTVSAGDI 251


>gi|157693259|ref|YP_001487721.1| biotin-(acetyl-CoA carboxylase) ligase [Bacillus pumilus SAFR-032]
 gi|157682017|gb|ABV63161.1| possible biotin-(acetyl-CoA carboxylase) ligase [Bacillus pumilus
           SAFR-032]
          Length = 239

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 106/239 (44%), Gaps = 10/239 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           +   +DTI STN+E  +    G+  +  + A  QTAGRGR    W +  GN+  ++ ++ 
Sbjct: 2   KIFQYDTIDSTNNEAKRLMQQGEKPSFAVYARQQTAGRGRLGRPWETPLGNVAVTMTVMP 61

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                + + ++   A+A+  V+   +    ++ IKWPNDIL+ + K++G LIE       
Sbjct: 62  PEELSTQSTIAPLTALAIYDVLKPLIRAEDELAIKWPNDILINEAKVSGTLIE-----AD 116

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             A+ +G+G+NV+  P   PY    L          D                 ++ G E
Sbjct: 117 RSAIYIGVGINVETKPEHVPYKTICLSELTEVK--ADQLVKDLAAAFEKYHSRWQNEGFE 174

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSI---LGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +  L+      +   + I L         G   GV+ FG+L L++ KG ++    GDI
Sbjct: 175 ALTALYNKRLYRLNKPLRISLDREKQTWEEGICCGVNRFGHLQLKDDKGQIKAHSAGDI 233


>gi|209545454|ref|YP_002277683.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533131|gb|ACI53068.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 260

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 71/241 (29%), Positives = 112/241 (46%), Gaps = 6/241 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R E  D + ST+D C+ RA  G+   L ++A  QT GRG R   W    GNL  S+LL 
Sbjct: 18  WRLEIHDELDSTSDTCLARAGQGERSGLAVMARRQTRGRGSRGRDWQDPGGNLAFSVLLR 77

Query: 74  DSISKDSL-TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                +    L  F   +A    IA  +P    +++KWPND+L+  RK AGILIE     
Sbjct: 78  PGGKGEWPVGLWPFIAGLAFHGAIAPWIPHPISLRLKWPNDLLLEGRKAAGILIEAGTDS 137

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G   +V+G G N++  P  T   +  +   G   + + +   +   +   + +      
Sbjct: 138 SGRW-LVIGFGANLRAAPAITGRDLACVAEYGTAPEPEIVARAICAGLDHWMAVCGGQGD 196

Query: 193 ---REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
               E +   W   A  +G  + ++   G + G F G+D  G LLL    G +++I TG+
Sbjct: 197 GLGFEAVRQAWLAHAHPMGTRLVVRAESGQVEGSFAGLDAQGMLLLRCADG-LKRISTGE 255

Query: 250 I 250
           I
Sbjct: 256 I 256


>gi|146313575|ref|YP_001178649.1| biotin--protein ligase [Enterobacter sp. 638]
 gi|145320451|gb|ABP62598.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Enterobacter sp. 638]
          Length = 320

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 107/240 (44%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +      I STN   ++R    + G+   VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  KVTVLPVIDSTNQYLLERINELNSGDS-CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +  V+         V++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVIAEVLHDLG--ADKVRVKWPNDLYLNDRKLAGILVEMTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G GLN+    V T        +LQ  G  ID   +   L +++   L L+++D
Sbjct: 197 DAAQIVIGAGLNMVMRNVQTDVVNQGWITLQEAGVTIDRNTLAVRLIKELREALTLFEQD 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G++  G LLLE++ G V+    G+I
Sbjct: 257 G-LSPFLSRWEKLDNFINRPVKLIIGDKEIFGTSRGINAQGALLLEQE-GIVKPWVGGEI 314


>gi|295106132|emb|CBL03675.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Gordonibacter
           pamelaeae 7-10-1-b]
          Length = 314

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 96/248 (38%), Gaps = 13/248 (5%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
           + F       + STN E   RAL G      +VA  QTAGRGR    + S     +Y S+
Sbjct: 70  HPFGITVRKRVDSTNAEARHRALEGAPEGAVVVAEEQTAGRGRLGKTFYSPAGAGVYLSV 129

