>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates. They catalyse the reversible transfer of the gamma-phosphoryl group from an ATP donor to UMP, yielding UDP, which is the starting point for the synthesis of all other pyrimidine nucleotides. The eukaryotic enzyme has a dual specificity, phosphorylating both UMP and CMP, while the bacterial enzyme is specific to UMP. The bacterial enzyme shows no sequence similarity to the eukaryotic enzyme or other nucleoside monophosphate kinases, but rather appears to be part of the amino acid kinase family. It is dependent on magnesium for activity and is activated by GTP and repressed by UTP , . In many bacterial genomes, the gene tends to be located immediately downstream of elongation factor T and upstream of ribosome recycling factor. A related protein family, believed to be equivalent in function is found in the archaea and in spirochetes. Structurally, the bacterial and archaeal proteins are homohexamers centred around a hollow nucleus and organised as a trimer of dimers , . Each monomer within the protein forms the amino acid kinase fold and can be divided into an N-terminal region which binds UMP and mediates intersubunit interactions within the dimer, and a C-terminal region which binds ATP and contains a mobile loop covering the active site. Inhibition of enzyme activity by UTP appears to be due to competition for the binding site for UMP, not allosteric inhibition as was previously suspected. This entry represents the bacterial proteins..

Probab=99.96 E-value=7.5e-29 Score=214.14 Aligned_cols=217 Identities=28% Similarity=0.403 Sum_probs=179.7 Q ss_pred CEEEEEECCCCCC--------CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCHHHHHH--HHH Q ss_conf 6699960858458--------889999999999999967998899980687304899999998614899889999--998 Q gi|254780873|r 2 ARIVMKFGGTSVA--------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDV--VIS 71 (411) Q Consensus 2 ~~iV~KfGGtSv~--------~~~~i~~v~~~i~~~~~~g~~~ivVvSA~~g~Td~L~~l~~~~~~~~~~~~~d~--i~s 71 (411) T Consensus 2 kRvLlKLSGEaL~g~~~~f~ID~~~l~~iA~eik~~~~~G~evgIViG--GG--NIfRG~~~~~~Gi~R-~~aDymGMLA 76 (236) T TIGR02075 2 KRVLLKLSGEALAGKDSQFGIDPKRLNRIANEIKEVVKKGIEVGIVIG--GG--NIFRGKSAAELGIDR-VSADYMGMLA 76 (236) T ss_pred CEEEEEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEC--CH--HHHHHHHHHHCCCCE-EECCCCCHHH T ss_conf 648999610432478888642689999999999999867948999977--82--788778898748961-1143230589 Q ss_pred HHHHHHHHHHHHHHHHCCCCCCCCC-CCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHHCCEEEEECCCCCCCCCCEEEEC Q ss_conf 3129999999999984399863567-3324551213355200012-3621003343106805860343335568424430 Q gi|254780873|r 72 TGEQVSSGLMVLALQSLGIQAISLQ-GWQIPIMTDSLHGMARICR-VDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLG 149 (411) Q Consensus 72 ~GE~~s~~l~a~~l~~~G~~a~~l~-~~~~~i~t~~~~~~a~~~~-~~~~~l~~~l~~~~v~v~~Gf~g~~~~g~~ttlg 149 (411) T Consensus 77 T--viNglaL~~~L~~~g~~~~V~Sfai~~~~---------~i~E~Y~~~~a~~~le~g~vVIF~g---GtGnPfFTT-- 140 (236) T TIGR02075 77 T--VINGLALKDALEKLGLKTRVLSFAISMPK---------QICESYIRRKAIKHLEKGKVVIFSG---GTGNPFFTT-- 140 (236) T ss_pred H--HHHHHHHHHHHHHCCCCEEEEEEEEECCC---------CCCCCCCHHHHHHHHHCCCEEEEEC---CCCCCCCHH-- T ss_conf 9--99999999888736995689877753586---------4132322789999853597899955---898696321-- Q ss_pred CCCCCHHHHHHHHHHCHHHHHHHCC-HHHHEECCCCCCCCCCEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEE Q ss_conf 6862428999998847345565346-144024584212344110567999999988403110137887643313852676 Q gi|254780873|r 150 RGGSDTSAVAIAAAIKADRCDIYTD-VCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFV 228 (411) Q Consensus 150 RGGSD~tA~~ia~~l~A~~~~i~td-V~Gi~taDPr~v~~a~~i~~lsy~Ea~eLa~~Gakvlhp~~~~~~~~~~ipi~i 228 (411) T Consensus 141 ----DtaA~LRAiEi~aD~~Lkgt~GVDGVY~~DPkknk~A~~y~~itY~~~L~~---~L~VMD~TA~~La~dnnlpi~V 213 (236) T TIGR02075 141 ----DTAAALRAIEINADVILKGTNGVDGVYTADPKKNKDAKKYDTITYNEVLKK---NLKVMDLTAFSLAKDNNLPIVV 213 (236) T ss_pred ----HHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCEECCCCCHHHHHHC---CCCHHHHHHHHHHHHCCCCEEE T ss_conf ----158887666431347998104888023587885987523166798999861---4711358999999877897599 Q ss_pred ECCCCCCC-----CCCCCCCCCC Q ss_conf 11237777-----7654354545 Q gi|254780873|r 229 RSSFEDHG-----QQEQLGTLIC 246 (411) Q Consensus 229 ~ntf~~~~-----~~~~~GT~I~ 246 (411) T Consensus 214 FnI~~~g~l~~vi~g~~~gTlv~ 236 (236) T TIGR02075 214 FNIDEPGALKKVILGKGIGTLVS 236 (236) T ss_pred ECCCCCCHHHHHHCCCCCEEEEC T ss_conf 66665301645322784457528

HHsearch alignment for GI: 254780873 and conserved domain: TIGR02075