BLAST/PSIBLAST alignment of GI: 254780871 and GI: 315122707 at iteration 1
>gi|315122707|ref|YP_004063196.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 228
>gi|313496109|gb|ADR52708.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 228
 Score =  355 bits (910), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 202/224 (90%)

Query: 1   MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLE 60
           + + EVLLLQN+KHSY QVGK FPVLENVHLSLKKGE+VALVSPSGTGKSTILHIAGLLE
Sbjct: 2   LSNTEVLLLQNIKHSYYQVGKYFPVLENVHLSLKKGEMVALVSPSGTGKSTILHIAGLLE 61

Query: 61  VPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINH 120
            PD+G++II +Q CN+LSD+KK+FLRC+KIGFVYQ HRLL DFSVIENII PQIIAG++H
Sbjct: 62  NPDKGDIIIDSQSCNQLSDEKKAFLRCTKIGFVYQAHRLLTDFSVIENIIIPQIIAGVDH 121

Query: 121 KTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLK 180
            TA+QRAM++L YM M+ YANR SSDISGGEQQRVAICRA+ANKPLIILADEPTGNLD K
Sbjct: 122 NTAHQRAMEILDYMGMAPYANRNSSDISGGEQQRVAICRAVANKPLIILADEPTGNLDPK 181

Query: 181 TAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMI 224
           TAQ+VF  LK LV R GLA L+ATHNHDLASQMDRQITI+DGMI
Sbjct: 182 TAQRVFGFLKDLVARFGLATLVATHNHDLASQMDRQITIKDGMI 225