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +  D+   L+ A AV+    I +      +  IKW NDI    RK+AGIL E + 
Sbjct: 130 VLRPRLQADAAQYLTCAAAVSCAQAIEAVTG--EEALIKWVNDIFCRGRKVAGILTEGVV 187

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID------LKDIFSLLFQDVARVL 184
                +     +G+ V      T +P       G   D         + + +      + 
Sbjct: 188 DMESGRFEHAVLGMGVNVRVPATGFPSEIADVAGAVCDEAVGVLRSRLAAEMLARFWSLY 247

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +     +      + +R     +G  I +  +   +  R V + +   L++E      R+
Sbjct: 248 ENLPDRSFY----DEYRRRCFLLGQPIVVTRNGSRVRARAVDLTEDFKLVVELPDKTRRE 303

Query: 245 IFTGDIFT 252
           +  G++ T
Sbjct: 304 LPHGEVST 311


>gi|269963591|ref|ZP_06177915.1| biotin--protein ligase [Vibrio harveyi 1DA3]
 gi|269831675|gb|EEZ85810.1| biotin--protein ligase [Vibrio harveyi 1DA3]
          Length = 321

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            E    I STN   + +    D      +A  Q  GRGRR  +WIS    NLY S+    
Sbjct: 81  IELISVIDSTNQYLLDKVNESDK-GRVCLAEYQAKGRGRRGRQWISPFGTNLYLSMYWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  + +A    I S    G    +KWPNDI    +K+AGIL+E      G
Sbjct: 140 DAGMAAAMGLSLVVGIAAVEAIESLGIDGVK--LKWPNDIYYQDKKLAGILVEMSGQAGG 197

Query: 135 LQAVVVGIGLNVKHCPVD----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+GLN+    +      P+   +   +G  ID   +   L +     L+ ++  
Sbjct: 198 AAHLVIGMGLNIGMPDMQPEIDQPWTTLNQVSDGVLIDRTQLAIKLIEHWKNALEEYEMA 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      IG  + + +    I G   G+D  G ++LE + G +     G+I
Sbjct: 258 G-LAGFVDRWNRLDNFIGRSVKLLMGPREIHGVVKGIDQQGGVVLETENG-LETYVGGEI 315


>gi|152998733|ref|YP_001364414.1| biotin--protein ligase [Shewanella baltica OS185]
 gi|151363351|gb|ABS06351.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella baltica OS185]
          Length = 319

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 100/236 (42%), Gaps = 7/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +FD I+STN   +             VA  Q+AGRGRR   W+S    +LY SL      
Sbjct: 83  YFDEIASTNGFMLSHTTELK-NGDVCVAEYQSAGRGRRGRTWVSPYGHHLYFSLFWTFPQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LS  +A  +  V+ S      ++ +KWPNDI +  +K+AGILIE     +   
Sbjct: 142 GMAQAMGLSLVVACTLVEVLKSFG--VENIGVKWPNDIYLDNKKLAGILIEMSGQADSQC 199

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD--LWKKDTGRE 194
            +++G+G+N+                    +D+ D  +L+ +   ++       +  G  
Sbjct: 200 QLIIGVGVNMAMSEEQGKGIDQPWSDLSDLVDMPDKTALVIELQRQLKRDIQLFEREGLA 259

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                W+      G  I + +   S+ G   GVD+ G +LLE   G V+    G+I
Sbjct: 260 AFKARWQAADLFYGREIRLLMGEKSVEGICRGVDEQGAVLLETADG-VQAFIGGEI 314


>gi|269128324|ref|YP_003301694.1| biotin/acetyl-CoA-carboxylase ligase [Thermomonospora curvata DSM
           43183]
 gi|268313282|gb|ACY99656.1| biotin/acetyl-CoA-carboxylase ligase [Thermomonospora curvata DSM
           43183]
          Length = 289

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/261 (23%), Positives = 100/261 (38%), Gaps = 30/261 (11%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLLL 72
            R        STN +  + A  G+     +VA  Q AGRGR    W    +  L  S+LL
Sbjct: 31  RRVRVVAETGSTNVDLAEAARRGEPEGAVLVAESQRAGRGRLGRSWTAPPRSGLTFSVLL 90

