RPSBLAST alignment for GI: 254780871 and conserved domain: cd03237

>gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 246
 Score = 64.9 bits (158), Expect = 2e-11
 Identities = 39/192 (20%), Positives = 85/192 (44%), Gaps = 22/192 (11%)

Query: 32  SLKKGEIVALVSPSGTGKSTILHI-AGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKI 90
           S+ + E++ ++ P+G GK+T + + AG+L+ PD+G++ I       +S            
Sbjct: 21  SISESEVIGILGPNGIGKTTFIKMLAGVLK-PDEGDIEIELD---TVS------------ 64

Query: 91  GFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGG 150
              Y+   +  D+      +   I         ++   ++   + + Q  +R   ++SGG
Sbjct: 65  ---YKPQYIKADYEGTVRDLLSSITKDFYTHPYFK--TEIAKPLQIEQILDREVPELSGG 119

Query: 151 EQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLA 210
           E QRVAI   ++    I L DEP+  LD++       +++     +   A +  H+  + 
Sbjct: 120 ELQRVAIAACLSKDADIYLLDEPSAYLDVEQRLMASKVIRRFAENNEKTAFVVEHDIIMI 179

Query: 211 SQMDRQITIRDG 222
             +  ++ + +G
Sbjct: 180 DYLADRLIVFEG 191