RPSBLAST alignment for GI: 254780871 and conserved domain: TIGR03258

>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate. Length = 362
 Score = 95.8 bits (238), Expect = 9e-21
 Identities = 59/208 (28%), Positives = 99/208 (47%), Gaps = 12/208 (5%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPD--QGNVIIANQLCNKLSDDK 81
           VL+++ L ++ GE++AL+  SG GK+T+L  IAG ++      G + IA++        K
Sbjct: 20  VLDDLSLEIEAGELLALIGKSGCGKTTLLRAIAGFVK-AAGLTGRIAIADRDLTHAPPHK 78

Query: 82  KSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYAN 141
           +       +  ++Q + L     V +N+ F      +      +R  D L  + +   A 
Sbjct: 79  RG------LALLFQNYALFPHLKVEDNVAFGLRAQKMPKADIAERVADALKLVGLGDAAA 132

Query: 142 RRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVR-SGLAA 200
              + +SGG QQR+AI RAIA +P ++L DEP   LD      +   +  L      L  
Sbjct: 133 HLPAQLSGGMQQRIAIARAIAIEPDVLLLDEPLSALDANIRANMREEIAALHEELPELTI 192

Query: 201 LIATHNHDLASQM-DRQITIRDGMIADL 227
           L  TH+ D A  + D+   ++DG +A  
Sbjct: 193 LCVTHDQDDALTLADKAGIMKDGRLAAH 220