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPV-----------------GTDVKIKWPNDIL 115
              +   +L  L     +A    +                         DV++KWPND++
Sbjct: 91  RPPVEAAALGWLPLLTGLAAAEALRRVTGRVTEDLTEGSARRNGRAAALDVRLKWPNDLM 150

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC--IDLKDIF 173
           V  RK+ GIL E +       AVV+G+GLNV     + P P  +     G    + + + 
Sbjct: 151 VGDRKLGGILAERVGD-----AVVMGVGLNVSLREEELPVPTATSLLLEGAAFREREALL 205

Query: 174 SLLFQDVARVLDLWKKDTGREEI---MNLWRCFACGIGDLITIKLS-YGSILGRFVGVDD 229
             + +++      W    G  E       +R     +G  + + +     I GR   VD 
Sbjct: 206 RAILRELEDWYRRWTAQGGDAEGSGLRAAYRDLCATLGRQVRVVMPGDQEITGRVADVDA 265

Query: 230 FGYLLLEEKKGCVRQIFTGDI 250
            G L++   +G  + +  GD+
Sbjct: 266 AGCLVVVTPEGE-QTVGAGDV 285


>gi|126176359|ref|YP_001052508.1| biotin--protein ligase [Shewanella baltica OS155]
 gi|125999564|gb|ABN63639.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella baltica OS155]
          Length = 319

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 104/237 (43%), Gaps = 9/237 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +FD I+STN   +             VA  Q+AGRGRR   W+S    +LY SL      
Sbjct: 83  YFDEIASTNGFMLSHTTELK-NGDVCVAEYQSAGRGRRGRTWVSPYGHHLYFSLFWTFPQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LS  +A  +  V+ S      ++ +KWPNDI +  +K+AGILIE     +   
Sbjct: 142 GMAQAMGLSLVVACTLVEVLKSFG--VENIGVKWPNDIYLDNKKLAGILIEMSGQADSQC 199

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV---LDLWKKDTGR 193
            +++G+G+N+                    +D+ D  +L+ +   ++   + L++++   
Sbjct: 200 QLIIGVGVNMAMSEEQGKGIDQPWSDLSDLVDMPDKTALVIELQKQLKRDIQLFEREG-L 258

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 W+      G  I + +   S+ G   GVD+ G +LLE   G V+    G+I
Sbjct: 259 AAFKARWQAADLFYGREIRLLMGEKSVEGICRGVDEQGAVLLETADG-VQAFIGGEI 314


>gi|168217198|ref|ZP_02642823.1| BirA bifunctional protein [Clostridium perfringens NCTC 8239]
 gi|182380725|gb|EDT78204.1| BirA bifunctional protein [Clostridium perfringens NCTC 8239]
          Length = 328

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      +++  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILISEEQTAGRGRFQRKFFSPSNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKTDSKDFPEDIKNIAGSIFGGEKPTITRNQLIAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G++
Sbjct: 262 LEDKSIMTEYRILSLVLGKEVSFLKNNKLNKGLAIDITDEGALVVKYENGEIEYLNSGEV 321


>gi|110802589|ref|YP_697990.1| BirA bifunctional protein [Clostridium perfringens SM101]
 gi|110683090|gb|ABG86460.1| BirA bifunctional protein [Clostridium perfringens SM101]
          Length = 328

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      ++A  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILIAEEQTAGRGRFQRKFFSPFNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKNDSKDFPEDIKNIAGSIFGGEKPTITRNQLIAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G+I
Sbjct: 262 LEDKSIMTEYRILSSVLGKEVSFLKNNKLNKGLAIDITDEGALVVKYENGEIDYLNSGEI 321


>gi|261250488|ref|ZP_05943063.1| biotin-protein ligase/biotin operon repressor [Vibrio orientalis
           CIP 102891]
 gi|260939057|gb|EEX95044.1| biotin-protein ligase/biotin operon repressor [Vibrio orientalis
           CIP 102891]
          Length = 323

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 10/240 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            E    I STN   ++RA S +      +A  Q  GRGRR  +W+S    NLY S+    
Sbjct: 80  VELIPIIDSTNQYLLERADSLE-SGSVCLAEYQAKGRGRRGREWVSPFGSNLYLSMFWRL 138

