RPSBLAST alignment for GI: 254780871 and conserved domain: TIGR02857

>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD. Length = 529
 Score =  112 bits (283), Expect = 7e-26
 Identities = 65/227 (28%), Positives = 103/227 (45%), Gaps = 22/227 (9%)

Query: 2   DSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLE 60
             A  L    +  +Y   G+  P L  V  ++  GE VALV PSG GKST+L+ + G ++
Sbjct: 316 APAPSLEFSGLSVAYP--GRRAPALRPVSFTVPPGERVALVGPSGAGKSTLLNLLLGFVD 373

Query: 61  VPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINH 120
            P +G++ +       L+D      R  +I +V Q H  L   ++ ENI   +  A    
Sbjct: 374 -PTEGSIAVNGV---PLADADADSWR-DQIAWVPQ-HPFLFAGTIAENIRLARPDAS--- 424

Query: 121 KTAYQRAMDLLSYMDMSQYA--------NRRSSDISGGEQQRVAICRAIANKPLIILADE 172
               +RA++     +                 + +SGG+ QR+A+ RA      ++L DE
Sbjct: 425 DAEIRRALERAGLDEFVAALPQGLDTLIGEGGAGLSGGQAQRLALARAFLRDAPLLLLDE 484

Query: 173 PTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITI 219
           PT +LD +T   V   L+ L    G   L+ TH   LA + DR + +
Sbjct: 485 PTAHLDAETEALVTEALRAL--AQGRTVLLVTHRLALAERADRIVVL 529