>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. This family consists of (Uracil-5-)-methyltransferases EC:2.1.1.35 from bacteria, archaea and eukaryotes. A 5-methyluridine (m(5)U) residue at position 54 is a conserved feature of bacterial and eukaryotic tRNAs. The methylation of U54 is catalysed by the tRNA(m5U54)methyltransferase, which in Saccharomyces cerevisiae is encoded by the nonessential TRM2 gene. It is thought that tRNA modification enzymes might have a role in tRNA maturation not necessarily linked to their known catalytic activity.

Probab=98.44 E-value=4.5e-07 Score=64.50 Aligned_cols=58 Identities=28% Similarity=0.326 Sum_probs=51.9 Q ss_pred CCEEEECCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHCCCC-CCCCCCCCCCCC Q ss_conf 6288856985699999973198169952135677888865310112-111122100123 Q gi|254780872|r 68 LRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNI-NIDYRVSCAEEI 125 (254) Q Consensus 68 ~~VLDiGCG~G~~s~~la~~g~~V~giD~S~~~i~~Ak~~a~~~~~-~i~~~~~~~~~l 125 (254) T Consensus 199 ~~vlDlYcG~Gtfsl~lA~~~~~V~GvE~~~~AV~~A~~Na~~N~i~Nv~f~~~~~~~~ 257 (353) T pfam05958 199 GDLLELYCGNGNFSLALAQNFRRVLATEIAKPSVNAAQYNIAANNIDNVQIIRMSAEEF 257 (353) T ss_pred CCEEEEECCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCHHHH T ss_conf 95899846888888999864787999962599999999989986998649997289999

HHsearch alignment for GI: 254780872 and conserved domain: pfam05958