RPSBLAST alignment for GI: 254780871 and conserved domain: COG1132

>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]. Length = 567
 Score = 96.7 bits (240), Expect = 5e-21
 Identities = 70/228 (30%), Positives = 108/228 (47%), Gaps = 21/228 (9%)

Query: 7   LLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQG 65
           +  +NV  SY       PVL+++  S++ GE VA+V PSG+GKST++  +  L + P  G
Sbjct: 329 IEFENVSFSY---PGKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYD-PTSG 384

Query: 66  NVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIF-------PQIIAGI 118
            ++I       + D     LR  +IG V Q+  LL   ++ ENI          +I   +
Sbjct: 385 EILIDGI---DIRDISLDSLR-KRIGIVSQDP-LLFSGTIRENIALGRPDATDEEIEEAL 439

Query: 119 NHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLD 178
               A++   +L    D       R  ++SGG++QR+AI RA+   P I++ DE T  LD
Sbjct: 440 KLANAHEFIANLPDGYDT--IVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALD 497

Query: 179 LKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226
            +T   +   LK L    G   LI  H        DR I + +G I +
Sbjct: 498 TETEALIQDALKKL--LKGRTTLIIAHRLSTIKNADRIIVLDNGRIVE 543