>cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII. This CD includes the first of two ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. Bacillus subtilis YclM is reported to be a single polypeptide of 50 kD. AKIII from Bacillus subtilis strain 168 is induced by lysine and repressed by threonine and it is synergistically inhibited by lysine and threonine. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=97.33 E-value=0.00024 Score=49.11 Aligned_cols=70 Identities=20% Similarity=0.310 Sum_probs=57.9 Q ss_pred CHHCCC--CCCCCCCCCCHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEECCHHHHH--HHHHHHHHHHHHCCCCEEEEE Q ss_conf 000127--7500048410001455412850111234432222333101212302477--668878988860596158974 Q gi|254780873|r 267 AQISLR--RLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLE--KALAVLSDNKENIGYDVIQHE 342 (411) Q Consensus 267 ~~Iti~--~~~~~~g~~a~If~~La~~~I~VdmI~qs~s~~~~~~~Isf~i~~~d~~--~~~~~L~~~~~~~~~~~I~~~ 342 (411) T Consensus 2 ~~I~I~K~lMN~EvGF~rKvL~IlE~~~IS~EHmPSGID------~~siiv~~~~l~~~~~~~ii~~I~~~l~pD~i~i~ 75 (76) T cd04911 2 CSIYISKYLMNREVGFGRKLLSILEDNGISYEHMPSGID------DISIIIRDNQLTDEKEQKILAEIKEELHPDEIEII 75 (76) T ss_pred EEEEEEHHHHCHHHHHHHHHHHHHHHCCCCEEECCCCCC------EEEEEEEHHHCCCHHHHHHHHHHHHHCCCCEEEEE T ss_conf 299987877020464899999999983998645588866------08999886874705899999999976299779986

HHsearch alignment for GI: 254780873 and conserved domain: cd04911