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                +   LS  + VA+   +      G    +KWPND+    +K+AGIL+E       
Sbjct: 139 DAGMAAAMGLSLVVGVAIVEALEEIGLEGVK--LKWPNDLYYQDKKLAGILVEMSGQAGA 196

Query: 135 LQAVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              +V+G+G+N+        +  P+   S   +   ID   +   + + + + L  ++  
Sbjct: 197 AANLVIGMGMNLMMSDKTEGITQPWASLSEVADNQNIDRNQLAITMIKTLNKSLADYELQ 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      +G  I + +    I G   G+++ G +LLE ++G +     G+I
Sbjct: 257 GMSG-FVERWNRLDNFLGRPIKLIMGPREISGISKGINEQGAVLLETEQG-IESYIGGEI 314


>gi|254481030|ref|ZP_05094276.1| biotin-(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2148]
 gi|214038825|gb|EEB79486.1| biotin-(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2148]
          Length = 313

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 106/241 (43%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLID 74
            +  D I STN E M +  +G        A  QTAGRGRR  +W+S    NLY S +   
Sbjct: 70  LDLRDAIGSTNAEAMSQIAAGRGSGYVCTAEQQTAGRGRRGREWVSPYARNLYLSAVWEY 129

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                 L  +S A+ V +   +A+       V++KWPND+L    K+ GIL+E      G
Sbjct: 130 EQGAAVLEGMSLAVGVVVARALAA--CGVPPVRLKWPNDLLYEGAKLGGILLEMTGDPAG 187

Query: 135 LQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
              VVVGIG+NV         +D  +   S    G  +D   + + +  ++  +L  ++ 
Sbjct: 188 ACQVVVGIGVNVSMPGKAAEGIDQSWTDVSRINSGSPLDRNLLLAAILDELLPMLASFEA 247

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
               E   + W       G  + +        G+ +GVD  G LLL+     V+ I+ G+
Sbjct: 248 TG-FEAWRDEWLLLDAYAGADVVLHSGNKKTAGKAMGVDKRGALLLQTVSAGVQAIYGGE 306

Query: 250 I 250
           I
Sbjct: 307 I 307


>gi|56963833|ref|YP_175564.1| bifunctional biotin biosynthesis protein BirA [Bacillus clausii
           KSM-K16]
 gi|56910076|dbj|BAD64603.1| bifunctional biotin biosynthesis protein BirA [Bacillus clausii
           KSM-K16]
          Length = 321

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 102/244 (41%), Gaps = 9/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
                 +D+++ST     + A         IVA+ Q   RGR   +W S K  +L  SLL
Sbjct: 77  GRNIHSYDSVASTQPLAHEEAAREAREGTLIVANEQQGARGRLGRQWQSTKGTSLSMSLL 136

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L   IS      L+   AVA+   I +   +  D  IKWPNDIL   +K+ GIL E    
Sbjct: 137 LRPDISVSQAPQLTLLAAVAVTRAIEAVSGLVCD--IKWPNDILYGGKKLVGILTEMAAD 194

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-----VTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            + +   +VGIG+N      D          +     G  +    + + +  +   + D 
Sbjct: 195 PDRVNYCIVGIGINCNQESNDFAETLAGIATSIKLETGNPVQRAKLVAAVMNEFEWLYDE 254

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           + K+     I  LW   +  +   ++ +     + G  +G+ D G L ++++ G    I+
Sbjct: 255 YIKNG-FAAIRPLWEARSVSLHTKLSARTPSRIVQGYSLGITDDGRLRIQDEDGQEHLIY 313

Query: 247 TGDI 250
           + DI
Sbjct: 314 SADI 317


>gi|254463244|ref|ZP_05076660.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679833|gb|EDZ44320.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 238

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 75/239 (31%), Positives = 114/239 (47%), Gaps = 9/239 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
              I STN E  + A +   G  WI+A  QTA RGRR   W   KGN  A+L+L    + 
Sbjct: 2   LSEIDSTNAEAARIAGTLA-GPEWILALNQTASRGRRGRAWHFPKGNFAATLVLHPREAP 60

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
           D + L SF  ++A+   + +       + +KWPND+L+   K+AGIL+E++    G+  +
Sbjct: 61  DVVALRSFVASLALYDALVACGVQAQSLALKWPNDVLLNGGKVAGILLESIGAGGGVSHL 120

