RPSBLAST alignment for GI: 254780871 and conserved domain: COG4148

>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352
 Score = 93.0 bits (231), Expect = 6e-20
 Identities = 56/191 (29%), Positives = 102/191 (53%), Gaps = 13/191 (6%)

Query: 38  IVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSD-DKKSFLRCSK--IGFVY 94
           I AL  PSG+GK++++++   L  PD+G + +  ++   L D +K  FL   K  IG+V+
Sbjct: 26  ITALFGPSGSGKTSLINMIAGLTRPDEGRIELNGRV---LVDAEKGIFLPPEKRRIGYVF 82

Query: 95  QEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQR 154
           Q+ RL   ++V  N+ +         K+   +   L++ + +    +R    +SGGE+QR
Sbjct: 83  QDARLFPHYTVRGNLRYGM------WKSMRAQFDQLVALLGIEHLLDRYPGTLSGGEKQR 136

Query: 155 VAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQM- 213
           VAI RA+   P ++L DEP  +LDL   +++   L+ L     +  L  +H+ D   ++ 
Sbjct: 137 VAIGRALLTAPELLLMDEPLASLDLPRKREILPYLERLRDEINIPILYVSHSLDEVLRLA 196

Query: 214 DRQITIRDGMI 224
           DR + + +G +
Sbjct: 197 DRVVVLENGKV 207