RPSBLAST alignment for GI: 254780871 and conserved domain: PRK14273

>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional. Length = 254
 Score = 76.6 bits (188), Expect = 5e-15
 Identities = 64/219 (29%), Positives = 106/219 (48%), Gaps = 24/219 (10%)

Query: 23  FPVLENVHLSLKKGEIVALVSPSGTGKSTILH----IAGLLE-VPDQGNVIIANQLCNKL 77
           F  L N+++ + K  I AL+ PSG GKST L     +  L+E +  +GNVI   +  N  
Sbjct: 20  FKALNNINIKILKNSITALIGPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGK--NIY 77

Query: 78  SDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMS 137
           S++        KIG V+Q     +  S+ +NI +   I G   K    + +D +    + 
Sbjct: 78  SNNFDILELRRKIGMVFQTPNPFL-MSIYDNISYGPKIHGTKDK----KKLDEIVEQSLK 132

Query: 138 QYA---------NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSI 188
           + A         N  +  +SGG+QQR+ I R +A +P +IL DEPT  LD  +  ++  +
Sbjct: 133 KSALWNEVKDKLNTNALSLSGGQQQRLCIARTLAIEPNVILMDEPTSALDPISTGKIEEL 192

Query: 189 LKYLVVRSGLAALIATHNHDLASQM-DRQITIRDGMIAD 226
           +  + ++     +I THN   A ++ DR     +G I +
Sbjct: 193 I--INLKESYTIIIVTHNMQQAGRISDRTAFFLNGCIEE 229