RPSBLAST alignment for GI: 254780871 and conserved domain: PRK13631

>gnl|CDD|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 320
 Score = 75.3 bits (185), Expect = 1e-14
 Identities = 56/237 (23%), Positives = 111/237 (46%), Gaps = 26/237 (10%)

Query: 5   EVLLLQNVKHSY-RQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTIL-HIAGLLEVP 62
            +L ++N+   +  +       L N+  + +K +I  ++  SG+GKST++ H  GL++  
Sbjct: 20  IILRVKNLYCVFDEKQENELVALNNISYTFEKNKIYFIIGNSGSGKSTLVTHFNGLIK-S 78

Query: 63  DQGNVIIAN-----------QLCNKLSDDKKSFLRCSK-IGFVYQ--EHRLLMDFSVIEN 108
             G + + +            + N  S   K+F    + +  V+Q  E++L  D ++ ++
Sbjct: 79  KYGTIQVGDIYIGDKKNNHELITNPYSKKIKNFKELRRRVSMVFQFPEYQLFKD-TIEKD 137

Query: 109 IIFPQIIAGINHKTAYQRAMDLLSYMDM-SQYANRRSSDISGGEQQRVAICRAIANKPLI 167
           I+F  +  G+    A + A   L+ M +   Y  R    +SGG+++RVAI   +A +P I
Sbjct: 138 IMFGPVALGVKKSEAKKLAKFYLNKMGLDDSYLERSPFGLSGGQKRRVAIAGILAIQPEI 197

Query: 168 ILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMI 224
           ++ DEPT  LD K   ++  ++      +     + TH       M+  + + D +I
Sbjct: 198 LIFDEPTAGLDPKGEHEMMQLILD-AKANNKTVFVITH------TMEHVLEVADEVI 247