Query: 139 VVGIGLNVKHCPVDT------PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            +GIG+N+   P+ +        PV+ L   G  I  +D   LL    AR    +     
Sbjct: 121 AIGIGVNLADAPLASDVEALAMRPVSLLSEAGVAISPEDFLDLLASAYARQESQFTTYG- 179

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I + W   A  +G++IT +       G F  VD  G L+L+  +G V  I   D+F
Sbjct: 180 FAAIRDAWLARAAKLGEVITARTMNSETTGTFETVDAQGNLVLKTSEGRV-AIAAADVF 237


>gi|83952325|ref|ZP_00961057.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius nubinhibens ISM]
 gi|83837331|gb|EAP76628.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius nubinhibens ISM]
          Length = 249

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 109/248 (43%), Gaps = 7/248 (2%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
             P  +       + STN E  + A +   G  WI+A  QTA RGRR   W +  GN  A
Sbjct: 3   NWPEGYGRRVLARVDSTNAEAARIAPTLA-GPEWILALEQTAARGRRGRAWANPVGNFAA 61

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           +L++  + S D + L SF  ++A+   +         V +KWPND+L+   K+AGIL+E+
Sbjct: 62  TLVMRPTESPDQVALRSFVASLALFDAVVDATGRAAGVSLKWPNDVLLNGGKLAGILLES 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-----GCIDLKDIFSLLFQDVARV 183
                GL    +GIG+N++  P        +++        G +   + F  L       
Sbjct: 122 AGSGGGLSHFAIGIGVNLREAPGAGEVEPGAVRPVSLLSEAGVMVTPEEFLDLLAPAYAR 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +      G   I   W   A  IG++IT + +  S  G F  VD  G L+L    G + 
Sbjct: 182 YETQFVTYGFAPIREAWLARAAKIGEVITARTTRDSHEGTFETVDATGNLVLSTAHGRI- 240

Query: 244 QIFTGDIF 251
            I   D+F
Sbjct: 241 AIPAADVF 248


>gi|88658376|ref|YP_507644.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599833|gb|ABD45302.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 251

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 72/253 (28%), Positives = 110/253 (43%), Gaps = 6/253 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M  NLS    P  +  E    + STN E +K A  G      I++  Q  GRGR +  W 
Sbjct: 1   MKLNLSNINLPNGYTLEHHKILYSTNYEAIKLAECGAEDGTIIISDKQIKGRGRYERTWY 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMR-SVIASTLPVGTDVKIKWPNDILVFQR 119
           S  GNLY S+++        L  ++          ++ +     + V+ KWPNDILV  +
Sbjct: 61  SPTGNLYFSIIITKFKETFPLPFIAALSVGKTLEEILINNNNTTSKVEYKWPNDILVNSK 120

Query: 120 KIAGILIETLNLKNGLQ-AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           KI+GIL+E+  L N LQ  +VVGIG+N+   P          Q                 
Sbjct: 121 KISGILLESKTLNNTLQKWIVVGIGINMYKAPTYATTIKEHNQNFTLS---NLELLEKVI 177

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
           +            G  +I NLW    C +   IT+K    +  G+F+ +D  G +L+++ 
Sbjct: 178 NNFYNFRKHYIYHGFADIRNLWLKQTCHLNREITVKSYKHTYTGQFITIDTQGNMLMKQN 237

Query: 239 KGCVRQIFTGDIF 251
              +  I +G+IF
Sbjct: 238 DKTI-CITSGEIF 249


>gi|70728946|ref|YP_262665.1| biotin--protein ligase [Pseudomonas fluorescens Pf-5]
 gi|68343245|gb|AAY90851.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas fluorescens
           Pf-5]
          Length = 320

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 5/238 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           +     D+  STN + ++    G +    ++A  QT GRGRR  KW+S    N+Y SL+L
Sbjct: 77  WDIRILDSTDSTNAQALRSIEEGSVAPFLVLAERQTVGRGRRGRKWVSPFAENIYYSLVL 136

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   L  LS  + +A+   +      G    +KWPND+LV Q+K+AGIL+E +   
Sbjct: 137 RMDGGLRQLEGLSLVVGLAVMHTLREYGIPG--AGLKWPNDVLVGQKKVAGILLELVGDP 194

