RPSBLAST alignment of GI: 254780868 and protein with PDBid: 2dxu

>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Length = 235
 Score =  100 bits (250), Expect = 3e-22
 Identities = 64/236 (27%), Positives = 105/236 (44%), Gaps = 17/236 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L        IVA  QT G G  + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYLEE---GTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L      + +    V+ +      D +IKWPND+LV  +KIAG+L+E       
Sbjct: 69  KVPQKDLP---KIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKG---- 121

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
              +V+GIGLNV +   +    +         +    +F  L  ++ R+   + K+    
Sbjct: 122 -DKIVLGIGLNVNNKVPNGATSMKLELGSEVPLL--SVFRSLITNLDRLYLNFLKNPMD- 177

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +         +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 178 --ILNLVRDNMILGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230