RPSBLAST alignment for GI: 254780871 and conserved domain: PRK14267

>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional. Length = 253
 Score = 63.3 bits (154), Expect = 4e-11
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 21/203 (10%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAG-LLEVPD----QGNVIIANQLCNKLSD 79
           V++ V L + +  + AL+ PSG GKST+L     LLE+ +    +G V +  +  N  S 
Sbjct: 19  VIKGVDLKIPQNGVFALMGPSGCGKSTLLRTFNRLLELNEEARVEGEVRLFGR--NIYSP 76

Query: 80  DKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQY 139
           D        ++G V+Q        ++ +N+    I   +N     ++ +D      + + 
Sbjct: 77  DVDPIEVRREVGMVFQYPNPFPHLTIYDNV---AIGVKLNGLVKSKKELDERVEWALKKA 133

Query: 140 A---------NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILK 190
           A         N   S++SGG++QR+ I RA+A KP I+L DEPT N+D     ++  +L 
Sbjct: 134 ALWDEVKDRLNDYPSNLSGGQRQRLVIARALAMKPKILLMDEPTANIDPVGTAKIEELL- 192

Query: 191 YLVVRSGLAALIATHNHDLASQM 213
              ++     ++ TH+   A+++
Sbjct: 193 -FELKKEYTIVLVTHSPAQAARV 214