Query: 133 NGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             +  VV+GIG+NV      +     TS++ E G +  ++       +V        +  
Sbjct: 195 ADVCHVVLGIGINVNMQSAEEIDQEWTSVRLESGKVIDRNQLVARLNEVLVSYLERHRLN 254

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           G   I   W       G  +++      I G  +G+D  G L L   +G  +    G+
Sbjct: 255 GFSAIQGEWEQGHLWQGRAVSLIAGVNKIDGVVLGIDRQGALRL-SVEGEEKTYSGGE 311


>gi|329998268|ref|ZP_08303011.1| biotin--[acetyl-CoA-carboxylase] ligase [Klebsiella sp. MS 92-3]
 gi|328538793|gb|EGF64872.1| biotin--[acetyl-CoA-carboxylase] ligase [Klebsiella sp. MS 92-3]
          Length = 320

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  RVTVLPVIDSTNQYLLDRLDEL-TSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +  V+         V++KWPNDI +  RK++GIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVIAEVLQQLG--AEQVRVKWPNDIYLQDRKLSGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V G G+N+               SLQ  G  ID   + + L +++   L+L++++
Sbjct: 197 DAAQIVSGAGINLMMRRVESDVVNQGWISLQEAGVVIDRNLLAARLIKELRLGLELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLPRWEKLDNFIHRPVKLIIGDKEIYGISRGIDAQGALLLEQ-DGVIKAWVGGEI 314


>gi|86750410|ref|YP_486906.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
 gi|86573438|gb|ABD07995.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
          Length = 287

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 101/247 (40%), Gaps = 10/247 (4%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLL 71
                    I STN   +    +G      +VA  QT GRG+    W     G+L  S L
Sbjct: 24  GRTVLHVAEIDSTNRALIDLGKAGADHGTVLVADHQTRGRGKGSRAWFSQPSGSLCVSTL 83

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +  +   +    L+   AVA+   IA+    G    IKWPND+LV  RKI GIL E    
Sbjct: 84  IRTARPIEEAPQLALLGAVALWEAIAA--HTGVAAGIKWPNDLLVDGRKICGILAEAHTD 141

Query: 132 KNG-LQAVVVGIGLNV-----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
             G L  VV+G GLNV     +          +     G  ID   +     + +   L 
Sbjct: 142 GAGELDFVVLGFGLNVAIAQAEFPEELRRSAASLAALAGRPIDPIGLLRGFLESLGVWLP 201

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           LW++D         W   A  +G ++ +      +  R +G+ D G L + ++ G  R +
Sbjct: 202 LWERDGV-ASFAGTWTRHAEHLGQMVRVTDGDEPVTARLIGLADDGALRILDETGVTRLV 260

Query: 246 FTGDIFT 252
            +G+I T
Sbjct: 261 HSGEIAT 267


>gi|311281472|ref|YP_003943703.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Enterobacter cloacae SCF1]
 gi|308750667|gb|ADO50419.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Enterobacter cloacae SCF1]
          Length = 320

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
                  I STN   + R      G+   VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  SVTVLPVIDSTNQYLLDRLSELYSGDT-CVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+      G  V  KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVMAEVLQRLGAEGVRV--KWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+    V+        T+LQ  G  ID   +   L +++   L+L++++
Sbjct: 197 DAAQIVIGAGVNLTMRRVESEVVNQGWTNLQEAGIRIDRNMLAVQLIKELREALNLFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LTPYLSRWEKLDNFINRPVKLIIGEKEIFGISRGIDTQGALLLEQ-DGVIKPWVGGEI 314


>gi|169344459|ref|ZP_02865428.1| BirA bifunctional protein [Clostridium perfringens C str. JGS1495]
 gi|169297379|gb|EDS79488.1| BirA bifunctional protein [Clostridium perfringens C str. JGS1495]
          Length = 328

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 98/240 (40%), Gaps = 7/240 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
              + TI STN E  K  +  D      +++  QTAGRGR   K+ S     +Y S++L 
Sbjct: 84  IRVYKTIDSTNQEAKKLLMDNDIPHGTILISEEQTAGRGRFQRKFFSPSNKGIYMSVILR 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +I       ++ + A+++   I +         IKW NDI +  +KI GIL E      
Sbjct: 144 PNIELSKAIHITTSAAISVCRAIETLTKKRPK--IKWVNDIFLDDKKICGILTEATGNFE 201

