>TIGR00414 serS seryl-tRNA synthetase; InterPro: IPR002317 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Seryl-tRNA synthetase (6.1.1.11 from EC) exists as monomer and belongs to class IIa .; GO: 0000166 nucleotide binding, 0004828 serine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006434 seryl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=99.36 E-value=2.4e-12 Score=97.50 Aligned_cols=174 Identities=20% Similarity=0.320 Sum_probs=154.4 Q ss_pred CCCCCHHCCCCHHHHHHHHHHHHHHHH-HHCCCEEEECCCCCCHHHHHHCC---CCHHHHHHHCCHHHCCCCCCEECCCC Q ss_conf 038811104316999999999999999-86698897357512468987719---73112222104021378620003455 Q gi|254780870|r 35 HSKGIYSWLPLGQKALDNVNAIIREEQ-NRTGAIEMSVPTLQSADLWVESG---RYDSYGKEMLRLADRNDKAMIYGPTH 110 (449) Q Consensus 35 ~~~G~~~~lP~G~~i~~~le~~~r~~~-~~~G~~ei~tP~l~~~eL~~~SG---h~d~~~~em~~~~d~~~~~~~LrP~~ 110 (449) T Consensus 190 ~g~~~~~~~~~~~~~~~al~~~~l~~~~~~~g~~~~~~p~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~~t~ 269 (460) T TIGR00414 190 AGSRFYYLKGDGAKLERALINFMLDLLREKNGYSELYPPYLVNEELLDGTGFNPQLPKFEEDLFKLEDTDDEKLYLIPTA 269 (460) T ss_pred HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCEEEEEECC T ss_conf 10101213213678999999999986443226401014035423443102456556530234432126777504652010 Q ss_pred CCCCCCCHHHCCCCC--CCCCEEEEECCCCCCCCC--CCC--CCCCCCEEEEEEECCEECCCHHHHHHHHHHHHHHHHHH Q ss_conf 543101100001342--013402641465334566--767--54345316687404221188688799999999987411 Q gi|254780870|r 111 EEVMTDIFRSHIKSY--RNLPFTFYQIQLKFRDEL--RPR--FGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRI 184 (449) Q Consensus 111 ~e~~~~i~~~~~~SY--r~LPlr~y~ig~~fR~E~--rp~--~GL~R~ReF~q~D~~~F~~~~e~~~~e~~~~~~~~~~i 184 (449) T Consensus 270 e~~~~~~~~~~~~~~~~~~lp~~~~~~~~cfr~eag~~g~~~~g~~r~h~f~k~e~~~~-~~p~~~~~~~~~~~~~~~~~ 348 (460) T TIGR00414 270 EVPLTNLHRDEILDLPSEELPIKYTGYSPCFRSEAGSYGKDTKGLIRVHQFNKVELVKF-CKPEESWEELEELLSDAEKI 348 (460) T ss_pred HHHHHHHHHHHHCCCCCCCCCEEHCCCCHHHHHHCCCCCCCCHHHHHHHHCCCEEEEEE-ECCHHHHHHHHHHHHHHHHH T ss_conf 00122222000102652103400000220233321345541000121110031024566-35401489999998789999 Q ss_pred HHHCCCHHHHHHHCCHHCCCCHHHH Q ss_conf 1100620122331100101311334 Q gi|254780870|r 185 FHRLGLKSIPMRAESGPIGGDLSHE 209 (449) Q Consensus 185 ~~~lgl~~~~v~~~~~~ig~~~s~e 209 (449) T Consensus 349 ~~~l~~p~~~~~~~~gd~g~~~~~~ 373 (460) T TIGR00414 349 LQELELPYRVLNLCTGDLGFGAAKK 373 (460) T ss_pred HHHHCCCHHHHEECCCCCCCCCCCC T ss_conf 9974375111000124346420110

HHsearch alignment for GI: 254780870 and conserved domain: TIGR00414