>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes. It is responsible for the attachment of glycine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP binding and hydrolysis. This alignment contains only sequences from the GlyRS form which homodimerizes. The heterotetramer glyQ is in a different family of class II aaRS. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. This domain is also found at the N-terminus of the accessory subunit of mitochondrial polymerase gamma (Pol gamma b). Pol gamma b stimulates processive DNA synthesis and is functional as a homodimer, which can associate with the catalytic subunit Pol gamma alpha to form a heterotrimer. Despite significant both structural and sequence similarity with Gly

Probab=99.93 E-value=2.4e-26 Score=186.02 Aligned_cols=155 Identities=25% Similarity=0.411 Sum_probs=124.6 Q ss_pred HHHHHCCCEECC------CCCHHCCCCHHHHHHHHHHHHHHHHH--HCCCEEEECCCCCCHHHHHHC-CCCHHHHHHHCC Q ss_conf 213530320003------88111043169999999999999998--669889735751246898771-973112222104 Q gi|254780870|r 25 LMLRTGMIHQHS------KGIYSWLPLGQKALDNVNAIIREEQN--RTGAIEMSVPTLQSADLWVES-GRYDSYGKEMLR 95 (449) Q Consensus 25 ll~~~g~i~~~~------~G~~~~lP~G~~i~~~le~~~r~~~~--~~G~~ei~tP~l~~~eL~~~S-Gh~d~~~~em~~ 95 (449) T Consensus 4 l~kRRgF~~ps~eIYGG~ag~yDyGPlG~~LK~Ni~~~W~~~fv~~~~~~~~id~~ii~p~LmF~T~iG~~--------- 74 (254) T cd00774 4 LAKRRGFVFPSSEIYGGVAGFYDYGPLGVELKNNIKSAWRKSFVLEEEDMLEIDSPIITPELMFKTSIGPV--------- 74 (254) T ss_pred HHHHCCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCEECCCCCC--------- T ss_conf 78406874558511468310615482379999999999999987437987995410036632200121565--------- Q ss_pred HHHCCCCCCEECCCCCCCCCCCHHHCCCCC-CCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCEECCCHHHHHHHH Q ss_conf 021378620003455543101100001342-0134026414653345667675434531668740422118868879999 Q gi|254780870|r 96 LADRNDKAMIYGPTHEEVMTDIFRSHIKSY-RNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSY 174 (449) Q Consensus 96 ~~d~~~~~~~LrP~~~e~~~~i~~~~~~SY-r~LPlr~y~ig~~fR~E~rp~~GL~R~ReF~q~D~~~F~~~~e~~~~e~ 174 (449) T Consensus 75 --~~~~~~~yLRPETAQGifvnFk~~~~~~r~kLPFGiaQIGk~FRNEIsPr~~l~R~REF~q~EiE~F-~~P~~~~~~~ 151 (254) T cd00774 75 --ESGGNLGYLRPETAQGIFVNFKNLLEFNRRKLPFGVAQIGKSFRNEISPRNGLFRVREFTQAEIEFF-VDPEKSHPWF 151 (254) T ss_pred --CCCCCCEEECHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCHHCHHHHEEEEE-ECCCCCHHHH T ss_conf --5898603536345347798789999964888884456542022673477767540000021257888-5798642578 Q ss_pred HHHHHHHHHHHHHCCCH Q ss_conf 99999874111100620 Q gi|254780870|r 175 NKMFVSYLRIFHRLGLK 191 (449) Q Consensus 175 ~~~~~~~~~i~~~lgl~ 191 (449) T Consensus 152 ~~w~~~~l~~~~~~~~~ 168 (254) T cd00774 152 DYWADQRLKWLPKFAQS 168 (254) T ss_pred HHHHHHHHHHHHHHCCC T ss_conf 99999998663873899

HHsearch alignment for GI: 254780870 and conserved domain: cd00774