RPSBLAST alignment of GI: 254780868 and protein with PDBid: 1bia

>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Length = 321
 Score =  109 bits (272), Expect = 7e-25
 Identities = 61/247 (24%), Positives = 104/247 (42%), Gaps = 9/247 (3%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NL 66
                         I STN   + R      G+   +A  Q AGRGRR  KW S  G NL
Sbjct: 73  LGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGD-ACIAEYQQAGRGRRGRKWFSPFGANL 131

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           Y S+         +      ++ + +             V++KWPND+ +  RK+AGIL+
Sbjct: 132 YLSMFWRLEQGPAAAI--GLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQDRKLAGILV 189

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           E          +V+G G+N+    V+         +LQ  G  +D   + ++L +++   
Sbjct: 190 ELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAA 249

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L+L++++ G    ++ W      I   + + +    I G   G+D  G LLLE+    ++
Sbjct: 250 LELFEQE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQDGI-IK 307

Query: 244 QIFTGDI 250
               G+I
Sbjct: 308 PWMGGEI 314