RPSBLAST alignment for GI: 254780871 and conserved domain: PRK14249

>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional. Length = 251
 Score = 62.8 bits (152), Expect = 6e-11
 Identities = 54/204 (26%), Positives = 99/204 (48%), Gaps = 27/204 (13%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPD-------QGNVIIANQLCNKL 77
           VL+N+++   + +I A++ PSG GKST+L    L  + D       +G V++ N+  N  
Sbjct: 19  VLKNINMDFPERQITAIIGPSGCGKSTLLR--ALNRMNDIVSGARLEGAVLLDNE--NIY 74

Query: 78  SDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGIN---------HKTAYQRAM 128
           S +        ++G V+Q+       S+ +N+ F   + G            K+  Q A+
Sbjct: 75  SPNLDVVNLRKRVGMVFQQPNPFPK-SIFDNVAFGPRMLGTTAQSRLDEVVEKSLRQAAL 133

Query: 129 DLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSI 188
               + ++    ++    +SGG+QQR+ I R +A +P +IL DEP   LD  +  ++  +
Sbjct: 134 ----WDEVKDNLHKSGLALSGGQQQRLCIARVLAIEPEVILMDEPCSALDPVSTMRIEEL 189

Query: 189 LKYLVVRSGLAALIATHNHDLASQ 212
           ++ L     +A  I THN   A++
Sbjct: 190 MQELKQNYTIA--IVTHNMQQAAR 211