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQ---REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V +G+ V        +P           G        + L  ++   L    ++
Sbjct: 202 SGRVENVVVGIGVNFKTDSKDFPEDIKNIAGSIFGGEKPTITRNQLVAEILNELFELCEN 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              + IM  +R  +  +G  ++   +     G  + + D G L+++ + G +  + +G++
Sbjct: 262 LEDKSIMTEYRILSLVLGKEVSFLKNNKLNKGLAIDITDEGALVVKYENGEIEYLNSGEV 321


>gi|152972835|ref|YP_001337981.1| biotin--protein ligase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238892448|ref|YP_002917182.1| biotin--protein ligase [Klebsiella pneumoniae NTUH-K2044]
 gi|262043792|ref|ZP_06016893.1| biotin--[acetyl-CoA-carboxylase] ligase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|150957684|gb|ABR79714.1| biotin--protein ligase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238544764|dbj|BAH61115.1| biotin--protein ligase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259038862|gb|EEW40032.1| biotin--[acetyl-CoA-carboxylase] ligase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 320

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 100/240 (41%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R      I STN   + R           VA  Q AGRGRR  KW S    NLY S+   
Sbjct: 80  RVTVLPVIDSTNQYLLDRLDEL-TSGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + +  V+         V++KWPNDI +  RK++GIL+E      
Sbjct: 139 LEQGPAAAIGLSLVIGIVIAEVLQQLG--AEQVRVKWPNDIYLQDRKLSGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V G G+N+               SLQ  G  ID   + + L +++   L+L++++
Sbjct: 197 DAAQIVSGAGINLVMRRVESDVVNQGWISLQEAGVVIDRNLLAARLIKELRLGLELFEQE 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                 +  W      I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 257 G-LAPYLPRWEKLDNFIHRPVKLIIGDKEIYGISRGIDAQGALLLEQ-DGVIKAWVGGEI 314


>gi|294083725|ref|YP_003550482.1| birA bifunctional protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663297|gb|ADE38398.1| birA bifunctional protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 246

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 107/238 (44%), Gaps = 4/238 (1%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           ++ +   D   S++D   K AL G       +   QTAGRGRR   WIS +G +Y S +L
Sbjct: 6   AWTFSTADVAKSSSDLARKAALDGAPTGTGFLVGTQTAGRGRRGRTWISPQGGMYLSFVL 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                K    LLSF  A+A R  IA  L      K+KWPNDILV  RKI GIL+E +   
Sbjct: 66  RPDYDKHLWPLLSFVAALAARETIAHVLASH-RPKVKWPNDILVNDRKICGILLEGVEDA 124

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             +   +    +           P + +           + +    ++AR  +++   T 
Sbjct: 125 LIVGTGINVAPIKADTAMPGHIQPTSLVDLGDNVTTPALLAADYMDNLARRYNMF-NQTA 183

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I + W   A  +   +T+  +   + GRF+G+DD G ++L +  G    I TGD+
Sbjct: 184 FAPIRDEWMRHAAFLNQNVTVMDTG--LTGRFIGIDDDGSMMLVDASGKTHHITTGDV 239


>gi|68248829|ref|YP_247941.1| biotin--protein ligase [Haemophilus influenzae 86-028NP]
 gi|68057028|gb|AAX87281.1| BirA bifunctional protein [Haemophilus influenzae 86-028NP]
          Length = 302

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 111/248 (44%), Gaps = 13/248 (5%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            +S    PY     +   ISSTN+  ++   S        VA  QTAGRGRR  +W+S  
Sbjct: 62  QISTALFPYG--IHYQPIISSTNEWILQNIPSLKK-GDLCVAEYQTAGRGRRGRQWLSPF 118

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
                         K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ G
Sbjct: 119 AGQIMFSFYWTFDPKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGG 170

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTP-YPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E  N KNG+  +V+G+G+N           P   +      +D + +   L Q +  
Sbjct: 171 ILVEIANHKNGMLNLVIGVGINASLSKQTEISQPYAEVCEIDPDVDRQTLLPKLIQHLYT 230

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L++++++   EE    W+ +       + +    G I G   G+D+ G+L +      +
Sbjct: 231 RLNIFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGHLKVLCGN-KI 289

