RPSBLAST alignment for GI: 254780871 and conserved domain: PRK10636

>gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional. Length = 638
 Score = 40.2 bits (94), Expect = 5e-04
 Identities = 58/214 (27%), Positives = 94/214 (43%), Gaps = 38/214 (17%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQGNVIIANQLCNKLSDDKKS 83
           +L+++ L+L  G  + L+  +G GKST++  +AG L  P  G + +A  +          
Sbjct: 327 ILDSIKLNLVPGSRIGLLGRNGAGKSTLIKLLAGELA-PVSGEIGLAKGI---------- 375

Query: 84  FLRCSKIGFVYQEHRLLM---DFSVIENIIFPQIIAGINHKTAYQRAMDLLSYM----DM 136
                K+G+  Q H+L     D S +      Q +A +  +   Q+  D L       D 
Sbjct: 376 -----KLGYFAQ-HQLEFLRADESPL------QHLARLAPQELEQKLRDYLGGFGFQGDK 423

Query: 137 SQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSIL----KYL 192
                RR    SGGE+ R+ +   +  +P ++L DEPT +LDL   Q +   L      L
Sbjct: 424 VTEETRR---FSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQALTEALIDFEGAL 480

Query: 193 VVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226
           VV S    L+ +   DL    D ++   DG + D
Sbjct: 481 VVVSHDRHLLRSTTDDLYLVHDGKVEPFDGDLED 514