RPSBLAST alignment for GI: 254780871 and conserved domain: PRK13638

>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 271
 Score = 62.3 bits (151), Expect = 9e-11
 Identities = 51/189 (26%), Positives = 98/189 (51%), Gaps = 8/189 (4%)

Query: 24  PVLENVHLSLKKGEIVALVSPSGTGKSTI-LHIAGLLEVPDQGNVIIANQLCNKLSDDKK 82
           PVL+ ++L      +  LV  +G GKST+ ++++GLL  P +G V+   +    L   K+
Sbjct: 15  PVLKGLNLDFSLSPVTGLVGANGCGKSTLFMNLSGLLR-PQKGAVLWQGK---PLDYSKR 70

Query: 83  SFLRC-SKIGFVYQEHRLLMDFSVIE-NIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYA 140
             L    ++  V+Q+    + ++ I+ +I F     G+      +R  + L+ +D   + 
Sbjct: 71  GLLALRQQVATVFQDPEQQIFYTDIDSDIAFSLRNLGVPEAEITRRVDEALTLVDAQHFR 130

Query: 141 NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAA 200
           ++    +S G+++RVAI  A+  +   +L DEPT  LD     Q+ +I++  +V  G   
Sbjct: 131 HQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDPAGRTQMIAIIRR-IVAQGNHV 189

Query: 201 LIATHNHDL 209
           +I++H+ DL
Sbjct: 190 IISSHDIDL 198