Query: 243 RQIFTGDI 250
           +    G++
Sbjct: 290 QIFNGGEV 297


>gi|260913039|ref|ZP_05919524.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Pasteurella dagmatis ATCC 43325]
 gi|260633029|gb|EEX51195.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Pasteurella dagmatis ATCC 43325]
          Length = 331

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/240 (25%), Positives = 104/240 (43%), Gaps = 6/240 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +       ++STN   +      +      ++  QTAGRGRR  +W+S         L 
Sbjct: 91  PYSVHIKPIVNSTNQYLLDNIAYLEK-GTICLSEYQTAGRGRRGRQWLSPFAGQVIMSLY 149

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                + +L  LS  + +A+   +  T     +VK+KWPND+L+  RK+AGIL+E  N  
Sbjct: 150 WTLDRQINLEGLSLVVGMAIADTLRRTGVR--NVKLKWPNDVLLNGRKLAGILVEIANRP 207

Query: 133 NGLQAVVVGIGLNVKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           N L  +V+G+G+N+           P   L       D   +   L Q+V   L  +++ 
Sbjct: 208 NNLHNLVIGLGINLSLPKQQNNITQPWAELIEVLPNFDRNKLIVSLSQNVLARLQQFEQV 267

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              ++    W       G+ + I      + G   G+D+ GY+ L  K+G V+    G++
Sbjct: 268 GIDKKFRLEWEEIDAYFGEEVNILSEKHKVTGIEQGIDERGYIQLITKEG-VQYFNAGEV 326


>gi|296268688|ref|YP_003651320.1| biotin/acetyl-CoA-carboxylase ligase [Thermobispora bispora DSM
           43833]
 gi|296091475|gb|ADG87427.1| biotin/acetyl-CoA-carboxylase ligase [Thermobispora bispora DSM
           43833]
          Length = 272

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 104/241 (43%), Gaps = 11/241 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI-SDKGNLYASLLLI 73
                    STN +  + A  G      +VA  Q+AGRGR    W    +  L  S+LL 
Sbjct: 32  SVTVVARTGSTNADLAEAARQGAAEGTVLVAEVQSAGRGRLGRTWTAPPRAGLTFSVLLR 91

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            ++       L     +A  S  A       DV++KWPND+LV +RK+ G+L E +   +
Sbjct: 92  PTVRPARQGWLMLLAGLAAAS--AIRRIAQVDVRLKWPNDLLVGERKLGGVLAERV---D 146

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G   V +GI + ++   +      +    +  C D   +   + +++      W +  G 
Sbjct: 147 GAVVVGIGINVTLRPDELPVEQATSLAIEKAACTDRDPLLRAILRELESHYRDWTEADGD 206

Query: 194 EEI---MNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            E     + +   +  +G  + ++L  G ++ G+  G+D  G+LL+   +G +  +  GD
Sbjct: 207 AEASGLRSAYLASSATVGREVRVELPGGYALTGQATGIDQDGHLLVR-AEGRLHTLSAGD 265

Query: 250 I 250
           +
Sbjct: 266 V 266


>gi|238917596|ref|YP_002931113.1| biotin-[acetyl-CoA-carboxylase] ligase / BirA family
           transcriptional regulator, biotin operon repressor
           [Eubacterium eligens ATCC 27750]
 gi|238872956|gb|ACR72666.1| biotin-[acetyl-CoA-carboxylase] ligase / BirA family
           transcriptional regulator, biotin operon repressor
           [Eubacterium eligens ATCC 27750]
          Length = 337

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 109/245 (44%), Gaps = 9/245 (3%)

Query: 14  FRYEFFDTISSTNDECMKRA-LSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
               ++D   STN+E  + A           +   QT GRGRR   W+S     ++ SLL
Sbjct: 85  REVVYYDETDSTNNEAKRAAERDNAADGTLYITESQTGGRGRRGRNWVSPAGSGIWMSLL 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIA---STLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           L   I+  + ++L+   A+A++  I           + +IKWPNDI++ ++K+ GIL E 
Sbjct: 145 LRPDIAPVNASMLTIVAAMAVQEAIHTVLKEDGHDAECRIKWPNDIVLNKKKVCGILTE